Citrus Sinensis ID: 039198


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-
MESLQISDEINNIKKGPWTPEEDQKLIDYIRKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDIKRGKFSEEEEQLIVNLHAVLGNKWSAIATRLPGRTDNEIKNFWNTHLKKKLLQMGIDPVTHRPRTDLNNVLANLPQLLAAANFAVGNLMNVPNSWDINALKLQSDATQLAKIQLLHNIIQILSTSPPPNIEASSLLGSSLGDNYNQLFEFLRMNSHQFHGNNGNGNGNVPFGFTPQEPNQILSNLLNFDSASQLPHLGDYTNTSTSNTSQLGSSSYANNIPTSNQLPALVSVSSADCSALNQQIETKINPNDISNPSSTLTTFEANWGDFMDDEASQSYWRDFIE
cccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHcccccccHHHHccccccccccccccHHHHHHHHHHHHHHccHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHcccHHHHHHHHcccccccccccccccHHHcccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccHHHcc
ccccccccHHcccccccccHHHHHHHHHHHHHcccccHHHccHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHcccHHHHcccccccccccccHHHHHcccHHHHHHHHccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccHHHHHHc
meslqisdeinnikkgpwtpeedQKLIDYIRKhghgswralpklaglnrcgkscrlrwtnylrpdikrgkfsEEEEQLIVNLHAVLGNKWSaiatrlpgrtdneIKNFWNTHLKKKLLQmgidpvthrprtdlNNVLANLPQLLAAANFAVgnlmnvpnswdinALKLQSDATQLAKIQLLHNIIQIlstspppnieassllgsslgdnYNQLFEFLRMNshqfhgnngngngnvpfgftpqepNQILSNllnfdsasqlphlgdytntstsntsqlgsssyanniptsnqlpalvsvsSADCSALNQQIetkinpndisnpsstlttfeanwgdfmddeasQSYWRDFIE
meslqisdeinnikkgpwtpeeDQKLIDYIRKHGHgswralpklaglnrcgkscrlrwTNYLRPDIKRGKFSEEEEQLIVNLHAVLGNKWSAIAtrlpgrtdNEIKNFWNTHLKKKLLQMGIDPVTHRPRTDLNNVLANLPQLLAAANFAVGNLMNVPNSWDINALKLQSDATQLAKIQLLHNIIQILSTSPPPNIEASSLLGSSLGDNYNQLFEFLRMNSHQFHGNNGNGNGNVPFGFTPQEPNQILSNLLNFDSASQLPHLGDYTNTSTSNTSQLGSSSYANNIPTSNQLPALVSVSSADCSALNQQIetkinpndisnpsSTLTTFEANWGDFMDDEASQSYWRDFIE
MESLQISDEINNIKKGPWTPEEDQKLIDYIRKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDIKRGKFSEEEEQLIVNLHAVLGNKWSAIATRLPGRTDNEIKNFWNTHLKKKLLQMGIDPVTHRPRTDlnnvlanlpqllaaanfaVGNLMNVPNSWDINALKLQSDATQLAKIQLLHNIIQILSTSPPPNIEASSLLGSSLGDNYNQLFEFLRMNSHQFHgnngngngnVPFGFTPQEPNQILSNLLNFDSASQLPHLGDYtntstsntsqlgsssYANNIPTSNQLPALVSVSSADCSALNQQIETKINPNDISNPSSTLTTFEANWGDFMDDEASQSYWRDFIE
************************KLIDYIRKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDIKRGKFSEEEEQLIVNLHAVLGNKWSAIATRLPGRTDNEIKNFWNTHLKKKLLQMGIDPVTHRPRTDLNNVLANLPQLLAAANFAVGNLMNVPNSWDINALKLQSDATQLAKIQLLHNIIQILST**************SLGDNYNQLFEFLRMNSHQFH***********FGF*******ILSNLLN**************************************************************************TFEANWGDFM**************
*ESLQISDEINNIKKGPWTPEEDQKLIDYIRKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDIKRGKFSEEEEQLIVNLHAVLGNKWSAIATRLPGRTDNEIKNFWNTHLKKKLLQMGIDPV******************************************************************************************************************************************************************************************************STLTTFEANWGDFMDDEASQSYWRDFIE
MESLQISDEINNIKKGPWTPEEDQKLIDYIRKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDIKRGKFSEEEEQLIVNLHAVLGNKWSAIATRLPGRTDNEIKNFWNTHLKKKLLQMGIDPVTHRPRTDLNNVLANLPQLLAAANFAVGNLMNVPNSWDINALKLQSDATQLAKIQLLHNIIQILSTSPPPNIEASSLLGSSLGDNYNQLFEFLRMNSHQFHGNNGNGNGNVPFGFTPQEPNQILSNLLNFDSASQLPHLGDYTN***********SSYANNIPTSNQLPALVSVSSADCSALNQQIETKINPNDISNPSSTLTTFEANWGDFMDDEASQSYWRDFIE
****QISDEINNIKKGPWTPEEDQKLIDYIRKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDIKRGKFSEEEEQLIVNLHAVLGNKWSAIATRLPGRTDNEIKNFWNTHLKKKLLQMGIDPVTHRPRTDLNNVLANLPQLLAAANFAVGNLMNVPNSWDINALKLQSDATQLAKIQLLHNIIQILSTSPPPNIEASSLLGS*LGDNYNQLFEFLRMNSHQFHGNNGNGNGNVPFGFTPQEPNQILSNLLNFDSASQLPHLGDYTNTST*************************************************************WGDF*D**ASQSYWRDFIE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESLQISDEINNIKKGPWTPEEDQKLIDYIRKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDIKRGKFSEEEEQLIVNLHAVLGNKWSAIATRLPGRTDNEIKNFWNTHLKKKLLQMGIDPVTHRPRTDLNNVLANLPQLLAAANFAVGNLMNVPNSWDINALKLQSDATQLAKIQLLHNIIQILSTSPPPNIEASSLLGSSLGDNYNQLFEFLRMNSHQFHGNNGNGNGNVPFGFTPQEPNQILSNLLNFDSASQLPHLGDYTNTSTSNTSQLGSSSYANNIPTSNQLPALVSVSSADCSALNQQIETKINPNDISNPSSTLTTFEANWGDFMDDEASQSYWRDFIE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query351 2.2.26 [Sep-21-2011]
Q8GWP0360 Transcription factor MYB3 no no 0.937 0.913 0.418 5e-63
Q8LPH6352 Transcription factor MYB8 no no 0.333 0.332 0.726 2e-51
Q9SPG2366 Transcription factor MYB2 no no 0.384 0.368 0.608 1e-50
Q50EX6294 Protein ODORANT1 OS=Petun N/A no 0.333 0.397 0.735 3e-50
Q9S9K9257 Transcription factor MYB3 no no 0.341 0.466 0.716 3e-50
O49608274 Transcription factor MYB3 no no 0.404 0.518 0.601 4e-50
Q38851236 Transcription repressor M no no 0.415 0.618 0.608 8e-50
Q9SPG5338 Transcription factor MYB7 no no 0.333 0.346 0.717 3e-49
Q9FLR1336 Transcription factor MYB2 no no 0.333 0.348 0.717 3e-49
P81393232 Myb-related protein 308 O N/A no 0.336 0.508 0.711 4e-49
>sp|Q8GWP0|MYB39_ARATH Transcription factor MYB39 OS=Arabidopsis thaliana GN=MYB39 PE=2 SV=1 Back     alignment and function desciption
 Score =  241 bits (616), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 151/361 (41%), Positives = 208/361 (57%), Gaps = 32/361 (8%)

Query: 6   ISDEINNIKKGPWTPEEDQKLIDYIRKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPD 65
             D+   +KKGPW PEED KL  YI ++G+G+WR+LPKLAGLNRCGKSCRLRW NYLRPD
Sbjct: 6   CCDQDKGVKKGPWLPEEDDKLTAYINENGYGNWRSLPKLAGLNRCGKSCRLRWMNYLRPD 65

Query: 66  IKRGKFSEEEEQLIVNLHAVLGNKWSAIATRLPGRTDNEIKNFWNTHLKKKLLQMGIDPV 125
           I+RGKFS+ EE  IV LHA+LGNKWS IA  LPGRTDNEIKN+WNTH++KKLLQMGIDPV
Sbjct: 66  IRRGKFSDGEESTIVRLHALLGNKWSKIAGHLPGRTDNEIKNYWNTHMRKKLLQMGIDPV 125

Query: 126 THRPRTDLNNVLANLPQLLAAANFAVGNLMNVPNSWDINALKLQSDATQLAKIQLLHNII 185
           TH PRT+  + + ++ Q+LAAA    G   N     +  AL+       + K+QL+H ++
Sbjct: 126 THEPRTNDLSPILDVSQMLAAA-INNGQFGNNNLLNNNTALE------DILKLQLIHKML 178

Query: 186 QILSTSPPPNIEASSLLGSSLGDNYNQLFEFLRMNSHQFHGNNGNGNGNVPFGFTPQEPN 245
           QI++    PNI  SS   + L      +      NS     +   G      G TP+  +
Sbjct: 179 QIITPKAIPNI--SSFKTNLLNPKPEPVVNSFNTNSVNPKPDPPAGLFINQSGITPEAAS 236

Query: 246 QIL---SNLLNFDSASQLPHLGDYTNTSTSNTSQLGSSSYANNIPTSNQLPALVSVSSAD 302
             +    N+ +    +QLP L   +  S  NT++ G+S       T+ ++   +      
Sbjct: 237 DFIPSYENVWDGFEDNQLPGLVTVSQESL-NTAKPGTS-------TTTKVNDHIRTGMMP 288

Query: 303 CSALNQQIET------KINPNDIS--NPS----STLTTFEANWGDFMDDEASQSYWRDFI 350
           C   +Q +ET       ++P   S  +PS    S+ + F  +W  F+DDE S S W+ F+
Sbjct: 289 CYYGDQLLETPSTGSVSVSPETTSLNHPSTAQHSSGSDFLEDWEKFLDDETSDSCWKSFL 348

Query: 351 E 351
           +
Sbjct: 349 D 349





Arabidopsis thaliana (taxid: 3702)
>sp|Q8LPH6|MYB86_ARATH Transcription factor MYB86 OS=Arabidopsis thaliana GN=MYB86 PE=2 SV=1 Back     alignment and function description
>sp|Q9SPG2|MYB28_ARATH Transcription factor MYB28 OS=Arabidopsis thaliana GN=MYB28 PE=1 SV=1 Back     alignment and function description
>sp|Q50EX6|ODO1_PETHY Protein ODORANT1 OS=Petunia hybrida GN=ODO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 Back     alignment and function description
>sp|O49608|MYB32_ARATH Transcription factor MYB32 OS=Arabidopsis thaliana GN=MYB32 PE=2 SV=1 Back     alignment and function description
>sp|Q38851|MYB6_ARATH Transcription repressor MYB6 OS=Arabidopsis thaliana GN=MYB6 PE=1 SV=1 Back     alignment and function description
>sp|Q9SPG5|MYB76_ARATH Transcription factor MYB76 OS=Arabidopsis thaliana GN=MYB76 PE=1 SV=1 Back     alignment and function description
>sp|Q9FLR1|MYB29_ARATH Transcription factor MYB29 OS=Arabidopsis thaliana GN=MYB29 PE=1 SV=1 Back     alignment and function description
>sp|P81393|MYB08_ANTMA Myb-related protein 308 OS=Antirrhinum majus GN=MYB308 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query351
359489983341 PREDICTED: transcription factor MYB39-li 0.920 0.947 0.613 1e-105
30024598348 transcription factor MYB101 [Lotus japon 0.925 0.933 0.571 1e-96
297737290268 unnamed protein product [Vitis vinifera] 0.752 0.985 0.586 6e-94
356543313352 PREDICTED: transcription factor MYB39 [G 0.948 0.946 0.558 5e-90
30024604345 transcription factor MYB101 [Glycine max 0.931 0.947 0.562 4e-89
224144721300 predicted protein [Populus trichocarpa] 0.814 0.953 0.590 5e-89
356541038337 PREDICTED: transcription factor MYB39-li 0.914 0.952 0.564 4e-87
224074299335 predicted protein [Populus trichocarpa] 0.880 0.922 0.524 9e-84
297742074303 unnamed protein product [Vitis vinifera] 0.826 0.957 0.536 1e-82
224138964336 predicted protein [Populus trichocarpa] 0.888 0.928 0.522 3e-82
>gi|359489983|ref|XP_003634006.1| PREDICTED: transcription factor MYB39-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  388 bits (997), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 214/349 (61%), Positives = 262/349 (75%), Gaps = 26/349 (7%)

Query: 7   SDEINNIKKGPWTPEEDQKLIDYIRKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDI 66
           S E + +KKGPWTPEEDQKL++YI++HGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDI
Sbjct: 4   SPEESGLKKGPWTPEEDQKLVEYIQRHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDI 63

Query: 67  KRGKFSEEEEQLIVNLHAVLGNKWSAIATRLPGRTDNEIKNFWNTHLKKKLLQMGIDPVT 126
           KRGKFS+EEE  I+NLH+VLGNKWSAIAT LPGRTDNEIKNFWNTHLKKKL+QMGIDPVT
Sbjct: 64  KRGKFSDEEENTIINLHSVLGNKWSAIATHLPGRTDNEIKNFWNTHLKKKLMQMGIDPVT 123

Query: 127 HRPRTDLNNVLANLPQLLAAANFAVGNLMNVPNSWDINALKLQSDATQLAKIQLLHNIIQ 186
           HRPRTDL N+LANLPQLLAAAN +  +L+N  N WD NAL+LQSDATQLAK+ LLHN++Q
Sbjct: 124 HRPRTDL-NILANLPQLLAAANLST-SLVN--NPWD-NALRLQSDATQLAKLHLLHNLLQ 178

Query: 187 ILSTSP---PPNIEASSLLGSSLGDNYNQLFEFLRMNSHQFHGNNGNGNGNVPFGFTPQE 243
           +L TSP   PPN+EA +L G+           F+   ++++  +N   NG +  G  P +
Sbjct: 179 VLGTSPTALPPNMEAGNLFGTP---------SFMDHQAYEYPTSNPQLNGLI--GLHPTD 227

Query: 244 PNQILSNLLNFDSASQLPHLGDYTNTSTSNTSQLGSSSYANNIPTSNQLPALVSVSSADC 303
           P Q LS++ +F    Q P   +Y     S     G+++  + + +   +PALVS +S + 
Sbjct: 228 PAQTLSSIPSF-VPPQEPGF-EYQTMENSKVCA-GNNNDGDELGSLYAIPALVS-ASPEP 283

Query: 304 SALNQQIETKINP-NDISNPSSTLTTFEANWGDFMDDEASQSYWRDFIE 351
           S +NQ+ E KI P +DISNPSST TTFEA WG+ MDDEAS SYWRD I+
Sbjct: 284 STVNQK-EKKIEPAHDISNPSSTSTTFEA-WGELMDDEASDSYWRDLID 330




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|30024598|dbj|BAC75671.1| transcription factor MYB101 [Lotus japonicus] Back     alignment and taxonomy information
>gi|297737290|emb|CBI26491.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356543313|ref|XP_003540106.1| PREDICTED: transcription factor MYB39 [Glycine max] Back     alignment and taxonomy information
>gi|30024604|dbj|BAC75674.1| transcription factor MYB101 [Glycine max] Back     alignment and taxonomy information
>gi|224144721|ref|XP_002325389.1| predicted protein [Populus trichocarpa] gi|222862264|gb|EEE99770.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356541038|ref|XP_003538990.1| PREDICTED: transcription factor MYB39-like [Glycine max] Back     alignment and taxonomy information
>gi|224074299|ref|XP_002304344.1| predicted protein [Populus trichocarpa] gi|222841776|gb|EEE79323.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297742074|emb|CBI33861.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224138964|ref|XP_002326734.1| predicted protein [Populus trichocarpa] gi|222834056|gb|EEE72533.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query351
TAIR|locus:2075387321 MYB107 "myb domain protein 107 0.495 0.542 0.657 3.2e-73
TAIR|locus:2149000336 MYB9 "myb domain protein 9" [A 0.555 0.580 0.623 6.7e-73
TAIR|locus:2145402334 MYB92 "myb domain protein 92" 0.555 0.583 0.603 3.8e-62
TAIR|locus:2023951365 MYB93 "myb domain protein 93" 0.703 0.676 0.525 6.2e-62
TAIR|locus:2171845310 MYB53 "myb domain protein 53" 0.512 0.580 0.638 2.7e-59
TAIR|locus:505006490360 MYB39 "myb domain protein 39" 0.948 0.925 0.390 1.2e-58
TAIR|locus:2141231350 MYB102 "MYB-like 102" [Arabido 0.353 0.354 0.798 3.7e-55
TAIR|locus:2132957282 MYB41 "myb domain protein 41" 0.347 0.432 0.778 5.4e-55
TAIR|locus:2115708324 MYB74 "myb domain protein 74" 0.347 0.376 0.786 1.6e-54
TAIR|locus:2162585319 MYB49 "myb domain protein 49" 0.353 0.388 0.758 3.7e-54
TAIR|locus:2075387 MYB107 "myb domain protein 107" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 642 (231.1 bits), Expect = 3.2e-73, Sum P(2) = 3.2e-73
 Identities = 121/184 (65%), Positives = 143/184 (77%)

Query:     8 DEINNIKKGPWTPEEDQKLIDYIRKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDIK 67
             DE + +KKGPWTPEEDQKLI++IRKHGHGSWRALPK AGLNRCGKSCRLRWTNYLRPDIK
Sbjct:     8 DE-SGLKKGPWTPEEDQKLINHIRKHGHGSWRALPKQAGLNRCGKSCRLRWTNYLRPDIK 66

Query:    68 RGKFSEEEEQLIVNLHAVLGNKWSAIATRLPGRTDNEIKNFWNTHLKKKLLQMGIDPVTH 127
             RG F+ EEEQ I+NLH++LGNKWS+IA  LPGRTDNEIKN+WNTH++KKL+QMGIDPVTH
Sbjct:    67 RGNFTAEEEQTIINLHSLLGNKWSSIAGHLPGRTDNEIKNYWNTHIRKKLIQMGIDPVTH 126

Query:   128 RPRTDXXXXXXXXXXXXXXXXXXVGNLMNVPNSWDINALKLQSDATQLAKIQLLHNIIQI 187
             RPRTD                    NL+N+  +       +Q DAT +AK QLLH++IQ+
Sbjct:   127 RPRTDHLNVLAALPQLLAAANF--NNLLNLNQN-------IQLDATSVAKAQLLHSMIQV 177

Query:   188 LSTS 191
             LS +
Sbjct:   178 LSNN 181


GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0009751 "response to salicylic acid stimulus" evidence=IEP
TAIR|locus:2149000 MYB9 "myb domain protein 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2145402 MYB92 "myb domain protein 92" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2023951 MYB93 "myb domain protein 93" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171845 MYB53 "myb domain protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006490 MYB39 "myb domain protein 39" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141231 MYB102 "MYB-like 102" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132957 MYB41 "myb domain protein 41" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115708 MYB74 "myb domain protein 74" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2162585 MYB49 "myb domain protein 49" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query351
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 7e-60
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 2e-57
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 1e-17
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 7e-16
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 6e-14
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 7e-14
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 7e-14
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 3e-13
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 2e-12
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 5e-12
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 1e-05
cd1166050 cd11660, SANT_TRF, Telomere repeat binding factor- 8e-05
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
 Score =  199 bits (506), Expect = 7e-60
 Identities = 95/199 (47%), Positives = 129/199 (64%), Gaps = 5/199 (2%)

Query: 13  IKKGPWTPEEDQKLIDYIRKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDIKRGKFS 72
           ++KG W+PEED+KL+ +I K+GHG W ++PK AGL RCGKSCRLRW NYLRPD+KRG FS
Sbjct: 12  LRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYLRPDLKRGTFS 71

Query: 73  EEEEQLIVNLHAVLGNKWSAIATRLPGRTDNEIKNFWNTHLKKKLLQMGIDPVTHRPRTD 132
           ++EE LI+ LHAVLGN+WS IA +LPGRTDNEIKN WN+ LKKKL Q GIDP TH+P ++
Sbjct: 72  QQEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRGIDPNTHKPLSE 131

Query: 133 LNNVLANLPQLLAAANFAVGNLMNVPNSWDINALKLQSDATQLAKIQLLHNIIQILSTSP 192
           + N     P     ++ A   + N     ++N LK  +     A  +   + I       
Sbjct: 132 VENGEDKNPPTDDKSDKASSVVSN-----ELNLLKADNSKPLAALQEKRSSSISPAGYQL 186

Query: 193 PPNIEASSLLGSSLGDNYN 211
                +SS + +S  +N++
Sbjct: 187 EVESSSSSKINNSNNNNHS 205


Length = 459

>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 351
PLN03091 459 hypothetical protein; Provisional 100.0
PLN03212249 Transcription repressor MYB5; Provisional 100.0
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.97
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.95
PLN03212249 Transcription repressor MYB5; Provisional 99.91
PLN03091 459 hypothetical protein; Provisional 99.89
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.88
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.77
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.57
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.54
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.52
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.42
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.38
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.33
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.26
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.2
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.15
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.03
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.01
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 98.88
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.86
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.7
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.66
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 97.53
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.53
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.3
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 97.26
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 97.01
KOG1279506 consensus Chromatin remodeling factor subunit and 96.63
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.61
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.52
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 96.42
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.3
KOG1279506 consensus Chromatin remodeling factor subunit and 96.01
PRK13923170 putative spore coat protein regulator protein YlbO 95.88
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 95.85
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 95.4
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.27
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 95.1
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 94.62
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 94.1
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 93.2
PRK13923170 putative spore coat protein regulator protein YlbO 93.19
PLN031421033 Probable chromatin-remodeling complex ATPase chain 91.38
KOG4282345 consensus Transcription factor GT-2 and related pr 88.03
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 87.91
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 86.46
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 85.24
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 80.08
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=6.3e-36  Score=297.30  Aligned_cols=132  Identities=63%  Similarity=1.153  Sum_probs=127.5

Q ss_pred             CCCCccccccCCCCCCCCCHHHHHHHHHHHHHhCCCCcccccccccccccccccccccccccCCCCCCCCCCHHHHHHHH
Q 039198            1 MESLQISDEINNIKKGPWTPEEDQKLIDYIRKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDIKRGKFSEEEEQLIV   80 (351)
Q Consensus         1 m~R~~~c~~~~~lkKg~WT~EED~~L~~~V~k~g~~nW~~IA~~lgp~Rs~kqCr~Rw~n~L~p~lkrg~WT~EED~~Ll   80 (351)
                      |||++||.+ ..++|++||+|||++|+++|++||..+|..||+.++++|+++|||+||.++|+|.+++|+||+|||++|+
T Consensus         1 mgr~~Cc~K-qklrKg~WTpEEDe~L~~~V~kyG~~nWs~IAk~~g~gRT~KQCRERW~NyLdP~IkKgpWT~EED~lLL   79 (459)
T PLN03091          1 MGRHSCCYK-QKLRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYLRPDLKRGTFSQQEENLII   79 (459)
T ss_pred             CCCCccCcC-CCCcCCCCCHHHHHHHHHHHHHhCcCCHHHHhhhhccCcCcchHhHHHHhccCCcccCCCCCHHHHHHHH
Confidence            999999999 9999999999999999999999999999999999988999999999999999999999999999999999


Q ss_pred             HHHHHhCCchhhhhccCCCCCHHHHHHHHHHhhhhhhhcCCCCccCcchhhhH
Q 039198           81 NLHAVLGNKWSAIATRLPGRTDNEIKNFWNTHLKKKLLQMGIDPVTHRPRTDL  133 (351)
Q Consensus        81 ~lv~~~G~kW~~IA~~lpgRT~~qcr~RW~~~Lr~~ik~~~~t~eEd~~l~~l  133 (351)
                      +++.+||.+|..||+.|+|||+++||+||+.+|++++++.+..+.+++++.+.
T Consensus        80 eL~k~~GnKWskIAk~LPGRTDnqIKNRWnslLKKklr~~~I~p~t~kpl~e~  132 (459)
T PLN03091         80 ELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKLRQRGIDPNTHKPLSEV  132 (459)
T ss_pred             HHHHHhCcchHHHHHhcCCCCHHHHHHHHHHHHHHHHHHcCCCCCCCCCcccc
Confidence            99999999999999999999999999999999999999999998888877653



>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query351
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 2e-26
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 1e-24
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 1e-24
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 2e-24
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 3e-24
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 7e-17
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 4e-13
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 3e-10
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 2e-09
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 2e-09
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 5e-08
1mbg_A53 Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 5e-08
1gv5_A52 Crystal Structure Of C-Myb R2 Length = 52 9e-08
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure

Iteration: 1

Score = 116 bits (290), Expect = 2e-26, Method: Composition-based stats. Identities = 54/109 (49%), Positives = 78/109 (71%), Gaps = 3/109 (2%) Query: 10 INNIKKGPWTPEEDQKLIDYIRKHGHGSWRALPK-LAGLNRCGKSCRLRWTNYLRPDIKR 68 I ++ KGPWT EEDQK+I+ ++K+G W + K L G R GK CR RW N+L P++K+ Sbjct: 2 IPDLVKGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKG--RLGKQCRERWHNHLNPEVKK 59 Query: 69 GKFSEEEEQLIVNLHAVLGNKWSAIATRLPGRTDNEIKNFWNTHLKKKL 117 ++EEE+++I H VLGN+W+ IA LPGRTDN +KN WN+ +K+K+ Sbjct: 60 SSWTEEEDRIIFEAHKVLGNRWAEIAKLLPGRTDNAVKNHWNSTIKRKV 108
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure
>pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 Back     alignment and structure
>pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query351
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 4e-75
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 3e-73
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 2e-71
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 2e-63
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 3e-61
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 3e-38
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 6e-58
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 3e-31
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 1e-27
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 1e-24
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 7e-18
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 6e-07
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 1e-13
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 5e-06
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 1e-12
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 4e-10
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 9e-05
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 6e-10
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 3e-06
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 7e-10
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 1e-09
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 1e-09
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 2e-05
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 4e-09
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 5e-09
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 1e-08
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 5e-08
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 1e-07
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 2e-07
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 1e-05
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 9e-07
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 9e-05
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 3e-04
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 1e-04
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
 Score =  227 bits (580), Expect = 4e-75
 Identities = 45/130 (34%), Positives = 71/130 (54%), Gaps = 1/130 (0%)

Query: 15  KGPWTPEEDQKLIDYIRKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDIKRGKFSEE 74
           KGP+T  ED  + +Y++++G  +W  +      NR  K CR RW N+L P + +  ++ E
Sbjct: 2   KGPFTEAEDDLIREYVKENGPQNWPRITSFLP-NRSPKQCRERWFNHLDPAVVKHAWTPE 60

Query: 75  EEQLIVNLHAVLGNKWSAIATRLPGRTDNEIKNFWNTHLKKKLLQMGIDPVTHRPRTDLN 134
           E++ I   +  LG+KWS IA  +PGRTDN IKN WN+ + K++           P     
Sbjct: 61  EDETIFRNYLKLGSKWSVIAKLIPGRTDNAIKNRWNSSISKRISTNSNHKEILLPDRSKK 120

Query: 135 NVLANLPQLL 144
              A++P+ L
Sbjct: 121 RKAADVPKKL 130


>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query351
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 100.0
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.97
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.97
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.97
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.97
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.97
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.97
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.95
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.91
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.91
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.9
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.89
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.8
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.78
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.67
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.67
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.66
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.66
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.65
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.65
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.64
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.63
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.63
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.63
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.62
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.6
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.59
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.58
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.57
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.56
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.56
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.56
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.55
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.54
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.52
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.51
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.5
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.48
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.45
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.44
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.14
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.42
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.41
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.4
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.35
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.32
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.31
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.3
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.3
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.27
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.27
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.17
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.75
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.08
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.06
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.06
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.84
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.71
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.7
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.62
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.61
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.55
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.49
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.45
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.39
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.3
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.23
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.18
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.02
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 97.86
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.79
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.74
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.64
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.58
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.45
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 96.54
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.3
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.3
2crg_A70 Metastasis associated protein MTA3; transcription 97.15
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.01
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.88
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 96.75
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 96.73
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.45
2crg_A70 Metastasis associated protein MTA3; transcription 96.35
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.29
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 96.27
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 95.84
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 94.82
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 95.63
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 94.36
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 94.3
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 93.47
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 92.44
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 89.98
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 87.18
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
Probab=100.00  E-value=4.8e-41  Score=295.64  Aligned_cols=150  Identities=26%  Similarity=0.510  Sum_probs=107.3

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCCcccccccccccccccccccccccccCCCCCCCCCCHHHHHHHHHHHHHhCC-ch
Q 039198           12 NIKKGPWTPEEDQKLIDYIRKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPDIKRGKFSEEEEQLIVNLHAVLGN-KW   90 (351)
Q Consensus        12 ~lkKg~WT~EED~~L~~~V~k~g~~nW~~IA~~lgp~Rs~kqCr~Rw~n~L~p~lkrg~WT~EED~~Ll~lv~~~G~-kW   90 (351)
                      ++++++||+|||++|+++|++||.++|..||+.+ ++|+++||++||.++|+|.+++|+||+|||++|+++|.+||. +|
T Consensus         3 ~~~k~~Wt~eED~~L~~~v~~~g~~~W~~Ia~~l-~~Rt~~qcr~Rw~~~l~p~~~~~~Wt~eEd~~L~~~v~~~g~~~W   81 (159)
T 1h89_C            3 HLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYL-PNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIKLVQKYGPKRW   81 (159)
T ss_dssp             -----------------------------------------CHHHHHHTTTCTTCCCSCCCHHHHHHHHHHHHHHCSCCH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCCHHHHHHHc-CCCCHHHHHHHHHHccCCCcCCCCCChHHHHHHHHHHHHhCcccH
Confidence            5789999999999999999999988999999999 599999999999999999999999999999999999999995 69


Q ss_pred             hhhhccCCCCCHHHHHHHHHHhhhhhhhcCCCCccCcchhhhHHHHhCCCchHHhhhccCCCCCCCCCCccch
Q 039198           91 SAIATRLPGRTDNEIKNFWNTHLKKKLLQMGIDPVTHRPRTDLNNVLANLPQLLAAANFAVGNLMNVPNSWDI  163 (351)
Q Consensus        91 ~~IA~~lpgRT~~qcr~RW~~~Lr~~ik~~~~t~eEd~~l~~l~~~~Gn~w~~Ia~~~~~grt~~~~~n~wn~  163 (351)
                      ..||..|||||++||++||.++|.|.+++++||++||..|++++..+|++|..||..++ ||+++.|+|+|+.
T Consensus        82 ~~Ia~~l~~Rt~~qcr~Rw~~~l~p~~~~~~WT~eEd~~L~~~~~~~g~~W~~Ia~~l~-gRt~~~~knr~~~  153 (159)
T 1h89_C           82 SVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLP-GRTDNAIKNHWNS  153 (159)
T ss_dssp             HHHHHTSTTCCHHHHHHHHHHTTCTTSCCSCCCHHHHHHHHHHHHHHCSCHHHHHTTST-TCCHHHHHHHHHT
T ss_pred             HHHHHHcCCCCHHHHHHHHHHHhCccccccCCChHHHHHHHHHHHHHCCCHHHHHHHCC-CCCHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999988 9999999999983



>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 351
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 5e-23
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 7e-12
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 7e-22
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 3e-11
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 3e-19
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 2e-12
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 4e-19
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 2e-18
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 2e-18
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 3e-08
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 3e-17
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 1e-12
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 4e-15
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 4e-13
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 7e-15
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 5e-09
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 6e-14
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 1e-11
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 2e-13
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 8e-13
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 2e-04
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 1e-11
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 2e-07
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 5e-05
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 4e-04
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 88.2 bits (219), Expect = 5e-23
 Identities = 25/53 (47%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 13 IKKGPWTPEEDQKLIDYIRKHGHGSWRALPKLAGLNRCGKSCRLRWTNYLRPD 65
          + KGPWT EEDQ+LI  ++K+G   W  + K     R GK CR RW N+L P+
Sbjct: 1  LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE 52


>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query351
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.72
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.68
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.65
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.64
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.63
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.62
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.57
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.53
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.49
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.49
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.43
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.43
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.42
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.37
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.37
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.33
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.3
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.29
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.23
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.17
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.16
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.12
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.04
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.03
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.02
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.7
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.68
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.44
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.87
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.72
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.55
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.49
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.32
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.7
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 96.44
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 96.25
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 95.2
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 94.94
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 94.16
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 90.35
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 83.55
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 83.08
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.72  E-value=9.5e-19  Score=138.19  Aligned_cols=70  Identities=20%  Similarity=0.297  Sum_probs=65.8

Q ss_pred             CCCCCHHHHHHHHHHHHHhCCc------hhhhhccCCCCCHHHHHHHHHHhhhhhhhcCCCCccCcchhhhHHHHh
Q 039198           68 RGKFSEEEEQLIVNLHAVLGNK------WSAIATRLPGRTDNEIKNFWNTHLKKKLLQMGIDPVTHRPRTDLNNVL  137 (351)
Q Consensus        68 rg~WT~EED~~Ll~lv~~~G~k------W~~IA~~lpgRT~~qcr~RW~~~Lr~~ik~~~~t~eEd~~l~~l~~~~  137 (351)
                      |+.||+|||++|+++|.+||..      |..||+.|||||++|||+||+++|.|.++++.|+++|++.+.+.+..+
T Consensus         1 k~~WT~eED~~L~~~v~~~g~~~~~~~~W~~IA~~lpgRt~~qcr~Rw~~~L~p~l~~~~~t~~ed~ll~d~~~~l   76 (86)
T d1igna1           1 KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNL   76 (86)
T ss_dssp             CCCCCHHHHHHHHHHHHTSGGGTTCSHHHHHHTTTSTTSCHHHHHHHHHHTTGGGCCCEECBCTTSCBCBCTTSCB
T ss_pred             CCCCCHHHHHHHHHHHHHhCcCcCCccCHHHHHHHcCCCCHHHHHHHHHHHcCccccCCCCCCchhHHHHHHhhcc
Confidence            6899999999999999999964      999999999999999999999999999999999999999999876554



>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure