Citrus Sinensis ID: 039191

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220
MAMAKSVVVSLTIMALFGAAMAATYTVGDDAGWTIQGHIDYSKWAEGKQFHVGDTLVFKYNKAMHDVRQVSHEDFQSCNAKAPIEEYTTGMDSITLKMAGHHYFLCGIPGHCQVGQKVEINVLPGASSPGESPAPSPSHNGSPAPSPSHTESPAPSPGHTGSSTPPPSSGGSSSSTPAEPGEGSSSSTPPPSSSAPSLWSSNFWFAAPGMLAVFLTAFAF
cccHHHHHHHHHHHHHHHHccccEEEEcccccccccccccHHHHcccccEEEccEEEEEEccccccEEEEcHHHHcccccccccccccccccEEEccccccEEEEcccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcc
cHHHHHHHHHHHHHHHHHHHHccEEEEccccccEccccccHHHccccccEccccEEEEEcccccccEEEEcHHHHHHcccccccEEEcccEEEEEccccccEEEEEccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcc
MAMAKSVVVSLTIMALFGAAMAATytvgddagwtiqghidyskwaegkqfhvgdTLVFKYNKAmhdvrqvshedfqscnakapieeyttgmdsiTLKMAGHHyflcgipghcqvgqkveinvlpgasspgespapspshngspapspshtespapspghtgsstpppssggsssstpaepgegsssstpppsssapslwssnfwfaaPGMLAVFLTAFAF
MAMAKSVVVSLTIMALFGAAMAATYTVGDDAGWTIQGHIDYSKWAEGKQFHVGDTLVFKYNKAMHDVRQVSHEDFQSCNAKAPIEEYTTGMDSITLKMAGHHYFLCGIPGHCQVGQKVEINVLPGASSPGESPAPSPSHNGSPAPSPSHTESPAPSPGHTGSSTPPPSSGGSSSSTPAEPGEGSSSSTPPPSSSAPSLWSSNFWFAAPGMLAVFLTAFAF
MAMAKSVVVSLTIMALFGAAMAATYTVGDDAGWTIQGHIDYSKWAEGKQFHVGDTLVFKYNKAMHDVRQVSHEDFQSCNAKAPIEEYTTGMDSITLKMAGHHYFLCGIPGHCQVGQKVEINVLpgasspgespapspsHNGSPAPSPSHTEspapspghtgsstpppssggsssstpaepgegsssstpppsssapsLWSSNFWFAAPGMLAVFLTAFAF
******VVVSLTIMALFGAAMAATYTVGDDAGWTIQGHIDYSKWAEGKQFHVGDTLVFKYNKAMHDVRQVSHEDFQSCNAKAPIEEYTTGMDSITLKMAGHHYFLCGIPGHCQVGQKVEINVL**************************************************************************LWSSNFWFAAPGMLAVFLTAF**
***AKSVVVSLTIMALFGAAMAATYTVGDDAGWTIQGHIDYSKWAEGKQFHVGDTLVFKYNKAMHDVRQVSHEDFQSCNAKAPIEEYTTGMDSITLKMAGHHYFLCGIPGHCQVGQKVEIN*******************************************************************************SNFWFAAPGMLAVFLTAFAF
MAMAKSVVVSLTIMALFGAAMAATYTVGDDAGWTIQGHIDYSKWAEGKQFHVGDTLVFKYNKAMHDVRQVSHEDFQSCNAKAPIEEYTTGMDSITLKMAGHHYFLCGIPGHCQVGQKVEINVLPG***********************************************************************SLWSSNFWFAAPGMLAVFLTAFAF
MAMAKSVVVSLTIMALFGAAMAATYTVGDDAGWTIQGHIDYSKWAEGKQFHVGDTLVFKYNKAMHDVRQVSHEDFQSCNAKAPIEEYTTGMDSITLKMAGHHYFLCGIPGHCQVGQKVEINVLPG********************************************************************SAPSLWSSNFWFAAPGMLAVFLTAFAF
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHo
oooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoo
oooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHi
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAMAKSVVVSLTIMALFGAAMAATYTVGDDAGWTIQGHIDYSKWAEGKQFHVGDTLVFKYNKAMHDVRQVSHEDFQSCNAKAPIEEYTTGMDSITLKMAGHHYFLCGIPGHCQVGQKVEINVLPGASSPGESPAPSPSHNGSPAPSPSHTESPAPSPGHTGSSTPPPSSGGSSSSTPAEPGEGSSSSTPPPSSSAPSLWSSNFWFAAPGMLAVFLTAFAF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query220 2.2.26 [Sep-21-2011]
P80728108 Mavicyanin OS=Cucurbita p N/A no 0.486 0.990 0.579 1e-31
P00302107 Stellacyanin OS=Toxicoden N/A no 0.45 0.925 0.519 8e-28
Q41001189 Blue copper protein OS=Pi N/A no 0.540 0.629 0.44 6e-23
P0030396 Basic blue protein OS=Cuc N/A no 0.436 1.0 0.435 3e-18
Q07488196 Blue copper protein OS=Ar no no 0.772 0.867 0.317 3e-18
Q9SK27182 Early nodulin-like protei no no 0.631 0.763 0.35 6e-18
P60496126 Chemocyanin OS=Lilium lon N/A no 0.436 0.761 0.445 3e-17
Q9T076 349 Early nodulin-like protei no no 0.6 0.378 0.299 1e-16
Q8LG89129 Basic blue protein OS=Ara no no 0.509 0.868 0.366 3e-16
Q39131172 Lamin-like protein OS=Ara no no 0.531 0.680 0.343 2e-15
>sp|P80728|MAVI_CUCPE Mavicyanin OS=Cucurbita pepo PE=1 SV=1 Back     alignment and function desciption
 Score =  136 bits (342), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 62/107 (57%), Positives = 74/107 (69%)

Query: 22  AATYTVGDDAGWTIQGHIDYSKWAEGKQFHVGDTLVFKYNKAMHDVRQVSHEDFQSCNAK 81
           A  + VGD  GWT     DY+KWA   +FHVGD+L+F YN   H+V QV  E F+SCN+ 
Sbjct: 1   ATVHKVGDSTGWTTLVPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNSS 60

Query: 82  APIEEYTTGMDSITLKMAGHHYFLCGIPGHCQVGQKVEINVLPGASS 128
           +P   YT+G DSI LK  G  YFLCGIPGHCQ+GQKVEI V PG+SS
Sbjct: 61  SPAASYTSGADSIPLKRPGTFYFLCGIPGHCQLGQKVEIKVDPGSSS 107

Cucurbita pepo (taxid: 3663)
>sp|P00302|STEL_TOXVR Stellacyanin OS=Toxicodendron vernicifluum PE=1 SV=1 Back     alignment and function description
>sp|Q41001|BCP_PEA Blue copper protein OS=Pisum sativum PE=2 SV=1 Back     alignment and function description
>sp|P00303|BABL_CUCSA Basic blue protein OS=Cucumis sativus PE=1 SV=1 Back     alignment and function description
>sp|Q07488|BCB1_ARATH Blue copper protein OS=Arabidopsis thaliana GN=BCB PE=1 SV=2 Back     alignment and function description
>sp|Q9SK27|ENL1_ARATH Early nodulin-like protein 1 OS=Arabidopsis thaliana GN=At2g25060 PE=1 SV=2 Back     alignment and function description
>sp|P60496|BABL_LILLO Chemocyanin OS=Lilium longiflorum PE=1 SV=1 Back     alignment and function description
>sp|Q9T076|ENL2_ARATH Early nodulin-like protein 2 OS=Arabidopsis thaliana GN=At4g27520 PE=1 SV=1 Back     alignment and function description
>sp|Q8LG89|BABL_ARATH Basic blue protein OS=Arabidopsis thaliana GN=ARPN PE=1 SV=2 Back     alignment and function description
>sp|Q39131|LAML_ARATH Lamin-like protein OS=Arabidopsis thaliana GN=At5g15350 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query220
356534224185 PREDICTED: mavicyanin-like [Glycine max] 0.781 0.929 0.489 6e-41
351722607183 uncharacterized protein LOC100306029 [Gl 0.745 0.896 0.453 5e-39
357480825182 Early nodulin-like protein [Medicago tru 0.677 0.818 0.493 2e-37
255552341200 Mavicyanin, putative [Ricinus communis] 0.554 0.61 0.573 7e-37
224161493147 predicted protein [Populus trichocarpa] 0.513 0.768 0.575 2e-35
224064047126 predicted protein [Populus trichocarpa] 0.522 0.912 0.565 3e-35
319433449189 copper binding protein 7 [Gossypium hirs 0.7 0.814 0.475 5e-35
449444779185 PREDICTED: mavicyanin-like [Cucumis sati 0.577 0.686 0.530 8e-35
351723741183 uncharacterized protein LOC100305939 pre 0.609 0.732 0.510 1e-34
225432610190 PREDICTED: mavicyanin [Vitis vinifera] g 0.595 0.689 0.503 2e-34
>gi|356534224|ref|XP_003535657.1| PREDICTED: mavicyanin-like [Glycine max] Back     alignment and taxonomy information
 Score =  172 bits (437), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 89/182 (48%), Positives = 112/182 (61%), Gaps = 10/182 (5%)

Query: 1   MAMAKSVVVSLTIMALFGAAMAATYTVGDDAGWTIQGHIDYSKWAEGKQFHVGDTLVFKY 60
           MA+ + VVV   +MA    + AA Y VGD AGWT  G IDY KWA  K F +GDT++F+Y
Sbjct: 1   MALVERVVVLFIVMAFVQVSFAAVYKVGDSAGWTTLGTIDYRKWAATKNFQIGDTIIFEY 60

Query: 61  NKAMHDVRQVSHEDFQSCNAKAPIEEYTTGMDSITLKMAGHHYFLCGIPGHCQVGQKVEI 120
           N   H+V +V+H  +++CNA +PI  +TTG DSI +   GHH+F CG+PGHCQ GQKV+I
Sbjct: 61  NAKFHNVMRVTHAIYKTCNASSPIATFTTGKDSINITNHGHHFFFCGVPGHCQAGQKVDI 120

Query: 121 NVLPGASSPGESPAPSPSHNGSPAPSPSHTESPAPSPGHTGSSTPPPSSGGSSSSTPAEP 180
           NVL   S   E+P PS S   SP    S    PAPSP +   +TP  S  GS  S   EP
Sbjct: 121 NVL---SISAEAPTPSGSALASPTVQTSTV--PAPSPSN---ATPLISLKGSFGS--LEP 170

Query: 181 GE 182
            E
Sbjct: 171 RE 172

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|351722607|ref|NP_001236482.1| uncharacterized protein LOC100306029 [Glycine max] gi|255627325|gb|ACU14007.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357480825|ref|XP_003610698.1| Early nodulin-like protein [Medicago truncatula] gi|355512033|gb|AES93656.1| Early nodulin-like protein [Medicago truncatula] gi|388518523|gb|AFK47323.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|255552341|ref|XP_002517215.1| Mavicyanin, putative [Ricinus communis] gi|223543850|gb|EEF45378.1| Mavicyanin, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224161493|ref|XP_002338337.1| predicted protein [Populus trichocarpa] gi|222871932|gb|EEF09063.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224064047|ref|XP_002301365.1| predicted protein [Populus trichocarpa] gi|222843091|gb|EEE80638.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|319433449|gb|ADV57642.1| copper binding protein 7 [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|449444779|ref|XP_004140151.1| PREDICTED: mavicyanin-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|351723741|ref|NP_001235242.1| uncharacterized protein LOC100305939 precursor [Glycine max] gi|255627039|gb|ACU13864.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225432610|ref|XP_002281674.1| PREDICTED: mavicyanin [Vitis vinifera] gi|297737024|emb|CBI26225.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query220
TAIR|locus:2151069187 AT5G26330 [Arabidopsis thalian 0.55 0.647 0.491 1.6e-31
TAIR|locus:2043833206 AT2G26720 [Arabidopsis thalian 0.663 0.708 0.432 5.6e-29
TAIR|locus:2052866200 AT2G31050 [Arabidopsis thalian 0.554 0.61 0.472 2.2e-27
TAIR|locus:2062525261 UCC1 "uclacyanin 1" [Arabidops 0.631 0.532 0.359 1e-22
TAIR|locus:2154679 370 ENODL1 "early nodulin-like pro 0.65 0.386 0.357 8.6e-21
TAIR|locus:2083931310 AT3G53330 [Arabidopsis thalian 0.445 0.316 0.464 2.1e-20
TAIR|locus:2081952187 AT3G60270 [Arabidopsis thalian 0.645 0.759 0.356 2.1e-20
TAIR|locus:1009023108 369 AT1G45063 [Arabidopsis thalian 0.518 0.308 0.381 2.6e-18
TAIR|locus:2042426202 UCC2 "uclacyanin 2" [Arabidops 0.522 0.569 0.392 4.6e-18
TAIR|locus:2056700129 ARPN "plantacyanin" [Arabidops 0.522 0.891 0.357 5.8e-18
TAIR|locus:2151069 AT5G26330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 346 (126.9 bits), Expect = 1.6e-31, P = 1.6e-31
 Identities = 60/122 (49%), Positives = 83/122 (68%)

Query:     3 MAKSVVVSLT-IMALFGAAMAATYTVGDDAGWTIQGHIDYSKWAEGKQFHVGDTLVFKYN 61
             MA  +V +L  I+ +   + AA Y VGD AGWT   ++DY  WA  K FH+GDT++F+YN
Sbjct:     1 MAAIIVAALACIVVMLRLSEAAVYKVGDSAGWTTIANVDYKLWASTKTFHIGDTVLFEYN 60

Query:    62 KAMHDVRQVSHEDFQSCNAKAPIEEYTTGMDSITLKMAGHHYFLCGIPGHCQVGQKVEIN 121
                H+V +V+H  ++SCN   PI  +TTG DSITL   GHH+F CG+PGHC  GQK++++
Sbjct:    61 PQFHNVMRVTHPMYRSCNTSKPISTFTTGNDSITLTNHGHHFFFCGVPGHCLAGQKLDLH 120

Query:   122 VL 123
             VL
Sbjct:   121 VL 122
GO:0005507 "copper ion binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA
GO:0031225 "anchored to membrane" evidence=TAS
GO:0010413 "glucuronoxylan metabolic process" evidence=RCA
GO:0042546 "cell wall biogenesis" evidence=RCA
GO:0044036 "cell wall macromolecule metabolic process" evidence=RCA
GO:0045492 "xylan biosynthetic process" evidence=RCA
TAIR|locus:2043833 AT2G26720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2052866 AT2G31050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062525 UCC1 "uclacyanin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154679 ENODL1 "early nodulin-like protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083931 AT3G53330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081952 AT3G60270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023108 AT1G45063 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042426 UCC2 "uclacyanin 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2056700 ARPN "plantacyanin" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query220
pfam0229884 pfam02298, Cu_bind_like, Plastocyanin-like domain 5e-42
PLN03148167 PLN03148, PLN03148, Blue copper-like protein; Prov 1e-19
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 4e-06
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 8e-06
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-05
pfam04652315 pfam04652, DUF605, Vta1 like 4e-05
PRK14959 624 PRK14959, PRK14959, DNA polymerase III subunits ga 4e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 6e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 1e-04
pfam04652315 pfam04652, DUF605, Vta1 like 1e-04
PRK14959 624 PRK14959, PRK14959, DNA polymerase III subunits ga 1e-04
PRK14971 614 PRK14971, PRK14971, DNA polymerase III subunits ga 1e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 3e-04
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-04
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-04
pfam05053618 pfam05053, Menin, Menin 3e-04
pfam12238201 pfam12238, MSA-2c, Merozoite surface antigen 2c 4e-04
PLN02217670 PLN02217, PLN02217, probable pectinesterase/pectin 5e-04
PLN02217670 PLN02217, PLN02217, probable pectinesterase/pectin 5e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 6e-04
pfam04652315 pfam04652, DUF605, Vta1 like 8e-04
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 9e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.001
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.001
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.001
pfam09507 427 pfam09507, CDC27, DNA polymerase subunit Cdc27 0.001
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 0.001
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.002
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.003
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.003
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.004
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.004
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.004
>gnl|CDD|216965 pfam02298, Cu_bind_like, Plastocyanin-like domain Back     alignment and domain information 
 Score =  137 bits (346), Expect = 5e-42
 Identities = 46/84 (54%), Positives = 58/84 (69%)

Query: 33  WTIQGHIDYSKWAEGKQFHVGDTLVFKYNKAMHDVRQVSHEDFQSCNAKAPIEEYTTGMD 92
           WT+  + DY+ WA GK F VGDTLVF Y+K  H+V +V+  D++SCN   PI  YTTG D
Sbjct: 1   WTVPLNADYTLWASGKTFRVGDTLVFNYDKGFHNVVEVTKADYESCNTSKPIRTYTTGND 60

Query: 93  SITLKMAGHHYFLCGIPGHCQVGQ 116
            I L   G HYF+CG+PGHC+ GQ
Sbjct: 61  IIPLTKPGQHYFICGVPGHCKGGQ 84

This family represents a domain found in flowering plants related to the copper binding protein plastocyanin. Some members of this family may not bind copper due to the lack of key residues. Length = 84
>gnl|CDD|178693 PLN03148, PLN03148, Blue copper-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|191179 pfam05053, Menin, Menin Back     alignment and domain information
>gnl|CDD|221480 pfam12238, MSA-2c, Merozoite surface antigen 2c Back     alignment and domain information
>gnl|CDD|215130 PLN02217, PLN02217, probable pectinesterase/pectinesterase inhibitor Back     alignment and domain information
>gnl|CDD|215130 PLN02217, PLN02217, probable pectinesterase/pectinesterase inhibitor Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 220
PLN03148167 Blue copper-like protein; Provisional 100.0
PF0229885 Cu_bind_like: Plastocyanin-like domain; InterPro: 99.97
PRK02710119 plastocyanin; Provisional 98.41
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 98.33
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 98.17
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 98.15
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 97.96
COG3794128 PetE Plastocyanin [Energy production and conversio 97.91
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 97.37
TIGR0265783 amicyanin amicyanin. Members of this family are am 97.07
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 96.59
PF00812145 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a 96.54
KOG3858233 consensus Ephrin, ligand for Eph receptor tyrosine 95.15
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 94.22
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 93.81
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 93.04
COG4454158 Uncharacterized copper-binding protein [Inorganic 92.48
KOG1924 1102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 89.13
TIGR02695125 azurin azurin. Azurin is a blue copper-binding pro 89.09
PF07732117 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01 85.9
TIGR02376311 Cu_nitrite_red nitrite reductase, copper-containin 85.54
PRK02888635 nitrous-oxide reductase; Validated 83.18
PLN02604 566 oxidoreductase 83.03
TIGR02866201 CoxB cytochrome c oxidase, subunit II. Cytochrome 81.58
>PLN03148 Blue copper-like protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.4e-41  Score=283.63  Aligned_cols=114  Identities=33%  Similarity=0.658  Sum_probs=104.3

Q ss_pred             HHHHHHHHHhhhccceEEEecCCCCceeeCCCCcccccCCCeeeeCCEEEeeecCCCCcEEEeCccCCCCCCCCCCcccc
Q 039191            8 VVSLTIMALFGAAMAATYTVGDDAGWTIQGHIDYSKWAEGKQFHVGDTLVFKYNKAMHDVRQVSHEDFQSCNAKAPIEEY   87 (220)
Q Consensus         8 ~~~l~~~~l~~~a~A~~~~VGg~~GW~~~~~~~Y~~WAs~~tF~VGDtLvF~y~~~~HsV~~V~~~~Y~~C~~s~pi~~~   87 (220)
                      ++++++++++..+.+++|+|||+.||+.  +.||++|+++++|++||+|+|+|++++|||+||++++|++|+.++++..+
T Consensus         6 l~~~~~~~~~~~~~a~~~~VGd~~GW~~--~~~Y~~WA~~k~F~VGD~LvF~Y~~~~hnV~~V~~~~Y~~C~~~~pi~~~   83 (167)
T PLN03148          6 LFCFFALFSASATTATDHIVGANKGWNP--GINYTLWANNQTFYVGDLISFRYQKTQYNVFEVNQTGYDNCTTEGAAGNW   83 (167)
T ss_pred             HHHHHHHHhhhhccceEEEeCCCCCcCC--CCChhHhhcCCCCccCCEEEEEecCCCceEEEEChHHcCcccCCCCccee
Confidence            3333444556788899999999999996  78999999999999999999999999999999999999999999999999


Q ss_pred             ccCCcEEEeeccccEEEEcCCCCCCCCCCeEEEEecC
Q 039191           88 TTGMDSITLKMAGHHYFLCGIPGHCQVGQKVEINVLP  124 (220)
Q Consensus        88 s~G~~~v~L~~pG~~YFiCgv~~HC~~GmKl~I~V~~  124 (220)
                      ++|++.|+|+++|+|||||+ .+||++||||.|+|.+
T Consensus        84 tsG~d~v~L~~~G~~YFIcg-~ghC~~GmKl~I~V~~  119 (167)
T PLN03148         84 TSGKDFIPLNKAKRYYFICG-NGQCFNGMKVTILVHP  119 (167)
T ss_pred             cCCCcEEEecCCccEEEEcC-CCccccCCEEEEEEcC
Confidence            99999999999999999999 5899999999999963

>PF02298 Cu_bind_like: Plastocyanin-like domain; InterPro: IPR003245 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>PF00812 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a family of proteins [] that are ligands of class V (EPH-related) receptor protein-tyrosine kinases (see IPR001426 from INTERPRO) Back     alignment and domain information
>KOG3858 consensus Ephrin, ligand for Eph receptor tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>TIGR02695 azurin azurin Back     alignment and domain information
>PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PLN02604 oxidoreductase Back     alignment and domain information
>TIGR02866 CoxB cytochrome c oxidase, subunit II Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query220
1ws7_A109 Crystal Structure Of Mavicyanin From Cucurbita Pepo 8e-32
2cbp_A96 Cucumber Basic Protein, A Blue Copper Protein Lengt 4e-20
1x9r_A116 Umecyanin From Horse Raddish- Crystal Structure Of 7e-16
1f56_A91 Spinach Plantacyanin Length = 91 2e-14
1jer_A138 Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 4e-13
>pdb|1WS7|A Chain A, Crystal Structure Of Mavicyanin From Cucurbita Pepo Medullosa (Zucchini) Length = 109 Back     alignment and structure 
Iteration: 1

 Score =  133 bits (335), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 59/102 (57%), Positives = 70/102 (68%)
Query: 21  MAATYTVGDDAGWTIQGHIDYSKWAEGKQFHVGDTLVFKYNKAMHDVRQVSHEDFQSCNA 80
           MA  + VGD  GWT     DY+KWA   +FHVGD+L+F YN   H+V QV  E F+SCN+
Sbjct: 1   MATVHKVGDSTGWTTLVPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNS 60
Query: 81  KAPIEEYTTGMDSITLKMAGHHYFLCGIPGHCQVGQKVEINV 122
            +P   YT+G DSI LK  G  YFLCGIPGHCQ+GQKVEI V
Sbjct: 61  SSPAASYTSGADSIPLKRPGTFYFLCGIPGHCQLGQKVEIKV 102
>pdb|2CBP|A Chain A, Cucumber Basic Protein, A Blue Copper Protein Length = 96 Back     alignment and structure
>pdb|1X9R|A Chain A, Umecyanin From Horse Raddish- Crystal Structure Of The Oxidised Form Length = 116 Back     alignment and structure
>pdb|1F56|A Chain A, Spinach Plantacyanin Length = 91 Back     alignment and structure
>pdb|1JER|A Chain A, Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query220
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 7e-46
2cbp_A96 Cucumber basic protein; electron transport, phytoc 3e-42
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 5e-41
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 8e-41
1jer_A138 Cucumber stellacyanin; electron transport, copper, 1e-36
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 4e-06
3h0g_A 1752 DNA-directed RNA polymerase II subunit RPB1; trans 9e-06
3h0g_A 1752 DNA-directed RNA polymerase II subunit RPB1; trans 1e-05
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 2e-05
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 4e-05
3h0g_A 1752 DNA-directed RNA polymerase II subunit RPB1; trans 1e-04
3h0g_A 1752 DNA-directed RNA polymerase II subunit RPB1; trans 1e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 1e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 1e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 2e-04
3h0g_A 1752 DNA-directed RNA polymerase II subunit RPB1; trans 2e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 2e-04
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 8e-04
1twf_A 1733 B220, DNA-directed RNA polymerase II largest subun 6e-06
1twf_A 1733 B220, DNA-directed RNA polymerase II largest subun 1e-05
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 1e-05
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 2e-05
1twf_A 1733 B220, DNA-directed RNA polymerase II largest subun 3e-05
1twf_A 1733 B220, DNA-directed RNA polymerase II largest subun 4e-05
1twf_A 1733 B220, DNA-directed RNA polymerase II largest subun 4e-05
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 6e-05
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 3e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 3e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 3e-04
1twf_A 1733 B220, DNA-directed RNA polymerase II largest subun 4e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 4e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 7e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 8e-04
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 1e-05
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 1e-04
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 1e-04
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 8e-04
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-05
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-04
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 8e-05
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 2e-04
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 1e-04
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 2e-04
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 3e-04
3a58_A320 Exocyst complex component SEC3; protein complex, P 1e-04
3a58_A320 Exocyst complex component SEC3; protein complex, P 2e-04
3a58_A320 Exocyst complex component SEC3; protein complex, P 3e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-04
3tx7_B 352 Nuclear receptor subfamily 5 group A member 2; LRH 4e-04
1pk8_A 422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 6e-04
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Length = 109 Back     alignment and structure
 Score =  147 bits (371), Expect = 7e-46
 Identities = 63/108 (58%), Positives = 75/108 (69%)

Query: 21  MAATYTVGDDAGWTIQGHIDYSKWAEGKQFHVGDTLVFKYNKAMHDVRQVSHEDFQSCNA 80
           MA  + VGD  GWT     DY+KWA   +FHVGD+L+F YN   H+V QV  E F+SCN+
Sbjct: 1   MATVHKVGDSTGWTTLVPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNS 60

Query: 81  KAPIEEYTTGMDSITLKMAGHHYFLCGIPGHCQVGQKVEINVLPGASS 128
            +P   YT+G DSI LK  G  YFLCGIPGHCQ+GQKVEI V PG+SS
Sbjct: 61  SSPAASYTSGADSIPLKRPGTFYFLCGIPGHCQLGQKVEIKVDPGSSS 108
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Length = 96 Back     alignment and structure
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Length = 116 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Length = 91 Back     alignment and structure
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Length = 138 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure
>3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 Back     alignment and structure
>3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 Back     alignment and structure
>3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query220
1jer_A138 Cucumber stellacyanin; electron transport, copper, 100.0
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 100.0
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 100.0
2cbp_A96 Cucumber basic protein; electron transport, phytoc 100.0
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 100.0
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 99.25
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 99.13
2cal_A154 Rusticyanin; iron respiratory electron transport c 99.09
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 98.9
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 98.86
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 98.86
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 98.85
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 98.82
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 98.79
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 98.74
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 98.73
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 98.73
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 98.72
1byp_A99 Protein (plastocyanin); electron transfer, photosy 98.72
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 98.7
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 98.7
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 98.53
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 98.1
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 98.04
3c75_A132 Amicyanin; copper proteins, electron transfer comp 98.0
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 97.98
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 97.95
1iko_P178 Ephrin-B2; greek KEY, glycosylation, signaling pro 97.91
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 97.85
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 97.83
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 97.78
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 97.7
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 97.67
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 97.58
2x11_B177 Ephrin-A5; receptor-signaling protein complex, dev 97.28
3czu_B182 Ephrin-A1; ATP-binding, kinase, nucleotide-binding 97.17
1shx_A138 Ephrin-A5; ephrin signaling, hormone-growth factor 97.04
3d12_B141 Ephrin-B3; beta propeller, protein-receptor comple 96.96
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 96.72
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 96.44
2wo3_B157 Ephrin-A2; transferase-signaling protein complex, 96.21
2vsm_B140 Ephrin-B2; developmental protein, henipavirus, neu 96.09
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 95.75
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 94.8
3hei_B132 Ephrin-A1; EPH receptor tyrosine kinase, cell memb 94.51
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 93.8
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 92.01
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 90.94
1mzy_A333 Copper-containing nitrite reductase; mutant M182T, 82.19
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
Probab=100.00  E-value=6.6e-42  Score=278.11  Aligned_cols=108  Identities=33%  Similarity=0.699  Sum_probs=100.7

Q ss_pred             cceEEEecCCCCceeeCC-CCcccccCCCeeeeCCEEEeeecCCCCcEEEe-CccCCCCCCCCCCccccccCCcEEEe-e
Q 039191           21 MAATYTVGDDAGWTIQGH-IDYSKWAEGKQFHVGDTLVFKYNKAMHDVRQV-SHEDFQSCNAKAPIEEYTTGMDSITL-K   97 (220)
Q Consensus        21 ~A~~~~VGg~~GW~~~~~-~~Y~~WAs~~tF~VGDtLvF~y~~~~HsV~~V-~~~~Y~~C~~s~pi~~~s~G~~~v~L-~   97 (220)
                      +|++|+|||+.||++.+. .||++||++++|+|||+|+|+|..++|+|+|| ++++|+.|+.++++..+++|+++|+| +
T Consensus         2 ~a~~~~VGg~~GW~~~~~~~~Y~~Wa~~~~F~vGD~LvF~y~~~~HsV~~V~~~~~y~~C~~s~p~~~~~~G~~~v~L~~   81 (138)
T 1jer_A            2 QSTVHIVGDNTGWSVPSSPNFYSQWAAGKTFRVGDSLQFNFPANAHNVHEMETKQSFDACNFVNSDNDVERTSPVIERLD   81 (138)
T ss_dssp             CCCEEETTGGGCSSCCSSTTHHHHHHHTCCEETTCEEEECCCTTTCCCEEESCHHHHHHTCCTTSCCCCCCCSCEEEECC
T ss_pred             CceEEEECCcCcCcCCCCccchhhhhcCCcCcCCCEEEEeecCCCceEEEeCchhhcCccCCCCccccccCCCeEEEecc
Confidence            578999999999999433 78999999999999999999999999999999 99999999999999999999999999 9


Q ss_pred             ccccEEEEcCCCCCCCCCCeEEEEecCCCCC
Q 039191           98 MAGHHYFLCGIPGHCQVGQKVEINVLPGASS  128 (220)
Q Consensus        98 ~pG~~YFiCgv~~HC~~GmKl~I~V~~~~s~  128 (220)
                      ++|+|||||++++||++||||+|+|......
T Consensus        82 ~~G~~YFicg~~gHC~~GmKl~I~V~~~~~~  112 (138)
T 1jer_A           82 ELGMHYFVCTVGTHCSNGQKLSINVVAANAT  112 (138)
T ss_dssp             SSEEEEEECCSTTTGGGTCEEEEEEECCC--
T ss_pred             CCcCEEEEcCCCCccccCCEEEEEEcCCCCC
Confidence            9999999999999999999999999977654
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Back     alignment and structure
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1iko_P Ephrin-B2; greek KEY, glycosylation, signaling protein; HET: NAG MAN; 1.92A {Mus musculus} SCOP: b.6.1.5 Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>2x11_B Ephrin-A5; receptor-signaling protein complex, developmental protein, signaling platform, kinase, transferase, neurogenesis, receptor, cataract; 4.83A {Homo sapiens} Back     alignment and structure
>3czu_B Ephrin-A1; ATP-binding, kinase, nucleotide-binding, receptor, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG MAN; 2.65A {Homo sapiens} PDB: 3mbw_B* Back     alignment and structure
>1shx_A Ephrin-A5; ephrin signaling, hormone-growth factor complex; HET: NAG; 2.10A {Mus musculus} SCOP: b.6.1.5 PDB: 1shw_A* 3mx0_B* Back     alignment and structure
>3d12_B Ephrin-B3; beta propeller, protein-receptor complex, envelope protein, glycoprotein, hemagglutinin, hydrolase, membrane, signal-AN transmembrane; HET: NAG BMA MAN BGC LXZ NGA GL0 GLC LXB NGZ GXL; 3.00A {Mus musculus} Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>2wo3_B Ephrin-A2; transferase-signaling protein complex, EFN, EPHA4, KINA ephrin, complex, membrane, cell surface receptor, tyrosine- kinase, glycoprotein; HET: NAG; 2.35A {Homo sapiens} Back     alignment and structure
>2vsm_B Ephrin-B2; developmental protein, henipavirus, neurogenesis, glycoprotein, paramyxovirus, envelope protein, cell surface receptor, hendra, virion; HET: NAG; 1.80A {Homo sapiens} PDB: 2wo2_B* 2i85_A 3gxu_B 2vsk_B 2hle_B 1kgy_E Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>3hei_B Ephrin-A1; EPH receptor tyrosine kinase, cell membrane, disulfi glycoprotein, GPI-anchor, lipoprotein, membrane, ATP-bindin kinase; 2.00A {Homo sapiens} SCOP: b.6.1.0 Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 220
d1ws8a_104 b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) 4e-44
d2cbpa_96 b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativ 4e-44
d1f56a_91 b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia olera 1e-38
d1jera_110 b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativ 2e-35
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Length = 104 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Mavicyanin
species: Zucchini (Cucurbita pepo) [TaxId: 3663]

 Score =  141 bits (356), Expect = 4e-44
 Identities = 60/104 (57%), Positives = 71/104 (68%)

Query: 21  MAATYTVGDDAGWTIQGHIDYSKWAEGKQFHVGDTLVFKYNKAMHDVRQVSHEDFQSCNA 80
           MA  + VGD  GWT     DY+KWA   +FHVGD+L+F YN   H+V QV  E F+SCN+
Sbjct: 1   MATVHKVGDSTGWTTLVPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNS 60

Query: 81  KAPIEEYTTGMDSITLKMAGHHYFLCGIPGHCQVGQKVEINVLP 124
            +P   YT+G DSI LK  G  YFLCGIPGHCQ+GQKVEI V P
Sbjct: 61  SSPAASYTSGADSIPLKRPGTFYFLCGIPGHCQLGQKVEIKVDP 104
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 96 Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 91 Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 110 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query220
d1ws8a_104 Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663 100.0
d2cbpa_96 Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1jera_110 Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1f56a_91 Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 99.97
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 99.06
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 98.94
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 98.87
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 98.85
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 98.82
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 98.79
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 98.78
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 98.75
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 98.71
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 98.67
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 98.59
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 98.58
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.42
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 98.37
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.27
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 98.14
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 97.76
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 97.52
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 97.51
d1shxa1138 Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} 97.36
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 97.27
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 97.02
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 96.56
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 96.42
d1ikop_141 Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 96.29
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 95.77
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 95.46
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 95.36
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 95.17
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 94.8
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 92.6
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 89.16
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 89.02
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 88.96
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 88.17
d1yela1102 At1g16640 {Thale cress (Arabidopsis thaliana) [Tax 84.0
d1kbva2151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 83.18
d1hfua1131 Laccase {Inky cap fungus (Coprinus cinereus) [TaxI 81.75
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Mavicyanin
species: Zucchini (Cucurbita pepo) [TaxId: 3663]

Probab=100.00  E-value=4.8e-39  Score=247.48  Aligned_cols=104  Identities=58%  Similarity=1.075  Sum_probs=99.7

Q ss_pred             cceEEEecCCCCceeeCCCCcccccCCCeeeeCCEEEeeecCCCCcEEEeCccCCCCCCCCCCccccccCCcEEEeeccc
Q 039191           21 MAATYTVGDDAGWTIQGHIDYSKWAEGKQFHVGDTLVFKYNKAMHDVRQVSHEDFQSCNAKAPIEEYTTGMDSITLKMAG  100 (220)
Q Consensus        21 ~A~~~~VGg~~GW~~~~~~~Y~~WAs~~tF~VGDtLvF~y~~~~HsV~~V~~~~Y~~C~~s~pi~~~s~G~~~v~L~~pG  100 (220)
                      .|++|+|||++||+...+.+|++|+++++|++||+|+|+|+++.|+|+||++++|++|+..+++..+++|++.|+|+++|
T Consensus         1 ~at~~~VGg~~gW~~~~~~~Y~~Wa~~~~f~vGD~l~F~y~~~~h~V~~v~~~~y~~C~~~~~~~~~~~G~~~v~l~~~g   80 (104)
T d1ws8a_           1 MATVHKVGDSTGWTTLVPYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNSSSPAASYTSGADSIPLKRPG   80 (104)
T ss_dssp             CCCEEETTGGGCSCSSSCCCHHHHHHTSCBCTTCEEEEECCTTTCCEEEECHHHHHHTCCSSCSEEECSSEEEEECCSSE
T ss_pred             CCcEEEeCCcCccCcCCCcCHHHHhhCCcCCCCCEEEEEECCCCceEEEECHHHhcCCcCCCccccccCCCeEEEEecCc
Confidence            37899999999999877889999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cEEEEcCCCCCCCCCCeEEEEecC
Q 039191          101 HHYFLCGIPGHCQVGQKVEINVLP  124 (220)
Q Consensus       101 ~~YFiCgv~~HC~~GmKl~I~V~~  124 (220)
                      +|||||++++||++||||.|+|++
T Consensus        81 ~~yF~C~~~~HC~~Gmkl~I~V~P  104 (104)
T d1ws8a_          81 TFYFLCGIPGHCQLGQKVEIKVDP  104 (104)
T ss_dssp             EEEEECCSTTTTTTTCEEEEEECC
T ss_pred             cEEEECCCcchhhCCCEEEEEECC
Confidence            999999999999999999999973
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1shxa1 b.6.1.5 (A:32-170) Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ikop_ b.6.1.5 (P:) Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1yela1 b.142.1.2 (A:1-102) At1g16640 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Back     information, alignment and structure