Citrus Sinensis ID: 039176

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--
QNKTPLETRLLTKEQLRFKGEKQRPVDSLFLNREREREREKESKMVTSPVVNTYPLSSYTFGTKEPKMEKDTSVADRLARMKVNYMKEGMRTSVEAILLVQEHNHPHILLLQIGNTFCKLPGGRLKPGENEIEGLKRKLTSKLGANSPALVPDWQIGECVAIWWRPNFETIMYPYCPPHITKPKECKKLFLVHLSEREYFAVPKNLKLLAVPLFELYDNVQIWASYFNHSSTAFQIPVQYDYRLTLAWISRAHSWMILLRFLELYQEYMVRRFLVLIPDGTS
ccccccccccHHHHHHHccccccccccccccccccccccccccccccccEEEEEEcccEEEccccccccccccHHHHHHHHHHHHHHcccEEEEEEEEEEEEccccEEEEEEEccEEEEcccccccccccHHHHHHHHHHHHHcccccccccccEEEEEEEEEEcccccccccccccccccccccEEEEEEEEcccEEEEEEccccEEEEccccccccccccccccccccccccccEEEEEEEEEEHHHHcHHHHHHHHHHHHHHHHHHHHEEEEEcccccc
ccccccHHHHHcHHHcccccccccccccccccHHHHHHHccccccccccEEEEEEccccEcccccccccccccHHHHHHHHHHHHHHccccEEEEEEEEEEcccccEEEEEEEcccEEEcccccccccccHHHHHHHHHHHHHcccccccccccEHHHHHHHHccccccccccccccccccccccEEEEEEEEccccEEEEcccccEEEEEEHHHHccccHHccccHHHHHHHHHHHHHHcEEEEEHHHcHHHHHHHHHHHHHHHHHHHHHHHHHEcccccc
QNKTPLETRLLTKEQLRfkgekqrpvdslFLNRERERerekeskmvtspvvntyplssytfgtkepkmekdtSVADRLARMKVNYMKEGMRTSVEAILLVQEHNHPHILLLQIGntfcklpggrlkpgeneIEGLKRKLTsklganspalvpdwqigecvaiwwrpnfetimypycpphitkpkecKKLFLVHLSEreyfavpknlkllAVPLFELYDNVQIWASYfnhsstafqipvqydYRLTLAWISRAHSWMILLRFLELYQEYMVRRFLVLIPDGTS
qnktpletrlltkeqlrfkgekqrpvdslflnrerererekeskmvtspvvntyplssytfgtkepkmekdtsvaDRLARMKVNYMKEGMRTSVEAILLVQEHNHPHILLLQIGNTFCKLPGGRLKPGENEIEGLKRKLtsklganspalvpdwqiGECVAIWWRPNFETIMYPYCPPHITKPKECKKLFLVHLSEREYFAVPKNLKLLAVPLFELYDNVQIWASYFNHSSTAFQIPVQYDYRLTLAWISRAHSWMILLRFLELYQEYMVRRFLVLIPDGTS
QNKTPLETRLLTKEQLRFKGEKQRPVDSLFLNrererereKESKMVTSPVVNTYPLSSYTFGTKEPKMEKDTSVADRLARMKVNYMKEGMRTSVEAILLVQEHNHPHILLLQIGNTFCKLPGGRLKPGENEIEGLKRKLTSKLGANSPALVPDWQIGECVAIWWRPNFETIMYPYCPPHITKPKECKKLFLVHLSEREYFAVPKNLKLLAVPLFELYDNVQIWASYFNHSSTAFQIPVQYDYRLTLAWISRAHSWMILLRFLELYQEYMVRRFLVLIPDGTS
*******************************************************************************RMKVNYMKEGMRTSVEAILLVQEHNHPHILLLQIGNTFCKLPGGRL*****************LGANSPALVPDWQIGECVAIWWRPNFETIMYPYCPPHITKPKECKKLFLVHLSEREYFAVPKNLKLLAVPLFELYDNVQIWASYFNHSSTAFQIPVQYDYRLTLAWISRAHSWMILLRFLELYQEYMVRRFLVLI*****
******E*******************************************VNTYPLSSYTFGT**************LARMKVNYMKEGMRTSVEAILLVQEHNHPHILLLQIGNTFCKLPGGRLKPGENEIEGLKRKLTSKLGANSPALVPDWQIGECVAIWWRPNFETIMYPYCPPHITKPKECKKLFLVHLSEREYFAVPKNLKLLAVPLFELYDNVQIWASYFNHSSTAFQIPVQYDYRLTLAWISRAHSWMILLRFLELYQEYMVRRFLVLIPDG**
QNKTPLETRLLTKEQLRFKGEKQRPVDSLFLNRE***********VTSPVVNTYPLSSYTFGTKE********VADRLARMKVNYMKEGMRTSVEAILLVQEHNHPHILLLQIGNTFCKLPGGRLKPGENEIEGLKRKLTSKLGANSPALVPDWQIGECVAIWWRPNFETIMYPYCPPHITKPKECKKLFLVHLSEREYFAVPKNLKLLAVPLFELYDNVQIWASYFNHSSTAFQIPVQYDYRLTLAWISRAHSWMILLRFLELYQEYMVRRFLVLIPDGTS
****PLETRLLTKEQLR****************************VTSPVVNTYPLSSYTFGTKEPK**KDTSVADRLARMKVNYMKEGMRTSVEAILLVQEHNHPHILLLQIGNTFCKLPGGRLKPGENEIEGLKRKLTSKLGANSPALVPDWQIGECVAIWWRPNFETIMYPYCPPHITKPKECKKLFLVHLSEREYFAVPKNLKLLAVPLFELYDNVQIWASYFNHSSTAFQIPVQYDYRLTLAWISRAHSWMILLRFLELYQEYMVRRFLVLIPD***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QNKTPLETRLLTKEQLRFKGEKQRPVDSLFLNREREREREKESKMVTSPVVNTYPLSSYTFGTKEPKMEKDTSVADRLARMKVNYMKEGMRTSVEAILLVQEHNHPHILLLQIGNTFCKLPGGRLKPGENEIEGLKRKLTSKLGANSPALVPDWQIGECVAIWWRPNFETIMYPYCPPHITKPKECKKLFLVHLSEREYFAVPKNLKLLAVPLFELYDNVQIWASYFNHSSTAFQIPVQYDYRLTLAWISRAHSWMILLRFLELYQEYMVRRFLVLIPDGTS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query282 2.2.26 [Sep-21-2011]
Q4KM65227 Cleavage and polyadenylat yes no 0.602 0.748 0.614 5e-57
Q5RAI8227 Cleavage and polyadenylat yes no 0.602 0.748 0.614 5e-57
Q9CQF3227 Cleavage and polyadenylat yes no 0.602 0.748 0.614 5e-57
O43809227 Cleavage and polyadenylat yes no 0.602 0.748 0.614 5e-57
Q3ZCA2227 Cleavage and polyadenylat yes no 0.602 0.748 0.614 5e-57
Q6DJE4227 Cleavage and polyadenylat N/A no 0.602 0.748 0.614 1e-56
Q7T3C6228 Cleavage and polyadenylat yes no 0.602 0.745 0.614 1e-56
Q55E68200 Cleavage and polyadenylat yes no 0.592 0.835 0.552 1e-46
>sp|Q4KM65|CPSF5_RAT Cleavage and polyadenylation specificity factor subunit 5 OS=Rattus norvegicus GN=Nudt21 PE=2 SV=1 Back     alignment and function desciption
 Score =  221 bits (563), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 125/171 (73%), Gaps = 1/171 (0%)

Query: 50  VVNTYPLSSYTFGTKEPKMEKDTSVADRLARMKVNYMKEGMRTSVEAILLVQEHNHPHIL 109
            +N YPL++YTFGTKEP  EKD+SVA R  RM+  + K GMR +VE +L+V EH  PH+L
Sbjct: 36  TINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVL 95

Query: 110 LLQIGNTFCKLPGGRLKPGENEIEGLKRKLTSKLGANSPALVPDWQIGECVAIWWRPNFE 169
           LLQ+G TF KLPGG L PGE+E+EGLKR +T  LG     ++ DW I +C+  WWRPNFE
Sbjct: 96  LLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQD-GVLQDWVIDDCIGNWWRPNFE 154

Query: 170 TIMYPYCPPHITKPKECKKLFLVHLSEREYFAVPKNLKLLAVPLFELYDNV 220
              YPY P HITKPKE KKLFLV L E+  FAVPKN KL+A PLFELYDN 
Sbjct: 155 PPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNA 205
Component of the cleavage factor Im (CFIm) complex that plays a key role in pre-mRNA 3'-processing. Involved in association with CPSF6 or CPSF7 in pre-MRNA 3'-end poly(A) site cleavage and poly(A) addition. NUDT21/CPSF5 binds to cleavage and polyadenylation RNA substrates. The homodimer mediates simultaneous sequence-specific recognition of two 5'-UGUA-3' elements within the pre-mRNA. Binds to, but does not hydrolyze mono- and di-adenosine nucleotides. May have a role in mRNA export.
Rattus norvegicus (taxid: 10116)
>sp|Q5RAI8|CPSF5_PONAB Cleavage and polyadenylation specificity factor subunit 5 OS=Pongo abelii GN=NUDT21 PE=2 SV=1 Back     alignment and function description
>sp|Q9CQF3|CPSF5_MOUSE Cleavage and polyadenylation specificity factor subunit 5 OS=Mus musculus GN=Nudt21 PE=2 SV=1 Back     alignment and function description
>sp|O43809|CPSF5_HUMAN Cleavage and polyadenylation specificity factor subunit 5 OS=Homo sapiens GN=NUDT21 PE=1 SV=1 Back     alignment and function description
>sp|Q3ZCA2|CPSF5_BOVIN Cleavage and polyadenylation specificity factor subunit 5 OS=Bos taurus GN=NUDT21 PE=2 SV=1 Back     alignment and function description
>sp|Q6DJE4|CPSF5_XENLA Cleavage and polyadenylation specificity factor subunit 5 OS=Xenopus laevis GN=cpsf5 PE=2 SV=1 Back     alignment and function description
>sp|Q7T3C6|CPSF5_DANRE Cleavage and polyadenylation specificity factor subunit 5 OS=Danio rerio GN=cpsf5 PE=2 SV=1 Back     alignment and function description
>sp|Q55E68|CPSF5_DICDI Cleavage and polyadenylation specificity factor subunit 5 OS=Dictyostelium discoideum GN=cpsf5 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
255539475200 pre-mRNA cleavage factor im, 25kD subuni 0.638 0.9 0.972 2e-99
351723959200 uncharacterized protein LOC100306068 [Gl 0.638 0.9 0.961 4e-98
449432171200 PREDICTED: cleavage and polyadenylation 0.638 0.9 0.95 4e-98
388513689200 unknown [Medicago truncatula] 0.638 0.9 0.955 6e-98
356535879200 PREDICTED: LOW QUALITY PROTEIN: cleavage 0.638 0.9 0.955 8e-98
225454123200 PREDICTED: cleavage and polyadenylation 0.627 0.885 0.971 8e-98
224134811202 predicted protein [Populus trichocarpa] 0.627 0.876 0.966 2e-97
225470159200 PREDICTED: cleavage and polyadenylation 0.638 0.9 0.922 5e-96
388515089200 unknown [Lotus japonicus] 0.638 0.9 0.95 8e-96
147796474244 hypothetical protein VITISV_006288 [Viti 0.659 0.762 0.817 5e-95
>gi|255539475|ref|XP_002510802.1| pre-mRNA cleavage factor im, 25kD subunit, putative [Ricinus communis] gi|223549917|gb|EEF51404.1| pre-mRNA cleavage factor im, 25kD subunit, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  368 bits (944), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 175/180 (97%), Positives = 176/180 (97%)

Query: 45  MVTSPVVNTYPLSSYTFGTKEPKMEKDTSVADRLARMKVNYMKEGMRTSVEAILLVQEHN 104
           MV S VVNTYPLSSYTFGTKEPKMEKDTSVADRLARMKVNYMKEGMRTSVEAILLVQEHN
Sbjct: 1   MVNSSVVNTYPLSSYTFGTKEPKMEKDTSVADRLARMKVNYMKEGMRTSVEAILLVQEHN 60

Query: 105 HPHILLLQIGNTFCKLPGGRLKPGENEIEGLKRKLTSKLGANSPALVPDWQIGECVAIWW 164
           HPHILLLQIGNTFCKLPGGRLKPGENEIEGLKRKLTSKLGANSPALVPDWQIGECVAIWW
Sbjct: 61  HPHILLLQIGNTFCKLPGGRLKPGENEIEGLKRKLTSKLGANSPALVPDWQIGECVAIWW 120

Query: 165 RPNFETIMYPYCPPHITKPKECKKLFLVHLSEREYFAVPKNLKLLAVPLFELYDNVQIWA 224
           RPNFETIMYPYCPPHITKPKECKKLFLVHLSEREYFAVPKNLKLLAVPLFELYDNVQ + 
Sbjct: 121 RPNFETIMYPYCPPHITKPKECKKLFLVHLSEREYFAVPKNLKLLAVPLFELYDNVQRYG 180

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|351723959|ref|NP_001237041.1| uncharacterized protein LOC100306068 [Glycine max] gi|255627433|gb|ACU14061.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449432171|ref|XP_004133873.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5-like [Cucumis sativus] gi|449480168|ref|XP_004155818.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388513689|gb|AFK44906.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356535879|ref|XP_003536470.1| PREDICTED: LOW QUALITY PROTEIN: cleavage and polyadenylation specificity factor subunit 5-like [Glycine max] Back     alignment and taxonomy information
>gi|225454123|ref|XP_002269748.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5 isoform 1 [Vitis vinifera] gi|297745235|emb|CBI40315.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224134811|ref|XP_002321911.1| predicted protein [Populus trichocarpa] gi|118487488|gb|ABK95571.1| unknown [Populus trichocarpa] gi|222868907|gb|EEF06038.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225470159|ref|XP_002267257.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 5 [Vitis vinifera] gi|147788664|emb|CAN61008.1| hypothetical protein VITISV_016616 [Vitis vinifera] gi|302143896|emb|CBI22757.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388515089|gb|AFK45606.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|147796474|emb|CAN74801.1| hypothetical protein VITISV_006288 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
TAIR|locus:2131839200 AT4G25550 [Arabidopsis thalian 0.627 0.885 0.887 6e-87
UNIPROTKB|Q3ZCA2227 NUDT21 "Cleavage and polyadeny 0.631 0.784 0.6 4.8e-55
UNIPROTKB|E2QUJ4227 NUDT21 "Uncharacterized protei 0.631 0.784 0.6 4.8e-55
UNIPROTKB|O43809227 NUDT21 "Cleavage and polyadeny 0.631 0.784 0.6 4.8e-55
UNIPROTKB|Q5RAI8227 NUDT21 "Cleavage and polyadeny 0.631 0.784 0.6 4.8e-55
MGI|MGI:1915469227 Nudt21 "nudix (nucleoside diph 0.631 0.784 0.6 4.8e-55
RGD|1305766227 Nudt21 "nudix (nucleoside diph 0.631 0.784 0.6 4.8e-55
UNIPROTKB|E2R7S0234 LOC100684233 "Uncharacterized 0.595 0.717 0.627 9.9e-55
UNIPROTKB|Q6DJE4227 cpsf5 "Cleavage and polyadenyl 0.631 0.784 0.594 9.9e-55
ZFIN|ZDB-GENE-040426-1316228 cpsf5 "cleavage and polyadenyl 0.595 0.736 0.621 1.3e-54
TAIR|locus:2131839 AT4G25550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 869 (311.0 bits), Expect = 6.0e-87, P = 6.0e-87
 Identities = 157/177 (88%), Positives = 168/177 (94%)

Query:    45 MVTSPVVNTYPLSSYTFGTKEPKMEKDTSVADRLARMKVNYMKEGMRTSVEAILLVQEHN 104
             M  S VVNTYPLS+Y+FGTKEPK+EKDTSVADRLARMK+NYMKEGMRTSVE ILLVQEHN
Sbjct:     1 MAMSQVVNTYPLSNYSFGTKEPKLEKDTSVADRLARMKINYMKEGMRTSVEGILLVQEHN 60

Query:   105 HPHILLLQIGNTFCKLPGGRLKPGENEIEGLKRKLTSKLGANSPALVPDWQIGECVAIWW 164
             HPHILLLQIGNTFCKLPGGRLKPGENE +GLKRKLTSKLG NS ALVPDW +GECVA WW
Sbjct:    61 HPHILLLQIGNTFCKLPGGRLKPGENEADGLKRKLTSKLGGNSAALVPDWTVGECVATWW 120

Query:   165 RPNFETIMYPYCPPHITKPKECKKLFLVHLSEREYFAVPKNLKLLAVPLFELYDNVQ 221
             RPNFET+MYPYCPPHITKPKECK+L++VHLSE+EYFAVPKNLKLLAVPLFELYDNVQ
Sbjct:   121 RPNFETMMYPYCPPHITKPKECKRLYIVHLSEKEYFAVPKNLKLLAVPLFELYDNVQ 177
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005515 "protein binding" evidence=IPI
UNIPROTKB|Q3ZCA2 NUDT21 "Cleavage and polyadenylation specificity factor subunit 5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUJ4 NUDT21 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O43809 NUDT21 "Cleavage and polyadenylation specificity factor subunit 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RAI8 NUDT21 "Cleavage and polyadenylation specificity factor subunit 5" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
MGI|MGI:1915469 Nudt21 "nudix (nucleoside diphosphate linked moiety X)-type motif 21" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305766 Nudt21 "nudix (nucleoside diphosphate linked moiety X)-type motif 21" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2R7S0 LOC100684233 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DJE4 cpsf5 "Cleavage and polyadenylation specificity factor subunit 5" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1316 cpsf5 "cleavage and polyadenylation specific factor 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5RAI8CPSF5_PONABNo assigned EC number0.61400.60280.7488yesno
Q7T3C6CPSF5_DANRENo assigned EC number0.61400.60280.7456yesno
Q3ZCA2CPSF5_BOVINNo assigned EC number0.61400.60280.7488yesno
Q9CQF3CPSF5_MOUSENo assigned EC number0.61400.60280.7488yesno
Q4KM65CPSF5_RATNo assigned EC number0.61400.60280.7488yesno
O43809CPSF5_HUMANNo assigned EC number0.61400.60280.7488yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
pfam13869188 pfam13869, NUDIX_2, Nucleotide hydrolase 1e-107
cd04686131 cd04686, Nudix_Hydrolase_27, Members of the Nudix 9e-05
>gnl|CDD|206040 pfam13869, NUDIX_2, Nucleotide hydrolase Back     alignment and domain information 
 Score =  309 bits (794), Expect = e-107
 Identities = 120/173 (69%), Positives = 137/173 (79%), Gaps = 1/173 (0%)

Query: 49  PVVNTYPLSSYTFGTKEPKMEKDTSVADRLARMKVNYMKEGMRTSVEAILLVQEHNHPHI 108
           PV++ YPLS+YTFGTKE  +EKD SVA+RL R+K NY K GMR SVE +LLV  H HPH+
Sbjct: 1   PVIDLYPLSNYTFGTKEALVEKDISVAERLKRLKNNYEKNGMRRSVEGVLLVHRHGHPHV 60

Query: 109 LLLQIGNTFCKLPGGRLKPGENEIEGLKRKLTSKLGANSPALVPDWQIGECVAIWWRPNF 168
           LLLQIGNTF KLPGGRL+PGE+EIEGLKRKL  KL      +  DW++GEC+  WWRPNF
Sbjct: 61  LLLQIGNTFFKLPGGRLRPGEDEIEGLKRKLAKKLSPED-GVEEDWEVGECLGEWWRPNF 119

Query: 169 ETIMYPYCPPHITKPKECKKLFLVHLSEREYFAVPKNLKLLAVPLFELYDNVQ 221
           ET MYPY P HITKPKEC KL+LV L E+  FAVPKN+KLLAVPLFELYDN  
Sbjct: 120 ETSMYPYLPAHITKPKECIKLYLVQLPEKCKFAVPKNMKLLAVPLFELYDNAA 172

Nudix hydrolases are found in all classes of organism and hydrolyse a wide range of organic pyrophosphates, including nucleoside di- and triphosphates, di-nucleoside and diphospho-inositol polyphosphates, nucleotide sugars and RNA caps, with varying degrees of substrate specificity. Length = 188
>gnl|CDD|240042 cd04686, Nudix_Hydrolase_27, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 282
PF13869188 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 100.0
KOG1689221 consensus mRNA cleavage factor I subunit [RNA proc 100.0
cd03428130 Ap4A_hydrolase_human_like Diadenosine tetraphospha 98.03
cd04682122 Nudix_Hydrolase_23 Members of the Nudix hydrolase 97.84
PF00293134 NUDIX: NUDIX domain; InterPro: IPR000086 The gener 97.82
cd04688126 Nudix_Hydrolase_29 Members of the Nudix hydrolase 97.81
cd03673131 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy 97.81
PRK09438148 nudB dihydroneopterin triphosphate pyrophosphatase 97.69
cd04684128 Nudix_Hydrolase_25 Contains a crystal structure of 97.64
cd04667112 Nudix_Hydrolase_10 Members of the Nudix hydrolase 97.57
cd04687128 Nudix_Hydrolase_28 Members of the Nudix hydrolase 97.54
cd04695131 Nudix_Hydrolase_36 Members of the Nudix hydrolase 97.53
cd04686131 Nudix_Hydrolase_27 Members of the Nudix hydrolase 97.51
cd04685133 Nudix_Hydrolase_26 Members of the Nudix hydrolase 97.46
cd04669121 Nudix_Hydrolase_11 Members of the Nudix hydrolase 97.46
cd03672145 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt 97.41
PRK15434159 GDP-mannose mannosyl hydrolase NudD; Provisional 97.4
cd04679125 Nudix_Hydrolase_20 Members of the Nudix hydrolase 97.37
cd04670127 Nudix_Hydrolase_12 Members of the Nudix hydrolase 97.36
cd04677132 Nudix_Hydrolase_18 Members of the Nudix hydrolase 97.35
cd04696125 Nudix_Hydrolase_37 Members of the Nudix hydrolase 97.31
cd04678129 Nudix_Hydrolase_19 Members of the Nudix hydrolase 97.27
cd04680120 Nudix_Hydrolase_21 Members of the Nudix hydrolase 97.27
cd04690118 Nudix_Hydrolase_31 Members of the Nudix hydrolase 97.25
cd03674138 Nudix_Hydrolase_1 Members of the Nudix hydrolase s 97.25
PRK15472141 nucleoside triphosphatase NudI; Provisional 97.23
cd04664129 Nudix_Hydrolase_7 Members of the Nudix hydrolase s 97.2
cd03671147 Ap4A_hydrolase_plant_like Diadenosine tetraphospha 97.2
cd04676129 Nudix_Hydrolase_17 Members of the Nudix hydrolase 97.19
PRK05379340 bifunctional nicotinamide mononucleotide adenylylt 97.19
cd04689125 Nudix_Hydrolase_30 Members of the Nudix hydrolase 97.17
PLN02325144 nudix hydrolase 97.16
cd04691117 Nudix_Hydrolase_32 Members of the Nudix hydrolase 97.16
cd04671123 Nudix_Hydrolase_13 Members of the Nudix hydrolase 97.14
cd03430144 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann 97.11
cd03426157 CoAse Coenzyme A pyrophosphatase (CoAse), a member 97.1
cd03675134 Nudix_Hydrolase_2 Contains a crystal structure of 97.08
PRK10546135 pyrimidine (deoxy)nucleoside triphosphate pyrophos 97.08
cd04672123 Nudix_Hydrolase_14 Members of the Nudix hydrolase 97.04
cd04511130 Nudix_Hydrolase_4 Members of the Nudix hydrolase s 97.0
cd04666122 Nudix_Hydrolase_9 Members of the Nudix hydrolase s 96.98
PRK10776129 nucleoside triphosphate pyrophosphohydrolase; Prov 96.95
PLN02709222 nudix hydrolase 96.95
cd04683120 Nudix_Hydrolase_24 Members of the Nudix hydrolase 96.93
cd04699129 Nudix_Hydrolase_39 Members of the Nudix hydrolase 96.92
cd04681130 Nudix_Hydrolase_22 Members of the Nudix hydrolase 96.91
TIGR02705156 nudix_YtkD nucleoside triphosphatase YtkD. The fun 96.91
cd04673122 Nudix_Hydrolase_15 Members of the Nudix hydrolase 96.91
cd03427137 MTH1 MutT homolog-1 (MTH1) is a member of the Nudi 96.85
PRK03759184 isopentenyl-diphosphate delta-isomerase; Provision 96.75
PRK10707190 putative NUDIX hydrolase; Provisional 96.73
cd04663126 Nudix_Hydrolase_6 Members of the Nudix hydrolase s 96.7
cd04700142 DR1025_like DR1025 from Deinococcus radiodurans, a 96.69
cd04694143 Nudix_Hydrolase_35 Members of the Nudix hydrolase 96.67
cd03424137 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) 96.63
cd04665118 Nudix_Hydrolase_8 Members of the Nudix hydrolase s 96.62
cd04674118 Nudix_Hydrolase_16 Members of the Nudix hydrolase 96.62
PRK00714156 RNA pyrophosphohydrolase; Reviewed 96.62
COG1051145 ADP-ribose pyrophosphatase [Nucleotide transport a 96.55
cd04693127 Nudix_Hydrolase_34 Members of the Nudix hydrolase 96.33
cd03425124 MutT_pyrophosphohydrolase The MutT pyrophosphohydr 96.29
cd04692144 Nudix_Hydrolase_33 Members of the Nudix hydrolase 96.25
TIGR00586128 mutt mutator mutT protein. All proteins in this fa 96.13
cd04661132 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L 96.1
cd02885165 IPP_Isomerase Isopentenyl diphosphate (IPP) isomer 96.08
cd02883123 Nudix_Hydrolase Nudix hydrolase is a superfamily o 96.06
cd03429131 NADH_pyrophosphatase NADH pyrophosphatase, a membe 96.06
PRK15393180 NUDIX hydrolase YfcD; Provisional 96.06
PRK11762185 nudE adenosine nucleotide hydrolase NudE; Provisio 95.81
cd04662126 Nudix_Hydrolase_5 Members of the Nudix hydrolase s 95.65
cd04697126 Nudix_Hydrolase_38 Members of the Nudix hydrolase 95.51
COG0494161 MutT NTP pyrophosphohydrolases including oxidative 95.32
TIGR02150158 IPP_isom_1 isopentenyl-diphosphate delta-isomerase 94.68
PRK08999 312 hypothetical protein; Provisional 94.28
PRK00241256 nudC NADH pyrophosphatase; Reviewed 94.27
cd03670186 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) 94.04
cd03676180 Nudix_hydrolase_3 Members of the Nudix hydrolase s 89.69
TIGR00052185 nudix-type nucleoside diphosphatase, YffH/AdpP fam 89.41
KOG2839145 consensus Diadenosine and diphosphoinositol polyph 86.38
PLN03143291 nudix hydrolase; Provisional 84.82
PRK10729202 nudF ADP-ribose pyrophosphatase NudF; Provisional 80.05
>PF13869 NUDIX_2: Nucleotide hydrolase; PDB: 3MDG_B 2J8Q_B 3Q2S_A 3P5T_D 3BAP_A 2CL3_A 3P6Y_A 3Q2T_B 3BHO_A 3N9U_A Back     alignment and domain information 
Probab=100.00  E-value=2.1e-93  Score=627.84  Aligned_cols=185  Identities=66%  Similarity=1.157  Sum_probs=157.9

Q ss_pred             CeEEEeeCCceeeccCCCCcccCccHHHHHHHHHHHHhhccceeEEEEEEEEecCCCCeEEEeeecCceecCCCccccCC
Q 039176           49 PVVNTYPLSSYTFGTKEPKMEKDTSVADRLARMKVNYMKEGMRTSVEAILLVQEHNHPHILLLQIGNTFCKLPGGRLKPG  128 (282)
Q Consensus        49 ~~v~IYPLsNYtFgtKe~~~eKD~sv~~Rl~Rlk~~Y~k~GmRrSVegVLLVH~h~hPHVLLLQ~~nsffkLPGGrLrpg  128 (282)
                      ++|+|||+|||+||+||+++|||.|+++|++||+++|+++||||||+||||||+||||||||||++|+||+||||+|++|
T Consensus         1 ~~~~iYPlsnY~Fg~ke~~~ekd~s~~~rl~rl~~~y~~~GmRrsVe~Vllvh~h~~PHvLLLq~~~~~fkLPGg~l~~g   80 (188)
T PF13869_consen    1 QTIRIYPLSNYTFGTKEAQPEKDPSVAARLQRLKENYEKEGMRRSVEGVLLVHEHGHPHVLLLQIGNTFFKLPGGRLRPG   80 (188)
T ss_dssp             -EEEE-BGGGEEEEEES----SSSSHHHHHHHHHHHHHHHSSEEEEEEEEEEEETTEEEEEEEEETTTEEE-SEEE--TT
T ss_pred             CeEEEecccceeeccCCcccccccCHHHHHHHHHHHHHHhCCceEEEEEEEEecCCCcEEEEEeccCccccCCccEeCCC
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CChHHHHHHHHHhhhCCCCCCCCCCeEeeeeeeeeeCCCCCCCCCCCCCCCCCCcceeEEEEEEEccceeeEeeCCCceE
Q 039176          129 ENEIEGLKRKLTSKLGANSPALVPDWQIGECVAIWWRPNFETIMYPYCPPHITKPKECKKLFLVHLSEREYFAVPKNLKL  208 (282)
Q Consensus       129 E~eieGLKRkL~~~L~~~~~~~~~~WeVGe~Lg~WWRPnFEt~~YPYlPpHITkPKE~kKLylV~LPEk~~F~VPkN~KL  208 (282)
                      |+|++||||+|+++|++.+ +...+|+||||||+|||||||+.||||+||||||||||+|||+|+|||+|.|+|||||||
T Consensus        81 E~e~~gLkrkL~~~l~~~~-~~~~~w~vge~l~~WwRp~Fe~~~YPYlP~HitkPKE~~klylV~Lpe~~~F~VPkn~kL  159 (188)
T PF13869_consen   81 EDEIEGLKRKLTEKLSPED-GVDPDWEVGECLGTWWRPNFEPFMYPYLPPHITKPKECIKLYLVQLPEKCLFAVPKNMKL  159 (188)
T ss_dssp             --HHHHHHHHHHHHHB-SS-SS----EEEEEEEEEEESSSSS--BSS--TT-SS-SEEEEEEEEE--SSEEEEEETTSEE
T ss_pred             CChhHHHHHHHHHHcCCCc-CCCCCcEecCEEEEEeCCCCCCCCCCCCCcccCChhheeEEEEEecCCCceEecCCCCeE
Confidence            9999999999999999744 668999999999999999999999999999999999999999999999999999999999


Q ss_pred             Eeecchhhccccccccceecccccee
Q 039176          209 LAVPLFELYDNVQIWASYFNHSSTAF  234 (282)
Q Consensus       209 lAVPLFELYdN~~~YGpiIsslp~~~  234 (282)
                      +||||||||||+++|||||||||+.+
T Consensus       160 ~AvPLFeLydN~~~YG~~issiP~lL  185 (188)
T PF13869_consen  160 VAVPLFELYDNAQRYGPIISSIPQLL  185 (188)
T ss_dssp             EEEEHHHHTTTHHHHHHHHTTHHHHH
T ss_pred             EeecHhhhhcChhhcCchhhccchHh
Confidence            99999999999999999999999875

...
>KOG1689 consensus mRNA cleavage factor I subunit [RNA processing and modification] Back     alignment and domain information
>cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] Back     alignment and domain information
>cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional Back     alignment and domain information
>cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function Back     alignment and domain information
>cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex Back     alignment and domain information
>PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional Back     alignment and domain information
>cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK15472 nucleoside triphosphatase NudI; Provisional Back     alignment and domain information
>cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PLN02325 nudix hydrolase Back     alignment and domain information
>cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes Back     alignment and domain information
>cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function Back     alignment and domain information
>PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional Back     alignment and domain information
>PLN02709 nudix hydrolase Back     alignment and domain information
>cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD Back     alignment and domain information
>cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily Back     alignment and domain information
>PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional Back     alignment and domain information
>PRK10707 putative NUDIX hydrolase; Provisional Back     alignment and domain information
>cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities Back     alignment and domain information
>cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate Back     alignment and domain information
>cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>PRK00714 RNA pyrophosphohydrolase; Reviewed Back     alignment and domain information
>COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) Back     alignment and domain information
>cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR00586 mutt mutator mutT protein Back     alignment and domain information
>cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily Back     alignment and domain information
>cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway Back     alignment and domain information
>cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP Back     alignment and domain information
>PRK15393 NUDIX hydrolase YfcD; Provisional Back     alignment and domain information
>PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional Back     alignment and domain information
>cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] Back     alignment and domain information
>TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>PRK00241 nudC NADH pyrophosphatase; Reviewed Back     alignment and domain information
>cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P Back     alignment and domain information
>cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X Back     alignment and domain information
>TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family Back     alignment and domain information
>KOG2839 consensus Diadenosine and diphosphoinositol polyphosphate phosphohydrolase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03143 nudix hydrolase; Provisional Back     alignment and domain information
>PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
2j8q_A227 Crystal Structure Of Human Cleavage And Polyadenyla 2e-58
2cl3_A230 Crystal Structure Of Human Cleavage And Polyadenyla 2e-58
3bho_A208 Crystal Structure Of The 25kda Subunit Of Human Cle 2e-58
3q2s_A207 Crystal Structure Of Cfim68 RrmCFIM25 COMPLEX Lengt 3e-58
3mdg_A227 Crystal Structure Of The 25kda Subunit Of Human Cle 3e-58
3p5t_A202 Cfim25-Cfim68 Complex Length = 202 3e-58
3bap_A227 Crystal Structure Of The 25 Kda Subunit Of Human Cl 2e-56
>pdb|2J8Q|A Chain A, Crystal Structure Of Human Cleavage And Polyadenylation Specificity Factor 5 (Cpsf5) In Complex With A Sulphate Ion. Length = 227 Back     alignment and structure 
Iteration: 1

 Score =  222 bits (566), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 105/171 (61%), Positives = 125/171 (73%), Gaps = 1/171 (0%)
Query: 50  VVNTYPLSSYTFGTKEPKMEKDTSVADRLARMKVNYMKEGMRTSVEAILLVQEHNHPHIL 109
            +N YPL++YTFGTKEP  EKD+SVA R  RM+  + K GMR +VE +L+V EH  PH+L
Sbjct: 36  TINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVL 95
Query: 110 LLQIGNTFCKLPGGRLKPGENEIEGLKRKLTSKLGANSPALVPDWQIGECVAIWWRPNFE 169
           LLQ+G TF KLPGG L PGE+E+EGLKR +T  LG     ++ DW I +C+  WWRPNFE
Sbjct: 96  LLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQD-GVLQDWVIDDCIGNWWRPNFE 154
Query: 170 TIMYPYCPPHITKPKECKKLFLVHLSEREYFAVPKNLKLLAVPLFELYDNV 220
              YPY P HITKPKE KKLFLV L E+  FAVPKN KL+A PLFELYDN 
Sbjct: 155 PPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNA 205
>pdb|2CL3|A Chain A, Crystal Structure Of Human Cleavage And Polyadenylation Specificity Factor 5 (Cpsf5) Length = 230 Back     alignment and structure
>pdb|3BHO|A Chain A, Crystal Structure Of The 25kda Subunit Of Human Cleavage Factor Im With Ap4a Length = 208 Back     alignment and structure
>pdb|3Q2S|A Chain A, Crystal Structure Of Cfim68 RrmCFIM25 COMPLEX Length = 207 Back     alignment and structure
>pdb|3MDG|A Chain A, Crystal Structure Of The 25kda Subunit Of Human Cleavage Factor Im In Complex With Rna Uuguau Length = 227 Back     alignment and structure
>pdb|3P5T|A Chain A, Cfim25-Cfim68 Complex Length = 202 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
3bho_A208 Cleavage and polyadenylation specificity factor su 4e-93
2xsq_A217 U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp 8e-05
>3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A Length = 208 Back     alignment and structure
 Score =  273 bits (698), Expect = 4e-93
 Identities = 105/182 (57%), Positives = 127/182 (69%), Gaps = 1/182 (0%)

Query: 40  EKESKMVTSPVVNTYPLSSYTFGTKEPKMEKDTSVADRLARMKVNYMKEGMRTSVEAILL 99
           ++   +     +N YPL++YTFGTKEP  EKD+SVA R  RM+  + K GMR +VE +L+
Sbjct: 7   QQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLI 66

Query: 100 VQEHNHPHILLLQIGNTFCKLPGGRLKPGENEIEGLKRKLTSKLGANSPALVPDWQIGEC 159
           V EH  PH+LLLQ+G TF KLPGG L PGE+E+EGLKR +T  LG      + DW I +C
Sbjct: 67  VHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGV-LQDWVIDDC 125

Query: 160 VAIWWRPNFETIMYPYCPPHITKPKECKKLFLVHLSEREYFAVPKNLKLLAVPLFELYDN 219
           +  WWRPNFE   YPY P HITKPKE KKLFLV L E+  FAVPKN KL+A PLFELYDN
Sbjct: 126 IGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDN 185

Query: 220 VQ 221
             
Sbjct: 186 AP 187
>2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A Length = 217 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
3bho_A208 Cleavage and polyadenylation specificity factor su 100.0
3i7u_A134 AP4A hydrolase; nudix protein, diadenosine polypho 98.15
3eds_A153 MUTT/nudix family protein; MUT/nudix protein, prot 97.91
1ktg_A138 Diadenosine tetraphosphate hydrolase; nudix, AMP, 97.89
2pbt_A134 AP4A hydrolase; nudix protein, diadenosine polypho 97.89
1vcd_A126 NDX1; nudix protein, diadenosine polyphosphate, AP 97.86
3son_A149 Hypothetical nudix hydrolase; structural genomics, 97.79
3oga_A165 Nucleoside triphosphatase NUDI; salmonella enteric 97.69
3f13_A163 Putative nudix hydrolase family member; structural 97.68
3i9x_A187 MUTT/nudix family protein; structural genomics, hy 97.56
3id9_A171 MUTT/nudix family protein; hydrolase, protein stru 97.55
3gz5_A240 MUTT/nudix family protein; DNA binding protein, nu 97.52
2fvv_A194 Diphosphoinositol polyphosphate phosphohydrolase 1 97.5
3f6a_A159 Hydrolase, nudix family; protein structure initiat 97.5
3gg6_A156 Nudix motif 18, nucleoside diphosphate-linked moie 97.48
3shd_A153 Phosphatase NUDJ; nudix fold, nudix motif, hydrola 97.47
2fb1_A226 Conserved hypothetical protein; structural genomic 97.43
3u53_A155 BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; 97.43
2azw_A148 MUTT/nudix family protein; MUTT/nudix ,enterococcu 97.42
2yyh_A139 MUTT domain, 8-OXO-DGTPase domain; nudix family pr 97.41
2o1c_A150 DATP pyrophosphohydrolase; nudix NTP hydrolase NTP 97.38
3gwy_A140 Putative CTP pyrophosphohydrolase; structural geno 97.34
1rya_A160 GDP-mannose mannosyl hydrolase; GDP-glucose, nudix 97.31
2b0v_A153 Nudix hydrolase; structural genomics, PSI, protein 97.29
1sjy_A159 MUTT/nudix family protein; nudix fold, alpha-beta- 97.28
1nqz_A194 COA pyrophosphatase (MUTT/nudix family protein); D 97.26
2fkb_A180 Putative nudix hydrolase YFCD; putative protein, M 97.24
2fml_A273 MUTT/nudix family protein; structural genomics, PS 97.22
3o8s_A206 Nudix hydrolase, ADP-ribose pyrophosphatase; struc 97.2
1q27_A171 Putative nudix hydrolase DR0079; radiation resista 97.2
3h95_A199 Nucleoside diphosphate-linked moiety X motif 6; NU 97.18
1f3y_A165 Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase 97.18
2w4e_A145 MUTT/nudix family protein; ADP-ribose pyrophosphat 97.18
3grn_A153 MUTT related protein; structural genomics, hydrola 97.18
2rrk_A140 ORF135, CTP pyrophosphohydrolase; NMR {Escherichia 97.18
2jvb_A146 Protein PSU1, mRNA-decapping enzyme subunit 2; DCP 97.15
3fcm_A197 Hydrolase, nudix family; protein structure initiat 97.14
3exq_A161 Nudix family hydrolase; protein structure initiati 97.13
2pqv_A154 MUTT/nudix family protein; structu genomics, PSI-2 97.13
3fk9_A188 Mutator MUTT protein; structural genomics, hydrola 97.1
2kdv_A164 RNA pyrophosphohydrolase; nudix family, magnesium, 97.09
3r03_A144 Nudix hydrolase; structural genomics, PSI2, protei 97.09
3ees_A153 Probable pyrophosphohydrolase; nudix, RNA pyrophos 97.08
2b06_A155 MUTT/nudix family protein; structural genomics, P 97.07
1k2e_A156 Nudix homolog; nudix/MUTT-like fold, mixed alpha/b 97.05
3q93_A176 7,8-dihydro-8-oxoguanine triphosphatase; structura 97.04
1hzt_A190 Isopentenyl diphosphate delta-isomerase; dimethyla 97.03
4dyw_A157 MUTT/nudix family protein; structural genomics, ni 97.0
3cng_A189 Nudix hydrolase; structural genomics, APC7497, PSI 97.0
2yvp_A182 NDX2, MUTT/nudix family protein; nudix protein, AD 96.97
1v8y_A170 ADP-ribose pyrophosphatase; nudix motif, loop-heli 96.93
3hhj_A158 Mutator MUTT protein; niaid, ssgcid, decode, UW, S 96.93
3q1p_A205 Phosphohydrolase (MUTT/nudix family protein); asym 96.91
2a6t_A271 SPAC19A8.12; alpha/beta/alpha, RNA binding protein 96.86
1vhz_A198 ADP compounds hydrolase NUDE; structural genomics; 96.74
1mut_A129 MUTT, nucleoside triphosphate pyrophosphohydrolase 96.72
1q33_A292 Pyrophosphatase, ADP-ribose pyrophosphatase; nudix 96.5
2qjo_A341 Bifunctional NMN adenylyltransferase/nudix hydrol; 96.34
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two i 96.22
1mk1_A207 ADPR pyrophosphatase; nudix hydrolase, adprase, ad 96.21
1x51_A155 A/G-specific adenine DNA glycosylase; nudix domain 96.14
1vk6_A269 NADH pyrophosphatase; 1790429, structural genomics 96.04
1u20_A212 U8 snoRNA-binding protein X29; modified nudix hydr 96.04
3fjy_A 364 Probable MUTT1 protein; dimer, protein structure i 95.71
2dsc_A212 ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP 95.66
1g0s_A209 Hypothetical 23.7 kDa protein in ICC-TOLC intergen 95.43
3kvh_A214 Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R 95.06
2xsq_A217 U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp 94.86
3o6z_A191 GDP-mannose pyrophosphatase NUDK; nudix, hydrolase 94.72
3e57_A211 Uncharacterized protein TM1382; structural genomic 94.02
2dho_A235 Isopentenyl-diphosphate delta-isomerase 1; alpha/b 93.02
3qsj_A232 Nudix hydrolase; structural genomics, PSI-biology, 92.18
2pny_A246 Isopentenyl-diphosphate delta-isomerase 2; caroten 91.98
3fsp_A369 A/G-specific adenine glycosylase; protein-DNA comp 91.15
3q91_A218 Uridine diphosphate glucose pyrophosphatase; struc 90.19
>3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A Back     alignment and structure
Probab=100.00  E-value=9.6e-84  Score=572.44  Aligned_cols=190  Identities=55%  Similarity=0.993  Sum_probs=179.9

Q ss_pred             ccCCCeEEEeeCCceeeccCCCCcccCccHHHHHHHHHHHHhhccceeEEEEEEEEecCCCCeEEEeeecCceecCCCcc
Q 039176           45 MVTSPVVNTYPLSSYTFGTKEPKMEKDTSVADRLARMKVNYMKEGMRTSVEAILLVQEHNHPHILLLQIGNTFCKLPGGR  124 (282)
Q Consensus        45 m~~~~~v~IYPLsNYtFgtKe~~~eKD~sv~~Rl~Rlk~~Y~k~GmRrSVegVLLVH~h~hPHVLLLQ~~nsffkLPGGr  124 (282)
                      +..+++|+|||++||+||+||+++|||+|+++|++||+++|++.|||+||+|||+||+|+||||||+|.++++|+||||+
T Consensus        12 ~~~~~~~~iYplsnY~f~~k~~~~ekd~s~~~r~~rl~~~y~~~g~R~sV~avil~~~~~~phVLLlq~~~~~f~LPGGk   91 (208)
T 3bho_A           12 LTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGE   91 (208)
T ss_dssp             TTTCCEEEECBGGGEEEEEECCCCCSCSSHHHHHHHHHHHHHHHCSEEEEEEEEEEEETTEEEEEEEEEETTEEECSEEE
T ss_pred             ccccceEEEecccceeEccCCccccccccHHHHHHHHHHHHHhhCCceEEEEEEEEcCCCCcEEEEEEcCCCcEECCCcc
Confidence            34467899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCChHHHHHHHHHhhhCCCCCCCCCCeEeeeeeeeeeCCCCCCCCCCCCCCCCCCcceeEEEEEEEccceeeEeeCC
Q 039176          125 LKPGENEIEGLKRKLTSKLGANSPALVPDWQIGECVAIWWRPNFETIMYPYCPPHITKPKECKKLFLVHLSEREYFAVPK  204 (282)
Q Consensus       125 LrpgE~eieGLKRkL~~~L~~~~~~~~~~WeVGe~Lg~WWRPnFEt~~YPYlPpHITkPKE~kKLylV~LPEk~~F~VPk  204 (282)
                      +++||++++||+|+|++.|+. +++...+|+||||||+|||||||+.+|||+||||||||||+|||+|+|||+|.|+|||
T Consensus        92 le~gE~~~eaL~REL~EELg~-~~~~~~~~eIge~lg~wwRp~fet~~YPYlP~Hit~pKE~~kly~V~Lp~~~~f~vPk  170 (208)
T 3bho_A           92 LNPGEDEVEGLKRLMTEILGR-QDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPK  170 (208)
T ss_dssp             CCTTCCHHHHHHHHHHHHHCC-CC-----CEEEEEEEEEEECSSSSCCBSSCCTTCCSCSEEEEEEEEECCSSEEEEEET
T ss_pred             cCCCCCHHHHHHHHHHHHhCC-CcCCCccEEEhheEEEEecCCCCCcCCCCCCcccCchhhheeeeeEecCccceEecCC
Confidence            999999999999999999997 5667789999999999999999999999999999999999999999999999999999


Q ss_pred             CceEEeecchhhccccccccceeccccceee
Q 039176          205 NLKLLAVPLFELYDNVQIWASYFNHSSTAFQ  235 (282)
Q Consensus       205 N~KLlAVPLFELYdN~~~YGpiIsslp~~~~  235 (282)
                      ||||+||||||||||+++|||||||||+.+.
T Consensus       171 n~kL~AvPLfely~N~~~yG~~issiP~llS  201 (208)
T 3bho_A          171 NYKLVAAPLFELYDNAPGYGPIISSLPQLLS  201 (208)
T ss_dssp             TCEEEEEEHHHHTTCHHHHHHHHTTHHHHHT
T ss_pred             CCeEEeecHHhhhcchhhhchhhhhhhhhhh
Confidence            9999999999999999999999999999864
>3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* Back     alignment and structure
>1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* Back     alignment and structure
>1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* Back     alignment and structure
>3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} Back     alignment and structure
>3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A Back     alignment and structure
>3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} Back     alignment and structure
>3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} Back     alignment and structure
>3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} Back     alignment and structure
>3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* Back     alignment and structure
>2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* Back     alignment and structure
>3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A Back     alignment and structure
>2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* Back     alignment and structure
>2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 Back     alignment and structure
>2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} Back     alignment and structure
>2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A Back     alignment and structure
>3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 Back     alignment and structure
>1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* Back     alignment and structure
>2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 Back     alignment and structure
>1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* Back     alignment and structure
>1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A Back     alignment and structure
>2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 Back     alignment and structure
>2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 Back     alignment and structure
>3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} Back     alignment and structure
>1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A Back     alignment and structure
>3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} Back     alignment and structure
>1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* Back     alignment and structure
>2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} Back     alignment and structure
>3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} Back     alignment and structure
>2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} Back     alignment and structure
>2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} Back     alignment and structure
>3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} Back     alignment and structure
>2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A Back     alignment and structure
>3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 Back     alignment and structure
>3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Back     alignment and structure
>2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 Back     alignment and structure
>1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A Back     alignment and structure
>3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A Back     alignment and structure
>1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* Back     alignment and structure
>4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} Back     alignment and structure
>3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} Back     alignment and structure
>2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* Back     alignment and structure
>1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A Back     alignment and structure
>3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Back     alignment and structure
>3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A Back     alignment and structure
>2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* Back     alignment and structure
>1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* Back     alignment and structure
>1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* Back     alignment and structure
>1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Back     alignment and structure
>1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* Back     alignment and structure
>1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 Back     alignment and structure
>1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A Back     alignment and structure
>1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* Back     alignment and structure
>1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A Back     alignment and structure
>3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} Back     alignment and structure
>2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A Back     alignment and structure
>3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A Back     alignment and structure
>3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} Back     alignment and structure
>2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* Back     alignment and structure
>3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} Back     alignment and structure
>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* Back     alignment and structure
>3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 282
d1vcda1126 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus t 0.002
>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Length = 126 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: AP6A hydrolase Ndx1
species: Thermus thermophilus [TaxId: 274]

 Score = 35.0 bits (80), Expect = 0.002
 Identities = 22/125 (17%), Positives = 38/125 (30%), Gaps = 11/125 (8%)

Query: 90  MRTSVEAILLVQEHNHPHILLLQIGNTFCKLPGGRLKPGENEIEGLKRKLTSKLGANSPA 149
           M      ++    +    +LLL+    F   P G  +PGE+  E   R++  + G     
Sbjct: 1   MELGAGGVVF---NAKREVLLLRDRMGFWVFPKGHPEPGESLEEAAVREVWEETGVR--- 54

Query: 150 LVPDWQIGECVAIWWRPNFETIMYPYCPPHITKPK---ECKKLFLVHLSE-REYFAVPKN 205
                              E  ++ +       P+              E R   A P++
Sbjct: 55  -AEVLLPLYPTRYVNPKGVEREVHWFLMRGEGAPRLEEGMTGAGWFSPEEARALLAFPED 113

Query: 206 LKLLA 210
           L LL 
Sbjct: 114 LGLLE 118

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
d2fvva1135 Diphosphoinositol polyphosphate phosphohydrolase { 98.14
d1vcda1126 AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 97.83
d1ktga_137 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 97.73
d1k2ea_152 Hypothetical protein PAE3301 {Archaeon Pyrobaculum 97.72
d2a6ta2151 mRNA decapping enzyme Dcp2p catalytic domain {Schi 97.67
d2fb1a2147 Hypothetical protein BT0354, N-terminal domain {Ba 97.65
d1puna_129 Nucleoside triphosphate pyrophosphorylase (MutT) { 97.63
d1ryaa_160 GDP-mannose mannosyl hydrolase NudD {Escherichia c 97.53
d1sjya_158 Hypothetical protein DR1025 {Deinococcus radiodura 97.48
d1jkna_165 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 97.43
d2fmla2202 Hypothetical protein EF2700, N-terminal domain {En 97.42
d1irya_156 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum 97.35
d1nqza_187 Coenzyme A pyrophosphatase {Deinococcus radioduran 97.35
d1vk6a2131 NADH pyrophosphatase {Escherichia coli [TaxId: 562 97.33
d2b06a1155 Hypothetical protein SP1235 (spr1115) {Streptococc 97.32
d2azwa1147 Hypothetical protein EF1141 {Enterococcus faecalis 97.29
d2b0va1146 Hypothetical protein NE0184 {Nitrosomonas europaea 97.26
d1xsba_153 Diadenosine tetraphosphate hydrolase (Ap4A hydrola 96.91
d2fkba1161 Hypothetical protein YfcD {Escherichia coli [TaxId 96.86
d1u20a1196 U8 snorna-binding protein x29 {African clawed frog 96.1
d1vhza_186 ADP compounds hydrolase NudE {Escherichia coli [Ta 95.82
d2o5fa1162 Hypothetical protein DR0079 {Deinococcus radiodura 95.81
d1v8ya_158 ADP-ribose pyrophosphatase {Thermus thermophilus [ 94.93
d1hzta_153 Isopentenyl diphosphate isomerase {Escherichia col 94.84
d1q33a_292 NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { 93.48
d1mqea_202 ADP-ribose pyrophosphatase {Mycobacterium tubercul 92.09
d1rrqa2127 Adenine glycosylase MutY, C-terminal domain {Bacil 89.46
d1g0sa_209 ADP-ribose pyrophosphatase {Escherichia coli [TaxI 87.04
>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Nudix
superfamily: Nudix
family: MutT-like
domain: Diphosphoinositol polyphosphate phosphohydrolase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.14  E-value=2.2e-06  Score=65.21  Aligned_cols=75  Identities=20%  Similarity=0.374  Sum_probs=57.1

Q ss_pred             HHhhccceeEEEEEEEEecCCCCeEEEeeec--CceecCCCccccCCCChHHHHHHHHHhhhCCCCCCCCCCeEeeeeee
Q 039176           84 NYMKEGMRTSVEAILLVQEHNHPHILLLQIG--NTFCKLPGGRLKPGENEIEGLKRKLTSKLGANSPALVPDWQIGECVA  161 (282)
Q Consensus        84 ~Y~k~GmRrSVegVLLVH~h~hPHVLLLQ~~--nsffkLPGGrLrpgE~eieGLKRkL~~~L~~~~~~~~~~WeVGe~Lg  161 (282)
                      .|++.|.|+.+.+|++... +.-.+||++..  ...|.+|||.+.+||+..++++|.+.+-.|-       .-.+.+.++
T Consensus         4 ~~~~~~~r~~a~~vv~~~~-~~~~~lL~~~~~~~~~W~~PgG~ve~gEs~~~aa~RE~~EEtGl-------~~~~~~~~~   75 (135)
T d2fvva1           4 TYDGDGYKKRAACLCFRSE-SEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGV-------KGTLGRLVG   75 (135)
T ss_dssp             CBCTTSCEEEEEEEEESST-TCCEEEEEECSSCTTSEECSEEECCTTCCHHHHHHHHHHHHHCE-------EEEEEEEEE
T ss_pred             ecCCCCCceEEEEEEEEec-CCCEEEEEEEeCCCCcEECCccccCCCCCHHHHHHHHHHHHhCC-------cceeeEEEE
Confidence            3788999999877777654 44455566543  3579999999999999999999999999985       234556777


Q ss_pred             eeeCC
Q 039176          162 IWWRP  166 (282)
Q Consensus       162 ~WWRP  166 (282)
                      .+..+
T Consensus        76 ~~~~~   80 (135)
T d2fvva1          76 IFENQ   80 (135)
T ss_dssp             EEEET
T ss_pred             EEeec
Confidence            76543
>d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} Back     information, alignment and structure
>d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} Back     information, alignment and structure
>d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure