Citrus Sinensis ID: 039157

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MASPLAYKDAADGIAKEYLIDKDTEACRDTLRAIVAVLHDTNKNKNLNPNDIPGFGRYTASYLVHRLASETKSWYGVLGLKEGRGGGATRVEEINKHYEVLSTLFQQPNMCSFVEVKNANKLVTEAWEVLSDARRKEAYDLLMGFTNRKNNNVINVQFVKSSETFRNPSSASSSTASSPLPLLDHRAVTRKIVKISRPPPKSPNLFL
ccccccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccEEEcccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccc
cccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHcccccccccccHHHHHHHHHHHHHHHHcccHHHHEccccccccccccHHHHHHHHHHHHHHHHcccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEcccccccccccccccccccccccccHHHHHHHEEccccccccccccc
MASPLAYKDAADGIAKEYLIDKDTEACRDTLRAIVAVLHdtnknknlnpndipgfgRYTASYLVHRLASETKSWYgvlglkegrgggatRVEEINKHYEVLSTLfqqpnmcsfvevKNANKLVTEAWEVLSDARRKEAYDLLMGFTnrknnnviNVQFVKssetfrnpssassstassplplldhraVTRKIvkisrpppkspnlfl
masplaykdaaDGIAKEYLIDKDTEACRDTLRAIVAVlhdtnknknlnpndipgFGRYTASYLVHRLASETKSWYGVLGLKEGRGGGATRVEEINKHYEVLSTLFQQPNMCSFVEVKNANKLVTEAWEVLSDARRKEAYDLLMGftnrknnnvINVQFVKSSetfrnpssassstassplplldHRAVTrkivkisrpppkspnlfl
MASPLAYKDAADGIAKEYLIDKDTEACRDTLRAIVAVLHDTNKNKNLNPNDIPGFGRYTASYLVHRLASETKSWYgvlglkegrgggATRVEEINKHYEVLSTLFQQPNMCSFVEVKNANKLVTEAWEVLSDARRKEAYDLLMGFTNRKNNNVINVQFVKSSETFRNpssassstassplpllDHRAVTRKIVKISRPPPKSPNLFL
**********ADGIAKEYLIDKDTEACRDTLRAIVAVLHDTNKNKNLNPNDIPGFGRYTASYLVHRLASETKSWYGVLGLKEGRGGGATRVEEINKHYEVLSTLFQQPNMCSFVEVKNANKLVTEAWEVLSDARRKEAYDLLMGFTNRKNNNVINVQFV************************************************
***********************TEA*RDTLRAIVAVLHDTNKNKNLNPNDIPGFGRYTASYLVHRLASETKSWYGVLGLKEGRGG*ATRVEEINKHYEVLSTLFQQPNMCSFVEVKNANKLVTEAWEVLSDARRKEAYDL******************************************************************
MASPLAYKDAADGIAKEYLIDKDTEACRDTLRAIVAVLHDTNKNKNLNPNDIPGFGRYTASYLVHRLASETKSWYGVLGLKEGRGGGATRVEEINKHYEVLSTLFQQPNMCSFVEVKNANKLVTEAWEVLSDARRKEAYDLLMGFTNRKNNNVINVQFVKSS****************PLPLLDHRAVTRKIVKISRPPPKSPNLFL
**SPLAYKDAADGIAKEYLIDKDTEACRDTLRAIVAVLHDTNKNKNLNPNDIPGFGRYTASYLVHRLASETKSWYGVLGLKEGRGGGATRVEEINKHYEVLSTLFQQPNMCSFVEVKNANKLVTEAWEVLSDARRKEAYDLLMGFTNRKNNNVINVQFVKS******************LPLLDHRAVTRKIVKISRPPPKS*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASPLAYKDAADGIAKEYLIDKDTEACRDTLRAIVAVLHDTNKNKNLNPNDIPGFGRYTASYLVHRLASETKSWYGVLGLKEGRGGGATRVEEINKHYEVLSTLFQQPNMCSFVEVKNANKLVTEAWEVLSDARRKEAYDLLMGFTNRKNNNVINVQFVKSSETFRNPSSASSSTASSPLPLLDHRAVTRKIVKISRPPPKSPNLFL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query207
413918136 734 hypothetical protein ZEAMMB73_168515 [Ze 0.487 0.137 0.361 1e-05
308080522 736 uncharacterized protein LOC100501122 [Ze 0.487 0.137 0.361 2e-05
242072738 735 hypothetical protein SORBIDRAFT_06g01391 0.487 0.137 0.352 4e-05
357163081 738 PREDICTED: uncharacterized protein LOC10 0.487 0.136 0.344 0.0002
38344577 729 OSJNBa0053B21.9 [Oryza sativa Japonica G 0.487 0.138 0.344 0.0007
125548065 735 hypothetical protein OsI_15662 [Oryza sa 0.487 0.137 0.344 0.0007
>gi|413918136|gb|AFW58068.1| hypothetical protein ZEAMMB73_168515 [Zea mays] Back     alignment and taxonomy information
 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 61/119 (51%), Gaps = 18/119 (15%)

Query: 43  KNKNLNPNDIPGFGRYTASYLVHRLASETK-----SWYGVLGLKEGRGGGATRVEEINKH 97
           K +NL P  + G  +  ++  VH LA+E+K      WY +L L     G     EE+ K 
Sbjct: 35  KAQNLCPT-LEGILQMVSTLEVH-LAAESKIDGESDWYRILSL-----GAFADEEEVKKQ 87

Query: 98  YEVLSTLFQQPNMCSFVEVKNANKLVTEAWEVLSDARRKEAYDLLMGFTNRKNNNVINV 156
           Y  L+ L   P+    V  + A KL++EAW VLSD  RK  YD       R+N++V+NV
Sbjct: 88  YRKLALLLH-PDKNKSVGAEEAFKLISEAWSVLSDTSRKVVYD-----EKRRNHSVVNV 140

Source: Zea mays

Species: Zea mays

Genus: Zea

Family: Poaceae

Order: Poales

Class: Liliopsida

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|308080522|ref|NP_001182861.1| uncharacterized protein LOC100501122 [Zea mays] gi|238007816|gb|ACR34943.1| unknown [Zea mays] gi|414587576|tpg|DAA38147.1| TPA: hypothetical protein ZEAMMB73_576845 [Zea mays] Back     alignment and taxonomy information
>gi|242072738|ref|XP_002446305.1| hypothetical protein SORBIDRAFT_06g013910 [Sorghum bicolor] gi|241937488|gb|EES10633.1| hypothetical protein SORBIDRAFT_06g013910 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|357163081|ref|XP_003579619.1| PREDICTED: uncharacterized protein LOC100838049 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|38344577|emb|CAE05535.2| OSJNBa0053B21.9 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|125548065|gb|EAY93887.1| hypothetical protein OsI_15662 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

No hits with e-value below 0.001 by BLAST

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
pfam0022663 pfam00226, DnaJ, DnaJ domain 2e-04
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 0.001
PRK10266 306 PRK10266, PRK10266, curved DNA-binding protein Cbp 0.003
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information 
 Score = 37.5 bits (88), Expect = 2e-04
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 7/68 (10%)

Query: 74  WYGVLGLKEGRGGGATRVEEINKHYEVLSTLFQQPNMCSF-VEVKNANKLVTEAWEVLSD 132
           +Y +LG+       A+  EEI K Y  L+  +  P+        +   K + EA+EVLSD
Sbjct: 2   YYEILGVPRD----AS-DEEIKKAYRKLALKYH-PDKNPGDPAAEEKFKEINEAYEVLSD 55

Query: 133 ARRKEAYD 140
             ++  YD
Sbjct: 56  PEKRAIYD 63

DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 207
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.88
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 99.85
PRK14288 369 chaperone protein DnaJ; Provisional 99.8
PRK14296 372 chaperone protein DnaJ; Provisional 99.79
PRK14279 392 chaperone protein DnaJ; Provisional 99.76
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 99.76
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.76
PRK14287 371 chaperone protein DnaJ; Provisional 99.75
PRK14298 377 chaperone protein DnaJ; Provisional 99.75
PRK14286 372 chaperone protein DnaJ; Provisional 99.75
PRK14276 380 chaperone protein DnaJ; Provisional 99.75
PRK14299 291 chaperone protein DnaJ; Provisional 99.74
PRK14283 378 chaperone protein DnaJ; Provisional 99.74
PRK14291 382 chaperone protein DnaJ; Provisional 99.74
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.74
PRK14278 378 chaperone protein DnaJ; Provisional 99.74
PRK14282 369 chaperone protein DnaJ; Provisional 99.73
PRK14285 365 chaperone protein DnaJ; Provisional 99.73
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.73
PRK14280 376 chaperone protein DnaJ; Provisional 99.73
PRK14277 386 chaperone protein DnaJ; Provisional 99.72
PRK14294 366 chaperone protein DnaJ; Provisional 99.72
PRK14284 391 chaperone protein DnaJ; Provisional 99.71
PRK14301 373 chaperone protein DnaJ; Provisional 99.71
PRK14297 380 chaperone protein DnaJ; Provisional 99.71
PRK14295 389 chaperone protein DnaJ; Provisional 99.71
PRK14281 397 chaperone protein DnaJ; Provisional 99.7
PRK10767 371 chaperone protein DnaJ; Provisional 99.69
KOG0716 279 consensus Molecular chaperone (DnaJ superfamily) [ 99.69
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.69
KOG0691 296 consensus Molecular chaperone (DnaJ superfamily) [ 99.69
KOG0715 288 consensus Molecular chaperone (DnaJ superfamily) [ 99.69
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.68
PRK14300 372 chaperone protein DnaJ; Provisional 99.68
PRK14292 371 chaperone protein DnaJ; Provisional 99.68
PRK14293 374 chaperone protein DnaJ; Provisional 99.68
PRK14289 386 chaperone protein DnaJ; Provisional 99.68
PRK14290 365 chaperone protein DnaJ; Provisional 99.68
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.67
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.67
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.65
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.64
KOG0719 264 consensus Molecular chaperone (DnaJ superfamily) [ 99.63
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.63
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.6
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.56
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.56
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.54
KOG0720 490 consensus Molecular chaperone (DnaJ superfamily) [ 99.53
PHA03102153 Small T antigen; Reviewed 99.52
PRK05014171 hscB co-chaperone HscB; Provisional 99.47
PRK01356166 hscB co-chaperone HscB; Provisional 99.45
PRK00294173 hscB co-chaperone HscB; Provisional 99.41
PRK03578176 hscB co-chaperone HscB; Provisional 99.41
KOG0722 329 consensus Molecular chaperone (DnaJ superfamily) [ 99.39
KOG0714 306 consensus Molecular chaperone (DnaJ superfamily) [ 99.34
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.3
PHA02624 647 large T antigen; Provisional 99.26
PTZ00100116 DnaJ chaperone protein; Provisional 99.26
PRK01773173 hscB co-chaperone HscB; Provisional 99.12
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.1
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 99.09
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.95
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.95
KOG0568 342 consensus Molecular chaperone (DnaJ superfamily) [ 98.32
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.28
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 97.66
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 97.52
KOG0431453 consensus Auxilin-like protein and related protein 96.91
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.57
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 95.76
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 93.38
KOG0724 335 consensus Zuotin and related molecular chaperones 85.04
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 84.72
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.88  E-value=3.5e-23  Score=186.90  Aligned_cols=67  Identities=33%  Similarity=0.528  Sum_probs=64.5

Q ss_pred             CCCchhhcCcccCCCCCCCcHHHHHHHHHHHhhccCCCCCCC-ChhHHHHHHHHHHHHHHcCChhhHHHHhhhc
Q 039157           71 TKSWYGVLGLKEGRGGGATRVEEINKHYEVLSTLFQQPNMCS-FVEVKNANKLVTEAWEVLSDARRKEAYDLLM  143 (207)
Q Consensus        71 ~~d~Y~vLgv~~~~~~~~as~~eIk~aYrklal~~~HPDk~~-~~~a~~~f~~i~~Ay~vLsd~~kR~~YD~~~  143 (207)
                      .+|||+||||+++     ||.+|||+|||+||++ ||||+|+ ...|+++|++|++|||||+||+||+.||++|
T Consensus         3 ~~dyYeiLGV~k~-----As~~EIKkAYRkLA~k-yHPD~n~g~~~AeeKFKEI~eAYEVLsD~eKRa~YD~fG   70 (371)
T COG0484           3 KRDYYEILGVSKD-----ASEEEIKKAYRKLAKK-YHPDRNPGDKEAEEKFKEINEAYEVLSDPEKRAAYDQFG   70 (371)
T ss_pred             ccchhhhcCCCCC-----CCHHHHHHHHHHHHHH-hCCCCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHhhccC
Confidence            4699999999999     9999999999999999 9999999 6679999999999999999999999999996

>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 4e-07
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 6e-05
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 3e-04
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 7e-04
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
 Score = 47.1 bits (112), Expect = 4e-07
 Identities = 19/93 (20%), Positives = 38/93 (40%), Gaps = 11/93 (11%)

Query: 72  KSWYGVLGLKEGRGGGATRVEEINKHYEVLSTLF---QQPNMCSFVEVKNAN---KLVTE 125
           K WY +LG        A  + ++ + Y+ L  ++   +Q        V+        + +
Sbjct: 10  KDWYSILGADPS----AN-ISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQ 64

Query: 126 AWEVLSDARRKEAYDLLMGFTNRKNNNVINVQF 158
           AW++L +   K  YDL     + +N   ++ Q 
Sbjct: 65  AWKILGNEETKREYDLQRCEDDLRNVGPVDAQV 97
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query207
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.84
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.84
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.83
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.83
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.82
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.82
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.81
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.81
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.8
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.8
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.79
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.79
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.79
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.77
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.77
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.76
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.74
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.73
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.71
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.7
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.68
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.67
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.66
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.66
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.64
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.63
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.62
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.61
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.61
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.6
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.59
2guz_A71 Mitochondrial import inner membrane translocase su 99.56
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.53
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.49
2guz_B65 Mitochondrial import inner membrane translocase su 98.54
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 95.11
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
Probab=99.84  E-value=4.6e-21  Score=136.32  Aligned_cols=68  Identities=31%  Similarity=0.450  Sum_probs=64.9

Q ss_pred             CCchhhcCcccCCCCCCCcHHHHHHHHHHHhhccCCCCCCCChhHHHHHHHHHHHHHHcCChhhHHHHhhhcCc
Q 039157           72 KSWYGVLGLKEGRGGGATRVEEINKHYEVLSTLFQQPNMCSFVEVKNANKLVTEAWEVLSDARRKEAYDLLMGF  145 (207)
Q Consensus        72 ~d~Y~vLgv~~~~~~~~as~~eIk~aYrklal~~~HPDk~~~~~a~~~f~~i~~Ay~vLsd~~kR~~YD~~~~~  145 (207)
                      .|||+||||+++     ++.++||++||+|+++ +|||+++...+.+.|+.|++||++|+||.+|..||..+..
T Consensus         3 ~~~y~iLgv~~~-----as~~~Ik~ayr~l~~~-~HPD~~~~~~~~~~f~~i~~Ay~~L~d~~~R~~Yd~~~~~   70 (77)
T 1hdj_A            3 KDYYQTLGLARG-----ASDEEIKRAYRRQALR-YHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEE   70 (77)
T ss_dssp             CCSHHHHTCCTT-----CCHHHHHHHHHHHHHT-TCTTTCCCTTHHHHHHHHHHHHHHTTCHHHHHHHHHTCGG
T ss_pred             CCHHHHcCCCCC-----CCHHHHHHHHHHHHHH-HCcCCCCCccHHHHHHHHHHHHHHHCCHHHHHHHHHHccc
Confidence            589999999999     9999999999999999 9999999888999999999999999999999999998743
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 207
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 8e-07
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 2e-05
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 4e-05
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 1e-04
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 2e-04
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 3e-04
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 5e-04
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 0.002
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 43.5 bits (102), Expect = 8e-07
 Identities = 17/76 (22%), Positives = 30/76 (39%), Gaps = 11/76 (14%)

Query: 72  KSWYGVLGLKEGRGGGATRVEEINKHYEVLSTLFQQP------NMCSFVEVKNANKLVTE 125
           K WY +LG        A    ++ + Y+ L  L+            +  E       + +
Sbjct: 16  KDWYSILGADPS----ANM-SDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQ 70

Query: 126 AWEVLSDARRKEAYDL 141
           AW++L +   K+ YDL
Sbjct: 71  AWKILGNEETKKKYDL 86
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query207
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.87
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.82
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.79
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.71
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.71
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.61
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.6
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 88.14
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.87  E-value=7.9e-23  Score=143.96  Aligned_cols=69  Identities=28%  Similarity=0.434  Sum_probs=64.1

Q ss_pred             CCCchhhcCcccCCCCCCCcHHHHHHHHHHHhhccCCCCCCCChh-HHHHHHHHHHHHHHcCChhhHHHHhhhcCc
Q 039157           71 TKSWYGVLGLKEGRGGGATRVEEINKHYEVLSTLFQQPNMCSFVE-VKNANKLVTEAWEVLSDARRKEAYDLLMGF  145 (207)
Q Consensus        71 ~~d~Y~vLgv~~~~~~~~as~~eIk~aYrklal~~~HPDk~~~~~-a~~~f~~i~~Ay~vLsd~~kR~~YD~~~~~  145 (207)
                      .+|||+||||+++     +|.++||++||+++++ +|||++++.. +.+.|++|++||+||+||.+|..||.+|..
T Consensus         2 k~dyY~vLgv~~~-----As~~eIk~aYr~l~~~-~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~   71 (75)
T d1xbla_           2 KQDYYEILGVSKT-----AEEREIRKAYKRLAMK-YHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHA   71 (75)
T ss_dssp             CCCTTTTTCCSSS-----CCHHHHHHHHHHHHHH-TCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTS
T ss_pred             CCCHHHHcCCCCC-----cCHHHHHHHHHHHHhh-hhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCcc
Confidence            4699999999999     9999999999999999 9999998654 778899999999999999999999998754
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure