Citrus Sinensis ID: 039158

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MEKQSSFRTWTMEKQQSICSVTFEKQPSIQRVMEEQQSFHGVSTNKLPSARGVIEKQQSFHGVTIDKQLSTCDGKTGRKKNKDLPGKRSHLQLHLPARTGNLSRVTEILQGCDSSEAKELLLKQNQEAKNGYDSFHAAAK
cccccccccccccccccccccccccccHHHHHHHHHccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccc
cccEEEEcccEEEEcccEEEEEccccccccccEEccccHHHHHHHHccccHHHHHHccccHEEEEcHHHHHccccccccccccccccccccHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHEEcc
mekqssfrtwtmekQQSICSVTFEKQPSIQRVMEEQQsfhgvstnklpsargviekqqsfhgvtidkqlstcdgktgrkknkdlpgkrshlqlhlpartgnLSRVTEILQGCDSSEAKELLLKQNQEAKNGYDSFHAAAK
mekqssfrtwtmekqqsiCSVTFEKQPSIQRVMEEQQSFHGVSTNKLPSARGVIEkqqsfhgvtidkqlstcdgktgrkknkdlpgkrshlqlhlpartgnlSRVTEILQGCDSSEAKELLLKQNqeakngydSFHAAAK
MEKQSSFRTWTMEKQQSICSVTFEKQPSIQRVMEEQQSFHGVSTNKLPSARGVIEKQQSFHGVTIDKQLSTCDGKTGRKKNKDLPGKRSHLQLHLPARTGNLSRVTEILQGCDSSEAKELLLKQNQEAKNGYDSFHAAAK
********************************************************************************************************************************************
***********************************************************************************************PARTGNLSRV**************************YDSFHAAAK
***************QSICSVTFEKQPSIQRVMEEQQSFHGVSTNKLPSARGVIEKQQSFHGVTIDKQLSTCDGKTGRKKNKDLPGKRSHLQLHLPARTGNLSRVTEILQGCDSSEAKELLLKQNQEAKNGYDSFHAAAK
**KQSSFRTWTMEKQQSICSVTFEKQPSIQRV*EEQQSFHGVSTNKLPSARGVIEKQQSFHGVTIDKQLSTCD****************HLQLHLPARTGNLSRVTEILQGCDSSEAKELLLKQNQEAKNGYDSFHAAAK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKQSSFRTWTMEKQQSICSVTFEKQPSIQRVMEEQQSFHGVSTNKLPSARGVIEKQQSFHGVTIDKQLSTCDGKTGRKKNKDLPGKRSHLQLHLPARTGNLSRVTEILQGCDSSEAKELLLKQNQEAKNGYDSFHAAAK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
255576418 606 ankyrin repeat-containing protein, putat 0.985 0.227 0.430 3e-25
359478231 595 PREDICTED: ankyrin repeat-containing pro 0.971 0.228 0.453 2e-23
147783618 598 hypothetical protein VITISV_035656 [Viti 0.892 0.209 0.447 1e-20
356506136 566 PREDICTED: ankyrin repeat-containing pro 0.75 0.185 0.395 2e-17
356573310 558 PREDICTED: ankyrin repeat-containing pro 0.75 0.188 0.401 2e-17
15225141 662 ankyrin repeats-containing protein [Arab 0.971 0.205 0.376 4e-17
255635331179 unknown [Glycine max] 0.778 0.608 0.402 3e-16
15220595 627 ankyrin repeats-containing protein [Arab 0.992 0.221 0.356 4e-16
449444933 574 PREDICTED: ankyrin repeat-containing pro 0.8 0.195 0.389 2e-15
296084361 534 unnamed protein product [Vitis vinifera] 0.535 0.140 0.407 3e-10
>gi|255576418|ref|XP_002529101.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223531452|gb|EEF33285.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 93/181 (51%), Gaps = 43/181 (23%)

Query: 1   MEKQSSFRTWTMEKQQSICSVTFEKQPSIQRVMEEQQSFHGVSTNKLPSARGVIEKQQSF 60
           MEKQ SF+   MEKQ S      EK PS   + E   + HG+   K PS RG +EKQ+SF
Sbjct: 1   MEKQVSFKGRAMEKQVSFKQKVMEKLPSFHGITENPPTSHGL-MEKHPSFRGALEKQKSF 59

Query: 61  HG---------VTIDKQLSTCDGKTGRKKNKDLPGKRSHLQLHLPARTGNLSRVTEILQG 111
            G         V +++QLS   G   RKKNK+ PGKR   Q+HL AR GNLSRV EILQ 
Sbjct: 60  RGFVEKQKSFRVIMERQLSFIGGGE-RKKNKESPGKRGDSQIHLAARAGNLSRVREILQN 118

Query: 112 CDSSEAKELLLKQNQE--------------------------------AKNGYDSFHAAA 139
           CD +EAK+LL  +NQE                                A+NGYD FH AA
Sbjct: 119 CDGNEAKDLLAIKNQEGETPLYAAAENGHVGIVAEMLEYMNLETASIPARNGYDPFHIAA 178

Query: 140 K 140
           K
Sbjct: 179 K 179

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359478231|ref|XP_002279889.2| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147783618|emb|CAN68139.1| hypothetical protein VITISV_035656 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356506136|ref|XP_003521843.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Glycine max] Back     alignment and taxonomy information
>gi|356573310|ref|XP_003554805.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Glycine max] Back     alignment and taxonomy information
>gi|15225141|ref|NP_180741.1| ankyrin repeats-containing protein [Arabidopsis thaliana] gi|4887754|gb|AAD32290.1| ankyrin-like protein [Arabidopsis thaliana] gi|330253495|gb|AEC08589.1| ankyrin repeats-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255635331|gb|ACU18019.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|15220595|ref|NP_172055.1| ankyrin repeats-containing protein [Arabidopsis thaliana] gi|4836914|gb|AAD30616.1|AC007153_8 Hypothetical protein [Arabidopsis thaliana] gi|332189749|gb|AEE27870.1| ankyrin repeats-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449444933|ref|XP_004140228.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Cucumis sativus] gi|449490552|ref|XP_004158638.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|296084361|emb|CBI24749.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
TAIR|locus:2045233 662 AT2G31820 [Arabidopsis thalian 0.792 0.167 0.453 4.7e-16
TAIR|locus:2031948 627 AT1G05640 "AT1G05640" [Arabido 0.814 0.181 0.407 1.7e-14
TAIR|locus:2026489 543 AT1G07710 "AT1G07710" [Arabido 0.428 0.110 0.428 0.00091
TAIR|locus:2045233 AT2G31820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 210 (79.0 bits), Expect = 4.7e-16, P = 4.7e-16
 Identities = 59/130 (45%), Positives = 75/130 (57%)

Query:     1 MEKQSSFRTWTMEKQQSICSVTFEKQPSIQRV-MEEQQSFHGVSTNKLPSARGVIEKQQS 59
             MEKQ SFR   +E  +       EK PS  R  ME Q+SF G          G +EKQ+S
Sbjct:    79 MEKQQSFRGVNVENHKR---GVMEKLPSFGRATMERQKSFRG----------GFLEKQKS 125

Query:    60 FHGVTIDKQLSTCDGKTGRKKNKDLPGKRSHLQLHLPARTGNLSRVTEILQGCDSSEAKE 119
             F  V +++QLS    +  RKKN+  PGKR    LH+ ARTGNLS+V E+++GC   E KE
Sbjct:   126 FR-VVMERQLSFIGER--RKKNES-PGKRGDSSLHIAARTGNLSKVKELIRGC-GDELKE 180

Query:   120 LLLKQNQEAK 129
             LL KQN E +
Sbjct:   181 LLSKQNLEGE 190
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2031948 AT1G05640 "AT1G05640" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026489 AT1G07710 "AT1G07710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 140
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.49
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.23
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.12
KOG4412 226 consensus 26S proteasome regulatory complex, subun 99.09
KOG4412 226 consensus 26S proteasome regulatory complex, subun 99.03
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 98.99
KOG0515 752 consensus p53-interacting protein 53BP/ASPP, conta 98.97
PHA02946 446 ankyin-like protein; Provisional 98.91
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 98.89
PHA02736154 Viral ankyrin protein; Provisional 98.87
PHA02741169 hypothetical protein; Provisional 98.86
PHA02989 494 ankyrin repeat protein; Provisional 98.83
PHA02741169 hypothetical protein; Provisional 98.81
PHA03095 471 ankyrin-like protein; Provisional 98.81
KOG0512228 consensus Fetal globin-inducing factor (contains a 98.8
PHA02743166 Viral ankyrin protein; Provisional 98.78
PHA02795 437 ankyrin-like protein; Provisional 98.77
PHA02798 489 ankyrin-like protein; Provisional 98.77
PHA02743166 Viral ankyrin protein; Provisional 98.75
PHA02791 284 ankyrin-like protein; Provisional 98.75
PLN03192 823 Voltage-dependent potassium channel; Provisional 98.73
PHA02791 284 ankyrin-like protein; Provisional 98.71
PHA02875 413 ankyrin repeat protein; Provisional 98.71
PF1360630 Ank_3: Ankyrin repeat 98.69
PHA02878 477 ankyrin repeat protein; Provisional 98.69
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 98.67
PHA02730 672 ankyrin-like protein; Provisional 98.67
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 98.67
PHA02878 477 ankyrin repeat protein; Provisional 98.67
PHA02736154 Viral ankyrin protein; Provisional 98.66
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 98.65
PHA03100 480 ankyrin repeat protein; Provisional 98.63
PHA02874 434 ankyrin repeat protein; Provisional 98.63
PHA02875 413 ankyrin repeat protein; Provisional 98.62
PHA03095 471 ankyrin-like protein; Provisional 98.62
PHA02874 434 ankyrin repeat protein; Provisional 98.62
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 98.61
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.61
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 98.6
PHA02946 446 ankyin-like protein; Provisional 98.6
PHA02876 682 ankyrin repeat protein; Provisional 98.56
PLN03192 823 Voltage-dependent potassium channel; Provisional 98.56
PHA02884 300 ankyrin repeat protein; Provisional 98.54
PHA02798 489 ankyrin-like protein; Provisional 98.54
PHA02917 661 ankyrin-like protein; Provisional 98.5
PHA02859209 ankyrin repeat protein; Provisional 98.5
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 98.49
PHA02859209 ankyrin repeat protein; Provisional 98.49
KOG0510 929 consensus Ankyrin repeat protein [General function 98.48
PHA02884 300 ankyrin repeat protein; Provisional 98.46
PHA03100 480 ankyrin repeat protein; Provisional 98.45
KOG0502296 consensus Integral membrane ankyrin-repeat protein 98.44
PHA02876 682 ankyrin repeat protein; Provisional 98.42
KOG0514 452 consensus Ankyrin repeat protein [General function 98.39
PHA02989 494 ankyrin repeat protein; Provisional 98.37
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 98.36
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 98.36
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 98.35
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 98.35
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 98.34
TIGR00870 743 trp transient-receptor-potential calcium channel p 98.3
PHA02917 661 ankyrin-like protein; Provisional 98.27
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 98.25
KOG0522 560 consensus Ankyrin repeat protein [General function 98.22
PHA02792 631 ankyrin-like protein; Provisional 98.22
KOG0510 929 consensus Ankyrin repeat protein [General function 98.2
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 98.19
PHA02730 672 ankyrin-like protein; Provisional 98.19
KOG0508 615 consensus Ankyrin repeat protein [General function 98.18
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 98.13
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 98.07
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 98.04
PHA02792 631 ankyrin-like protein; Provisional 97.92
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 97.9
KOG0514452 consensus Ankyrin repeat protein [General function 97.77
PHA02795 437 ankyrin-like protein; Provisional 97.73
KOG4214117 consensus Myotrophin and similar proteins [Transcr 97.71
KOG0508 615 consensus Ankyrin repeat protein [General function 97.66
TIGR00870 743 trp transient-receptor-potential calcium channel p 97.65
KOG0502296 consensus Integral membrane ankyrin-repeat protein 97.62
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 97.58
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 97.55
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.53
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 97.36
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 97.28
KOG0705749 consensus GTPase-activating protein Centaurin gamm 97.21
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 97.2
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 97.09
KOG4214117 consensus Myotrophin and similar proteins [Transcr 96.9
KOG0783 1267 consensus Uncharacterized conserved protein, conta 96.75
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 96.64
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 96.31
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 96.31
KOG2384 223 consensus Major histocompatibility complex protein 96.12
KOG0520 975 consensus Uncharacterized conserved protein, conta 96.12
PF1360630 Ank_3: Ankyrin repeat 96.1
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 95.71
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 95.68
KOG2505 591 consensus Ankyrin repeat protein [General function 95.38
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 95.26
KOG0521785 consensus Putative GTPase activating proteins (GAP 94.99
KOG0520 975 consensus Uncharacterized conserved protein, conta 94.91
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 94.9
KOG0521785 consensus Putative GTPase activating proteins (GAP 94.51
KOG0783 1267 consensus Uncharacterized conserved protein, conta 94.24
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 94.03
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 93.78
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 92.9
KOG0511 516 consensus Ankyrin repeat protein [General function 91.31
KOG0511 516 consensus Ankyrin repeat protein [General function 89.73
KOG0522 560 consensus Ankyrin repeat protein [General function 83.14
KOG0705749 consensus GTPase-activating protein Centaurin gamm 80.03
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information 
Probab=99.49  E-value=2.7e-14  Score=91.62  Aligned_cols=51  Identities=27%  Similarity=0.337  Sum_probs=32.5

Q ss_pred             cccCCCCCCCCChhhHHHHHcCCHHHHHHHHhcCCchhHHHHHHhccCCCCCCCchhhhh
Q 039158           79 KKNKDLPGKRSHLQLHLPARTGNLSRVTEILQGCDSSEAKELLLKQNQEAKNGYDSFHAA  138 (140)
Q Consensus        79 ~~~~~~~~~~G~TpLHlAAr~G~l~~Vk~Ll~~~~~e~v~~LLa~~N~~~~~G~TPLHiA  138 (140)
                      ..+.+..|..|.||||+||+.|+.++|+.||..+         ++.|..|..|+||||||
T Consensus         6 ~~~~n~~d~~G~T~LH~A~~~g~~~~v~~Ll~~g---------~d~~~~d~~G~Tpl~~A   56 (56)
T PF13857_consen    6 PADVNAQDKYGNTPLHWAARYGHSEVVRLLLQNG---------ADPNAKDKDGQTPLHYA   56 (56)
T ss_dssp             T--TT---TTS--HHHHHHHHT-HHHHHHHHHCT-----------TT---TTS--HHHH-
T ss_pred             cCCCcCcCCCCCcHHHHHHHcCcHHHHHHHHHCc---------CCCCCCcCCCCCHHHhC
Confidence            4678999999999999999999999999999665         66888899999999998

>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.31
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.25
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.23
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.2
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.18
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.17
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.15
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.15
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.13
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.12
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.11
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.11
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.11
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.1
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.1
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.1
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.09
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 99.09
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.08
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.08
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.08
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.07
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.07
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.06
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.06
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.06
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.04
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.04
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.04
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 99.03
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.03
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.03
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.02
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.02
2rfa_A232 Transient receptor potential cation channel subfa 99.01
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.01
2etb_A256 Transient receptor potential cation channel subfam 99.01
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.01
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 99.0
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.0
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.0
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.0
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.0
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 98.99
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 98.99
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 98.99
3hra_A201 Ankyrin repeat family protein; structural protein; 98.98
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 98.98
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 98.98
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 98.98
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 98.98
3v31_A167 Ankyrin repeat family A protein 2; structural geno 98.98
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 98.98
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 98.98
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 98.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 98.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 98.97
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 98.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 98.96
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 98.96
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 98.96
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 98.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 98.96
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 98.96
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 98.95
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 98.95
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 98.95
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 98.94
2pnn_A273 Transient receptor potential cation channel subfa 98.94
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 98.94
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 98.94
2rfa_A 232 Transient receptor potential cation channel subfa 98.92
3hra_A201 Ankyrin repeat family protein; structural protein; 98.92
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 98.91
3jxi_A 260 Vanilloid receptor-related osmotically activated p 98.91
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 98.91
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 98.9
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 98.9
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 98.9
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 98.9
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 98.89
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 98.88
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 98.88
2etb_A256 Transient receptor potential cation channel subfam 98.87
2pnn_A 273 Transient receptor potential cation channel subfa 98.87
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 98.86
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 98.86
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 98.85
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 98.85
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 98.85
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 98.85
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 98.84
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 98.84
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 98.83
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 98.83
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 98.82
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 98.82
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 98.82
4g8k_A 337 2-5A-dependent ribonuclease; ankyrin-repeat domain 98.82
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 98.8
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 98.8
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 98.8
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 98.78
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 98.77
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 98.76
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 98.75
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 98.75
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 98.72
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 98.65
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 98.27
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 98.15
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
Probab=99.31  E-value=2.1e-12  Score=85.52  Aligned_cols=52  Identities=33%  Similarity=0.438  Sum_probs=46.2

Q ss_pred             cccCCCCCCCCChhhHHHHHcCCHHHHHHHHhcCCchhHHHHHHhccCCCCCCCchhhhhc
Q 039158           79 KKNKDLPGKRSHLQLHLPARTGNLSRVTEILQGCDSSEAKELLLKQNQEAKNGYDSFHAAA  139 (140)
Q Consensus        79 ~~~~~~~~~~G~TpLHlAAr~G~l~~Vk~Ll~~~~~e~v~~LLa~~N~~~~~G~TPLHiAA  139 (140)
                      ..+.+..|..|+||||+||..|+.++|+.|++.+         +++|..|.+|+||||+|+
T Consensus        25 g~~~n~~d~~g~t~L~~A~~~~~~~~v~~Ll~~g---------a~~~~~d~~g~t~l~~A~   76 (93)
T 1n0q_A           25 GADVNAKDKNGRTPLHLAARNGHLEVVKLLLEAG---------ADVNAKDKNGRTPLHLAA   76 (93)
T ss_dssp             TCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTT---------CCTTCCCTTSCCHHHHHH
T ss_pred             CCCCcccCCCCCCHHHHHHHcCCHHHHHHHHHcC---------CCCCccCCCCCCHHHHHH
Confidence            3567888999999999999999999999999986         457888899999999997
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.27
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.25
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.24
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.24
d1k1aa_ 228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.23
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.22
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.22
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.2
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.19
d1sw6a_ 301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.18
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.15
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.12
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.1
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.1
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.07
d1uoha_ 223 26S proteasome non-ATPase regulatory subunit 10, g 99.05
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.05
d1oy3d_ 255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.01
d2fo1e1 277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 98.99
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 98.93
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 98.9
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 98.85
d1iknd_ 221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 98.82
d1s70b_ 291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 98.8
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 98.8
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 98.74
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 98.64
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 98.63
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 98.53
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 98.52
d1wdya_ 285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 98.51
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 98.46
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 98.4
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: 53BP2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.29  E-value=1.1e-12  Score=92.08  Aligned_cols=52  Identities=23%  Similarity=0.331  Sum_probs=44.4

Q ss_pred             cccCCCCCCCCChhhHHHHHcCCHHHHHHHHhcCCchhHHHHHHhccCCCCCCCchhhhhc
Q 039158           79 KKNKDLPGKRSHLQLHLPARTGNLSRVTEILQGCDSSEAKELLLKQNQEAKNGYDSFHAAA  139 (140)
Q Consensus        79 ~~~~~~~~~~G~TpLHlAAr~G~l~~Vk~Ll~~~~~e~v~~LLa~~N~~~~~G~TPLHiAA  139 (140)
                      ..+++.+|..|+||||+||..|+.++++.|++.+         ++.|..|.+||||||+|+
T Consensus        24 g~d~n~~d~~g~t~Lh~A~~~~~~~~~~~ll~~g---------~~~~~~d~~g~tpLh~A~   75 (130)
T d1ycsb1          24 VDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFG---------VNVNAADSDGWTPLHCAA   75 (130)
T ss_dssp             TSSCCCCCTTSCCHHHHHHHHTCHHHHHHHHHHT---------CCTTCCCTTCCCHHHHHH
T ss_pred             CCCccccccccccccccccccccccccccccccc---------cccccccccCcccccccc
Confidence            4678889999999999999999999999999875         346777888999999886
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure