Citrus Sinensis ID: 039206
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 645 | ||||||
| 224130844 | 1006 | predicted protein [Populus trichocarpa] | 0.668 | 0.428 | 0.314 | 1e-41 | |
| 356541044 | 885 | PREDICTED: uncharacterized protein LOC10 | 0.843 | 0.614 | 0.277 | 1e-40 | |
| 147767145 | 1701 | hypothetical protein VITISV_031269 [Viti | 0.337 | 0.128 | 0.416 | 1e-38 | |
| 255542460 | 716 | Protein FRIGIDA, putative [Ricinus commu | 0.629 | 0.567 | 0.307 | 3e-38 | |
| 224130856 | 1033 | predicted protein [Populus trichocarpa] | 0.488 | 0.304 | 0.319 | 3e-35 | |
| 224130848 | 954 | predicted protein [Populus trichocarpa] | 0.477 | 0.322 | 0.346 | 9e-33 | |
| 224130872 | 168 | predicted protein [Populus trichocarpa] | 0.240 | 0.922 | 0.477 | 2e-30 | |
| 297813019 | 1191 | predicted protein [Arabidopsis lyrata su | 0.776 | 0.420 | 0.273 | 7e-28 | |
| 449524874 | 888 | PREDICTED: uncharacterized LOC101218416, | 0.665 | 0.483 | 0.260 | 7e-27 | |
| 449466953 | 1145 | PREDICTED: uncharacterized protein LOC10 | 0.665 | 0.374 | 0.260 | 1e-26 |
| >gi|224130844|ref|XP_002328390.1| predicted protein [Populus trichocarpa] gi|222838105|gb|EEE76470.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 178 bits (451), Expect = 1e-41, Method: Compositional matrix adjust.
Identities = 186/591 (31%), Positives = 281/591 (47%), Gaps = 160/591 (27%)
Query: 87 LDERAKEIENKESELVLVEKKIKDCNFELACKEKELGFVRKRIGVCNSELQSKE------ 140
++ER KE+E E E+ V K I +C+ +L K+KEL VR I CN EL SKE
Sbjct: 182 VEERLKELEFNEKEVERVRKLIANCDRDLEFKQKELRNVRNLINDCNKELSSKEMDLKML 241
Query: 141 ------------DELNLVKNSAEKWPKRLNLKKEK--------QKRLESLDGEVRE---- 176
DEL+ +K S E K L+LKK++ Q+ ++ LD E RE
Sbjct: 242 QVRSSAKFVSNKDELDGIKKSIE-CSKELDLKKKELDKTKELIQECVKELDSEERELSLI 300
Query: 177 ------SEKELVLMKEQKASIRAMIEACTEKLEAIEESYDAVK-------AKLESEKREL 223
S K+ + SI +I+ TE+LEA E+ +DAVK A+L+S++ EL
Sbjct: 301 KKSIEESSKDFDSRQNHLGSISVLIDEYTEELEAKEKQHDAVKKSISVRSAELKSKETEL 360
Query: 224 ELTQTFMKDLLVKLRLYEDNLQSLQSTVRLRENELECKE--------------KELELKE 269
+ +K+L KL+ E+ L S + V+ ++E KE KELE +E
Sbjct: 361 RSIEDSIKELSAKLQQKEEKLDSARQHVKHCARKIESKEEELNKIKGRMNTYVKELESRE 420
Query: 270 REFCRIQERIEESSQELLLKENQLKSVLACIEDC---------------------SKEDQ 308
REF IQ IE S+EL KE QLKSV I +C S+E Q
Sbjct: 421 REFNAIQLSIEYRSEELKGKERQLKSVQLSIGECEKELKAMKEQKNSIQKLILECSEELQ 480
Query: 309 VKEKELISVGKSIR---------------------------------------------- 322
KEK LI +S+R
Sbjct: 481 SKEKNLILARESLRECCDDLELKKVQLDSIQRSSHESNKKSEEKEKYLNSLEKTLDERLK 540
Query: 323 -------QFEERVREFELREREFDSLRKAVEDSSKNLELRQKKL-SDILQLH-------- 366
QFEERV E EL+E++ ++++VE K +EL++++L S+IL H
Sbjct: 541 NLGVKEMQFEERVNEIELKEQQLRLMQQSVEKYRKEVELKEQQLGSNILSSHVRVDQTEN 600
Query: 367 ---PKRSAAPE---NLTSSGRNLQILLNQHLRRHDVIFCNVFDTIRKAADPALLVLDAMS 420
PK +++ N T+S R+ ++ N + HD++ V +A+PA +VLD +
Sbjct: 601 VRNPKHASSSAFQFNATTSERSSPVV-NVCVSEHDLMHHGV------SAEPAKVVLDIVQ 653
Query: 421 GFYPPHSREGYVEFDVSIIRRTCILLLEQLSSLAPEINSQVQGEALKVAVEWKKNMEDTV 480
+ ++G FD S+ R ++LLEQL ++P+I+ QV+ A K+AV W+KN+
Sbjct: 654 NW-----KKGVTGFDASV-NRDNVVLLEQLMKVSPKISPQVKEAATKLAVLWEKNIRLET 707
Query: 481 KDSLVVLGFLHLLAAYKLASAFDGNELASLLDIVANHRQTPKLRRSLGFAD 531
+DS+ VL FL LA Y L S F + + L+ ++A +Q P++ ++LGFAD
Sbjct: 708 EDSMEVLMFLLFLAVYGLVSCFSRDRILRLVRVIAQQKQAPEIFKALGFAD 758
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356541044|ref|XP_003538993.1| PREDICTED: uncharacterized protein LOC100783311 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147767145|emb|CAN75646.1| hypothetical protein VITISV_031269 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255542460|ref|XP_002512293.1| Protein FRIGIDA, putative [Ricinus communis] gi|223548254|gb|EEF49745.1| Protein FRIGIDA, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224130856|ref|XP_002328393.1| predicted protein [Populus trichocarpa] gi|222838108|gb|EEE76473.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224130848|ref|XP_002328391.1| predicted protein [Populus trichocarpa] gi|222838106|gb|EEE76471.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224130872|ref|XP_002328397.1| predicted protein [Populus trichocarpa] gi|222838112|gb|EEE76477.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297813019|ref|XP_002874393.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297320230|gb|EFH50652.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449524874|ref|XP_004169446.1| PREDICTED: uncharacterized LOC101218416, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449466953|ref|XP_004151190.1| PREDICTED: uncharacterized protein LOC101218416 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 645 | ||||||
| TAIR|locus:2181241 | 1181 | AT5G27220 "AT5G27220" [Arabido | 0.744 | 0.406 | 0.241 | 9e-29 | |
| TAIR|locus:2181251 | 948 | AT5G27230 [Arabidopsis thalian | 0.262 | 0.178 | 0.308 | 6.6e-18 | |
| TAIR|locus:1005716104 | 558 | AT5G48385 "AT5G48385" [Arabido | 0.2 | 0.231 | 0.358 | 9.4e-12 | |
| TAIR|locus:2826175 | 473 | FRL2 "AT1G31814" [Arabidopsis | 0.336 | 0.458 | 0.244 | 6.8e-10 | |
| UNIPROTKB|Q8IUD2 | 1116 | ERC1 "ELKS/Rab6-interacting/CA | 0.342 | 0.198 | 0.256 | 4.2e-09 | |
| UNIPROTKB|E2QZC5 | 927 | ERC1 "Uncharacterized protein" | 0.367 | 0.255 | 0.247 | 5.4e-09 | |
| TAIR|locus:2171327 | 470 | FRL1 "FRIGIDA like 1" [Arabido | 0.179 | 0.246 | 0.36 | 5e-08 | |
| DICTYBASE|DDB_G0286985 | 1024 | zipA "zipper-like domain-conta | 0.548 | 0.345 | 0.169 | 7.4e-08 | |
| MGI|MGI:2151013 | 1120 | Erc1 "ELKS/RAB6-interacting/CA | 0.342 | 0.197 | 0.248 | 3.7e-07 | |
| UNIPROTKB|F1SQ11 | 1411 | EEA1 "Uncharacterized protein" | 0.553 | 0.253 | 0.213 | 3.8e-07 |
| TAIR|locus:2181241 AT5G27220 "AT5G27220" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 352 (129.0 bits), Expect = 9.0e-29, P = 9.0e-29
Identities = 122/505 (24%), Positives = 228/505 (45%)
Query: 64 DLTMKSLEKQSSSSIDVDMKIR--------LLDERA---KEIENKESELVLVEKKIKDCN 112
++ M+ LEK + S ++ +I +LD+ A K IE E EL L +K + +
Sbjct: 322 NVVMEHLEKSQTRSRELAEEIERKRKELTAVLDKTAEYGKTIELVEEELALQQKLLDIRS 381
Query: 113 FELACKEKELGFVRKRIGVCNSELQSKEDELNLVKNSAEKWPKRLNLKKEKQKRLESLDG 172
EL K+KEL + + + NS ++ + +++ ++ L +E+ ES+
Sbjct: 382 SELVSKKKELDGLSLDLELVNSLNNELKETVQRIESKGKELEDMERLIQERSGHNESIKL 441
Query: 173 EVRESEKELVLMKEQKASIRAMIEACTEKLEAIEESYDAVKAKLESEKRELELTQTFMKD 232
+ E +EL + +E+ I + + ++ + E++ + K S++ +L+ T+ +++
Sbjct: 442 LLEEHSEELAIKEERHNEIAEAVRKLSLEIVSKEKTIQQLSEKQHSKQTKLDSTEKCLEE 501
Query: 233 LLVKLRLYEDNLQSLQSTVXXXXXXXXXXXXXXXXXXXXFCRIQERIEESSQELLLKENQ 292
+L E+ L S++ T F ++I++S ++ KE +
Sbjct: 502 TTAELVSKENELCSVKDTYRECLQNWEIKEKELKS----FQEEVKKIQDSLKDFQSKEAE 557
Query: 293 LKSVLACIEDCSKEDQVKEKELISVGKSIXXXXXXXXXXXXXXXXXDSLRKAVEDSS--- 349
L + + + KE +K+K++ + I D K+ E
Sbjct: 558 LVKLKESLTEHEKELGLKKKQIHVRSEKIELKDKKLDAREERLDKKDEQLKSAEQKLAKC 617
Query: 350 -KNLELRQKKLSDILQLH-PKRSA--APENLTSSGRNLQILLNQHLRRHDVIFCNVFDTI 405
K EL KKL+ Q + P + + + LQ+LL HL++ D + +V +
Sbjct: 618 VKEYELNAKKLASFCQQNNPDQQVDLVRDASVCDEKTLQLLLRGHLKKCDQLHLDVLRAL 677
Query: 406 RKAADPALLVLDAMSGFYPPHSREGYVEFDVSIIRRTCILLLEQLSSLAPEINSQVQGEA 465
+ ++DPA LVL+ + H + + D +RR I LLE L ++PE ++VQ EA
Sbjct: 678 KASSDPAKLVLNTIQRL---HEKMAVTKLDPDSVRRGSICLLECLMDMSPEPKTEVQVEA 734
Query: 466 LKVAVEWKKNMEDTVKDSLVVLGFLHLLAAYKLASAFDGNELASLLDIVANHRQTPKLRR 525
+K EWK ++ + VLGFLH L+A+ LA FD +++ +L D + P L
Sbjct: 735 IKSVTEWKNTTLVKAENPVEVLGFLHFLSAFSLAYTFDADKVQNLFDAAFLRQYAPSLCE 794
Query: 526 SLGFADEVPVMHHEQLSDVASEINP 550
+LG + PV + L D + P
Sbjct: 795 ALGVSSLAPVNNVLSLDDKPEQQPP 819
|
|
| TAIR|locus:2181251 AT5G27230 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:1005716104 AT5G48385 "AT5G48385" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2826175 FRL2 "AT1G31814" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IUD2 ERC1 "ELKS/Rab6-interacting/CAST family member 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QZC5 ERC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2171327 FRL1 "FRIGIDA like 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0286985 zipA "zipper-like domain-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2151013 Erc1 "ELKS/RAB6-interacting/CAST family member 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SQ11 EEA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 645 | |||
| pfam07899 | 293 | pfam07899, Frigida, Frigida-like protein | 3e-38 | |
| pfam07899 | 293 | pfam07899, Frigida, Frigida-like protein | 1e-19 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-11 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 9e-11 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-10 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-10 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-10 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-10 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-09 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-09 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-09 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 5e-08 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 5e-08 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-08 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-07 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 1e-07 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-07 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-07 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-06 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 4e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 8e-06 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 1e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 1e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-05 | |
| COG2433 | 652 | COG2433, COG2433, Uncharacterized conserved protei | 5e-05 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 7e-05 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 1e-04 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 1e-04 | |
| PRK01156 | 895 | PRK01156, PRK01156, chromosome segregation protein | 1e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-04 | |
| TIGR00606 | 1311 | TIGR00606, rad50, rad50 | 2e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 5e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 6e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 8e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.001 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 0.002 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 0.003 |
| >gnl|CDD|219629 pfam07899, Frigida, Frigida-like protein | Back alignment and domain information |
|---|
Score = 143 bits (362), Expect = 3e-38
Identities = 70/161 (43%), Positives = 97/161 (60%), Gaps = 5/161 (3%)
Query: 380 GRNLQILLNQHLRRHDVIFCNVFDTIRKAADPALLVLDAMSGFYPPHSREGYVEFDVSII 439
R L + ++ + + V +R A DPA LVLDA+ GFYPP S+ G E + +
Sbjct: 24 SRGLLKFVIENRKELASLREEVPAALRCAPDPAKLVLDAIEGFYPPDSKGGK-EDKMVDV 82
Query: 440 RRTCILLLEQLSSLAPEINSQVQGEALKVAVEWKKNMEDTVK----DSLVVLGFLHLLAA 495
RR+C+LLLEQL + P I+ V+ EA K+AVEWK +E+ SL LGFL LLAA
Sbjct: 83 RRSCVLLLEQLVRVNPPISPDVKEEAKKLAVEWKAKLEEDGGVENGKSLEALGFLQLLAA 142
Query: 496 YKLASAFDGNELASLLDIVANHRQTPKLRRSLGFADEVPVM 536
+ L S FD +EL L +V+ +Q P+L RSLG AD++P +
Sbjct: 143 FGLVSEFDQDELLKLFVMVSRRKQAPELCRSLGLADKMPDL 183
|
This family is composed of plant proteins that are similar to FRIGIDA protein expressed by Arabidopsis thaliana. This protein is probably nuclear and is required for the regulation of flowering time in the late-flowering phenotype. It is known to increase RNA levels of flowering locus C. Allelic variation at the FRIGIDA locus is a major determinant of natural variation in flowering time. Length = 293 |
| >gnl|CDD|219629 pfam07899, Frigida, Frigida-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129694 TIGR00606, rad50, rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 645 | |||
| PF07899 | 290 | Frigida: Frigida-like protein; InterPro: IPR012474 | 100.0 | |
| PF07899 | 290 | Frigida: Frigida-like protein; InterPro: IPR012474 | 99.89 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 99.88 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 99.76 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.66 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 99.51 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 99.44 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 99.42 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 99.35 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 99.34 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.33 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 99.33 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 99.3 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 99.12 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 99.03 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 98.96 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 98.96 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 98.94 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 98.91 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.9 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 98.89 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 98.89 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 98.85 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 98.84 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 98.79 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 98.74 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 98.69 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 98.69 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.63 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.62 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 98.56 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 98.56 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.53 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 98.52 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 98.48 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.46 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 98.44 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 98.42 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.41 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 98.38 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 98.37 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 98.37 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 98.36 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 98.33 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 98.31 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.3 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 98.27 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 98.25 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 98.22 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 98.22 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 98.14 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 98.03 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 98.02 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 97.97 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.96 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 97.9 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.9 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 97.86 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.86 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 97.85 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 97.83 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 97.83 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 97.8 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 97.8 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 97.78 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 97.78 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 97.71 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 97.7 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 97.61 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 97.57 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 97.56 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.55 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 97.54 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 97.49 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 97.49 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 97.45 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 97.44 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 97.41 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 97.4 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 97.37 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 97.37 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 97.36 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.35 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 97.28 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 97.23 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.22 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 97.17 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 97.1 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 97.02 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 97.0 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 96.96 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.95 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 96.9 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 96.9 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 96.88 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 96.84 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.83 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 96.82 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 96.8 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 96.73 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 96.71 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.69 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 96.64 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 96.59 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.48 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 96.43 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 96.37 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 96.35 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 96.31 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 96.27 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 96.27 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 96.18 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 96.13 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 96.09 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 96.07 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 96.07 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 95.95 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 95.91 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 95.87 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 95.86 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 95.82 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 95.8 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 95.78 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 95.76 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 95.73 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 95.72 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 95.54 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 95.51 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 95.32 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 95.22 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 95.11 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 95.11 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 95.03 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 94.98 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 94.95 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 94.91 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 94.87 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 94.8 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 94.72 | |
| KOG4809 | 654 | consensus Rab6 GTPase-interacting protein involved | 94.61 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 94.6 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 94.54 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 94.53 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 94.52 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 94.51 | |
| PF13514 | 1111 | AAA_27: AAA domain | 94.47 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 94.42 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 94.25 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 94.18 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 94.13 | |
| KOG1937 | 521 | consensus Uncharacterized conserved protein [Funct | 93.95 | |
| PF13166 | 712 | AAA_13: AAA domain | 93.93 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 93.72 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 93.7 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 93.55 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 93.46 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 93.43 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 93.38 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 93.16 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 93.04 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 93.03 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 93.03 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 92.99 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 92.87 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 92.78 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 92.78 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 92.77 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 92.54 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 92.52 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 92.49 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 92.34 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 92.34 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 92.21 | |
| PF13166 | 712 | AAA_13: AAA domain | 92.0 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 91.86 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 91.79 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 91.75 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 91.68 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 91.45 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 91.38 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 91.35 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 91.32 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 91.23 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 91.0 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 91.0 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 90.9 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 90.69 | |
| PF05278 | 269 | PEARLI-4: Arabidopsis phospholipase-like protein ( | 90.61 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 90.39 | |
| KOG0249 | 916 | consensus LAR-interacting protein and related prot | 90.39 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 90.31 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 90.07 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 89.81 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 89.76 | |
| PF04949 | 159 | Transcrip_act: Transcriptional activator; InterPro | 89.65 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 89.45 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 89.44 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 88.9 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 88.84 | |
| PF14992 | 280 | TMCO5: TMCO5 family | 88.74 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 88.64 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 88.56 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 87.99 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 87.79 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 87.52 | |
| KOG4302 | 660 | consensus Microtubule-associated protein essential | 87.38 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 86.92 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 86.52 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 86.23 | |
| PF04912 | 388 | Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit | 86.13 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 86.13 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 85.85 | |
| PF07889 | 126 | DUF1664: Protein of unknown function (DUF1664); In | 85.54 | |
| PF06120 | 301 | Phage_HK97_TLTM: Tail length tape measure protein; | 85.31 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 85.21 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 84.64 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 84.5 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 84.4 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 84.26 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 83.74 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 83.56 | |
| PF04582 | 326 | Reo_sigmaC: Reovirus sigma C capsid protein; Inter | 83.4 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 82.64 | |
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 82.47 | |
| PF14992 | 280 | TMCO5: TMCO5 family | 82.03 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 81.78 | |
| KOG4603 | 201 | consensus TBP-1 interacting protein [Signal transd | 81.73 | |
| KOG2991 | 330 | consensus Splicing regulator [RNA processing and m | 81.5 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 81.47 | |
| PF07851 | 330 | TMPIT: TMPIT-like protein; InterPro: IPR012926 A n | 81.31 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 80.8 |
| >PF07899 Frigida: Frigida-like protein; InterPro: IPR012474 This family is composed of plant proteins that are similar to FRIGIDA protein expressed by Arabidopsis thaliana (Mouse-ear cress) (Q9FDW0 from SWISSPROT) | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.5e-58 Score=475.04 Aligned_cols=242 Identities=33% Similarity=0.508 Sum_probs=220.9
Q ss_pred CCCCCchhhhhCChhHHHHHHHHhhhhhhhhhhhhHHHHhhCCCchhhHhhhhcCCCCCCCCCCcccchhhHhHHHHHHH
Q 039206 367 PKRSAAPENLTSSGRNLQILLNQHLRRHDVIFCNVFDTIRKAADPALLVLDAMSGFYPPHSREGYVEFDVSIIRRTCILL 446 (645)
Q Consensus 367 p~~~l~~lc~~md~~~L~~~i~~~~ke~~~lr~e~~~AL~~a~dPa~LVLd~~e~~~~~~~~~~~~~~~~~~~r~~cill 446 (645)
|++.+..+|++|||+||++||++|+++..++|+|+|+||++|||||+||||+++|||+++.+. +++.++..+||+||+|
T Consensus 11 ~~~~L~~lC~~MD~~gL~~fv~~~~k~~~~lr~Ev~~AL~~A~DPAkLVLdai~~f~~~~~~~-~~~~~~~~~r~~cilL 89 (290)
T PF07899_consen 11 PRPELKSLCEKMDGKGLRKFVSENRKELASLREEVPAALRCAPDPAKLVLDAIEGFYPPGSKN-KKDSKLVDVRRACILL 89 (290)
T ss_pred hHHHHHHHHHHCCHHHHHHHHHHhhhhHHHHHHHHHHHHHcCCChHHHHHHHHHcccCCcccc-ccCcchhhHHHHHHHH
Confidence 456899999999999999999999999999999999999999999999999999999999765 7788899999999999
Q ss_pred HHhhhhcCCCCChhhHHHHHHHHHHHHHhc-cccCCchHHHHHHHHHHHhhcCCCCCChHHHHHHHHhhhccccchHHHh
Q 039206 447 LEQLSSLAPEINSQVQGEALKVAVEWKKNM-EDTVKDSLVVLGFLHLLAAYKLASAFDGNELASLLDIVANHRQTPKLRR 525 (645)
Q Consensus 447 LE~L~~~~p~i~~~vke~A~~lA~~WK~~i-~~~~~~sl~al~fL~~la~ygi~~~f~~del~~l~~~v~~~~~~~~L~~ 525 (645)
||+|+.++|.++|+|+++|+++|.+||++| +.+++++++|+||||||++|||+++||.|||++||..+++|+|+|+||+
T Consensus 90 LE~L~~~~~~is~~vke~A~~lA~~WK~~l~~~~~~~~lea~gFL~lla~fgi~s~Fd~del~~Lv~~va~~~~a~~L~~ 169 (290)
T PF07899_consen 90 LEQLMRISPEISPEVKEEAKKLAEEWKSKLDGVNNENSLEALGFLQLLAAFGIVSEFDEDELLKLVVSVARRKQAPELCR 169 (290)
T ss_pred HHHHhhcCCCCCHHHHHHHHHHHHHHHHHHHhcccCCCHHHHHHHHHHHHcCCccccCHHHHHHHHHHhcchHhhHHHHH
Confidence 999999999999999999999999999999 7778899999999999999999999999999999999999999999999
Q ss_pred hhCCCCCcchhhhh------hhccc----------cccCChhhHHHHHHHHHHHHHhhhh---------hhhchhhH-HH
Q 039206 526 SLGFADEVPVMHHE------QLSDV----------ASEINPLVRDEAMKVAGEWKEKMRA---------AVENSLEV-LG 579 (645)
Q Consensus 526 ~lgl~~ki~~~v~~------~i~Av----------~f~~~pllk~~a~k~a~~wk~~~~~---------~~~~~lea-~~ 579 (645)
+|||++||||+|++ ||+|| .|.|+|+|++|++.....|+..... +.+.++.| ++
T Consensus 170 sLgl~~k~~d~V~~LI~~g~~ieAv~fi~~f~L~dkfpPv~lLk~yl~~~k~~~~~~~~~~~~~~a~~ea~~kel~aL~~ 249 (290)
T PF07899_consen 170 SLGLSDKMPDIVEKLIKKGKQIEAVRFIYAFGLVDKFPPVPLLKSYLEDSKKAAKRIRKKGNSSEAQNEANEKELAALKS 249 (290)
T ss_pred HcCchhhhHHHHHHHHHCCCccchHHHHHHHcCCCCCCCHHHHHHHHHHHHHHHHHHHhcCCChHHHHHHHHHHHHHHHH
Confidence 99999999999998 99999 3357899999998766666643321 11234555 59
Q ss_pred HHHHHHHhCCCCCCChhhHHHHHHHHHhcc
Q 039206 580 LLHLLGAFRLAPAFDGNELESLLAIVAEDR 609 (645)
Q Consensus 580 ~L~~I~~y~L~s~f~~d~L~k~v~~~a~~k 609 (645)
+++||++|+|+++||.+.|.+++.++.+.+
T Consensus 250 vikcIee~kLes~~~~~~l~kri~~Lek~~ 279 (290)
T PF07899_consen 250 VIKCIEEHKLESEFPLEPLQKRIEQLEKQK 279 (290)
T ss_pred HHHHHHHhccccccChHHHHHHHHHHHHHH
Confidence 999999999999999999999999998654
|
This protein is probably nuclear and is required for the regulation of flowering time in the late-flowering phenotype. It is known to increase RNA levels of flowering locus C. Allelic variation at the FRIGIDA locus is a major determinant of natural variation in flowering time []. |
| >PF07899 Frigida: Frigida-like protein; InterPro: IPR012474 This family is composed of plant proteins that are similar to FRIGIDA protein expressed by Arabidopsis thaliana (Mouse-ear cress) (Q9FDW0 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG1937 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF04949 Transcrip_act: Transcriptional activator; InterPro: IPR007033 Golgins are a family of coiled-coil proteins associated with the Golgi apparatus necessary for tethering events in membrane fusion and as structural supports for Golgi cisternae [] | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >PF14992 TMCO5: TMCO5 family | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >PF14992 TMCO5: TMCO5 family | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4603 consensus TBP-1 interacting protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2991 consensus Splicing regulator [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PF07851 TMPIT: TMPIT-like protein; InterPro: IPR012926 A number of members of this family are annotated as being transmembrane proteins induced by tumour necrosis factor alpha, but no literature was found to support this | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 645 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-14 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-14 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-14 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-12 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-11 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-08 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 7e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-05 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 4e-06 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 8e-04 | |
| 2xs1_A | 704 | Programmed cell death 6-interacting protein; prote | 2e-04 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 3e-04 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 4e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 76.0 bits (186), Expect = 2e-14
Identities = 66/465 (14%), Positives = 141/465 (30%), Gaps = 145/465 (31%)
Query: 240 YEDNLQSLQSTVRLRENELECKEKELELKEREFCRIQERIEESSQELLLKENQLKSVLAC 299
Y+D L + + +CK+ +++ + +L KE
Sbjct: 18 YKDILSVFEDAFV---DNFDCKD----------------VQDMPKSILSKEE-------- 50
Query: 300 IEDCSKEDQVKEKELISVGKSIRQFEERVREFELREREFDSLRKAVEDSSKNLELRQKKL 359
I+ L + + EE V++F VE+ L + K L
Sbjct: 51 IDHIIMSKDAVSGTLRLFWTLLSKQEEMVQKF-------------VEEV---LRINYKFL 94
Query: 360 SDILQLHPKRSAAPENLTSSGRNLQILLNQHLRRHDVIFCNVFDTIRKA---ADPA-LLV 415
++ ++ + + R+ NQ +++V + +R+A PA ++
Sbjct: 95 MSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVL 154
Query: 416 LDAMSGF---------YPPHSREGYVEFDV---SIIRRTCI-LLLEQLSSL----APEIN 458
+D + G + + ++F + ++ +LE L L P
Sbjct: 155 IDGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWT 214
Query: 459 SQV-QGEALKVAVEWKKN------MEDTVKDSLVVLGFLHLLAAYKLASAFDGN------ 505
S+ +K+ + + ++ L+VL L++ A K +AF+ +
Sbjct: 215 SRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVL--LNVQNA-KAWNAFNLSCKILLT 271
Query: 506 -ELASLLDIV-ANHRQTPKL-RRSLGFADE--------VPVMHHEQLSDVASEINPLVRD 554
+ D + A L S+ + + L NP
Sbjct: 272 TRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPR--- 328
Query: 555 EAMKVAGE-----------WK----EKMRAAVENSLEVLGLLHLLGAFRLAPAFDGNELE 599
+ + E WK +K+ +E+SL VL + E
Sbjct: 329 -RLSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVL---------------EPAEYR 372
Query: 600 SL---LAIVAEDRQTPKLCRSLGFADKVPGKLSVIEIQMYWLQLV 641
+ L++ +P L + + W ++
Sbjct: 373 KMFDRLSVFPPSA-------------HIPTIL----LSLIWFDVI 400
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 645 | |||
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 99.39 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 99.16 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 99.1 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 98.28 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 98.13 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 97.34 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 97.33 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 97.17 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 97.0 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 96.77 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 96.59 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 96.56 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 96.37 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 95.81 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 95.8 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 95.51 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 95.37 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 95.15 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 94.94 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 94.49 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 94.12 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 93.93 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 93.76 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 93.61 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 92.85 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 91.89 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 91.48 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 89.46 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 89.32 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 89.05 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 89.04 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 88.51 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 88.02 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 87.74 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 86.93 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 86.56 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 86.44 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 86.36 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 85.92 | |
| 2xzr_A | 114 | Immunoglobulin-binding protein EIBD; cell adhesion | 84.88 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 84.12 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 83.37 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 82.71 | |
| 3jsv_C | 94 | NF-kappa-B essential modulator; ubiquitin, coiled- | 81.99 | |
| 2xzr_A | 114 | Immunoglobulin-binding protein EIBD; cell adhesion | 81.56 |
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
Probab=99.39 E-value=1.6e-08 Score=101.28 Aligned_cols=71 Identities=15% Similarity=0.173 Sum_probs=27.5
Q ss_pred HhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHhHHHHhhHHHHHHHHHH
Q 039206 78 IDVDMKIRLLDERAKEIENKESELVLVEKKIKDCNFELACKEKELGFVRKRIGVCNSELQSKEDELNLVKN 148 (645)
Q Consensus 78 ~~v~~~~~~~ee~~~~~e~~~~eie~~e~~lee~~~e~~~~~~el~~l~~~i~e~~~el~~le~eL~~le~ 148 (645)
.++..+...++++...+..+...+...+..+..+...+......+..+...+......+..+...+..++.
T Consensus 13 ~~~~~~~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 83 (284)
T 1c1g_A 13 LDKENALDRADEAEADKKAAEDRSKQLEDELVSLQKKLKATEDELDKYSEALKDAQEKLELAEKKATDAEA 83 (284)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 33333333333333333333333333333333333333333333333333333333333333333333333
|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >2xzr_A Immunoglobulin-binding protein EIBD; cell adhesion, trimeric autotransporter adhesin, TAA; 2.80A {Enterobacteria phage p-eibd} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B | Back alignment and structure |
|---|
| >2xzr_A Immunoglobulin-binding protein EIBD; cell adhesion, trimeric autotransporter adhesin, TAA; 2.80A {Enterobacteria phage p-eibd} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 645 | |||
| d1fxka_ | 107 | Prefoldin beta subunit {Archaeon Methanobacterium | 87.29 |
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Prefoldin family: Prefoldin domain: Prefoldin beta subunit species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]
Probab=87.29 E-value=3 Score=34.03 Aligned_cols=37 Identities=19% Similarity=0.252 Sum_probs=24.0
Q ss_pred hHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 039206 160 KKEKQKRLESLDGEVRESEKELVLMKEQKASIRAMIE 196 (645)
Q Consensus 160 k~el~~~ieei~~eI~~~e~~ie~~ekeieel~~eIE 196 (645)
.|.|..+++.++++|+++++.+..+++++++++..+.
T Consensus 67 ~~~l~~~~e~l~~~i~~l~~q~~~l~~~l~~~~~~l~ 103 (107)
T d1fxka_ 67 TEELQEKLETLQLREKTIERQEERVMKKLQEMQVNIQ 103 (107)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 3667777777777777777776666666555555443
|