Citrus Sinensis ID: 039216
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 394 | ||||||
| 296084437 | 399 | unnamed protein product [Vitis vinifera] | 0.860 | 0.849 | 0.555 | 1e-113 | |
| 147837629 | 376 | hypothetical protein VITISV_020885 [Viti | 0.865 | 0.906 | 0.543 | 1e-112 | |
| 225463711 | 376 | PREDICTED: uncharacterized protein At5g3 | 0.865 | 0.906 | 0.543 | 1e-112 | |
| 255546809 | 415 | electron transporter, putative [Ricinus | 0.926 | 0.879 | 0.564 | 1e-108 | |
| 224100575 | 401 | hypothetical protein POPTRDRAFT_563536 [ | 0.964 | 0.947 | 0.561 | 1e-107 | |
| 356533860 | 343 | PREDICTED: uncharacterized protein At5g3 | 0.860 | 0.988 | 0.507 | 1e-103 | |
| 356574699 | 380 | PREDICTED: uncharacterized protein At5g3 | 0.898 | 0.931 | 0.488 | 7e-98 | |
| 449446311 | 342 | PREDICTED: uncharacterized protein LOC10 | 0.852 | 0.982 | 0.487 | 5e-86 | |
| 357442781 | 369 | Glutaredoxin domain-containing cysteine- | 0.835 | 0.891 | 0.447 | 2e-83 | |
| 297806075 | 405 | hypothetical protein ARALYDRAFT_486934 [ | 0.949 | 0.923 | 0.432 | 4e-70 |
| >gi|296084437|emb|CBI24996.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 413 bits (1061), Expect = e-113, Method: Compositional matrix adjust.
Identities = 214/385 (55%), Positives = 274/385 (71%), Gaps = 46/385 (11%)
Query: 14 TIKPIGYLKPDRILQVNAADGFFETFSKISNGKFQQTQMESKRSEQEKKISERIEEIE-E 72
+I+PIGYLK DR+LQVNA+DGF + S + Q Q K + Q +R E E
Sbjct: 57 SIRPIGYLKEDRVLQVNASDGFLDG-SSWNPSVGVQAQFVCKGTVQNGL--DRTGGTERE 113
Query: 73 PDIIDVEELMKDLEDEEEEEEEEEAEEMELDDGINDKENIGPPTKPKDSVSCNSKENVEL 132
P++IDV ELM+DLE E+ME DD ++DKENIGPP + KD +
Sbjct: 114 PEVIDVMELMRDLE----------GEDMEFDDLMDDKENIGPPVRAKDPD--DGTWEATG 161
Query: 133 SKKVEPLAEIDVSSFRRPDMNSGTLFDPNLLAAFEEAVNQHIRLSQEERKARIDQEKNTE 192
+ PL+EID+SSFRRPD+NSG+LFDPNLLAAF++AV IR+++EERKAR+ +E
Sbjct: 162 NPGHTPLSEIDISSFRRPDLNSGSLFDPNLLAAFQQAVMDQIRINEEERKARMKEE---- 217
Query: 193 ETERDATIEQVDVEKLEEEEEPEPPYKSRRIQKEEEEEGEESNPLLNFELKCPPGGDESV 252
DVE + EPP K+RR++ +++NPLL FE +CPPGG ++V
Sbjct: 218 -----------DVEI-----DDEPPPKARRVE-------DDTNPLLGFEERCPPGGSDAV 254
Query: 253 IFYTTTLRGIRKTFEDCSSVRFLLESFKVIFFERDVSMHIEFREELWKVLDCKAVPPRLF 312
+ YTT+LRGIRKTFEDC+S+RFLLESF+VIF+ERDVSMH+EFREELW++LDCKA+PPRLF
Sbjct: 255 VLYTTSLRGIRKTFEDCTSIRFLLESFRVIFYERDVSMHLEFREELWRILDCKALPPRLF 314
Query: 313 IKGRYIGGAAEVLTLHEQGKLRPLFDGIPIDRSDGPCDGCAGVRFVLCFRCCGSHKVVTG 372
IKGRYIGGA +VL LHEQG+LR LF G+PID S GPC+GCAG+RFV+C++CCGS K+V+
Sbjct: 315 IKGRYIGGAEQVLGLHEQGRLRALFHGLPIDHSKGPCEGCAGIRFVMCYKCCGSRKIVSD 374
Query: 373 D---GLASQCQECNENGLIICPYCC 394
D GL++ C CNENGLIICP CC
Sbjct: 375 DGNHGLSNNCPHCNENGLIICPICC 399
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147837629|emb|CAN72487.1| hypothetical protein VITISV_020885 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225463711|ref|XP_002263752.1| PREDICTED: uncharacterized protein At5g39865-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255546809|ref|XP_002514463.1| electron transporter, putative [Ricinus communis] gi|223546459|gb|EEF47959.1| electron transporter, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224100575|ref|XP_002311930.1| hypothetical protein POPTRDRAFT_563536 [Populus trichocarpa] gi|222851750|gb|EEE89297.1| hypothetical protein POPTRDRAFT_563536 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356533860|ref|XP_003535476.1| PREDICTED: uncharacterized protein At5g39865-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356574699|ref|XP_003555483.1| PREDICTED: uncharacterized protein At5g39865-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449446311|ref|XP_004140915.1| PREDICTED: uncharacterized protein LOC101211414 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357442781|ref|XP_003591668.1| Glutaredoxin domain-containing cysteine-rich protein [Medicago truncatula] gi|358346057|ref|XP_003637089.1| Glutaredoxin domain-containing cysteine-rich protein [Medicago truncatula] gi|355480716|gb|AES61919.1| Glutaredoxin domain-containing cysteine-rich protein [Medicago truncatula] gi|355503024|gb|AES84227.1| Glutaredoxin domain-containing cysteine-rich protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297806075|ref|XP_002870921.1| hypothetical protein ARALYDRAFT_486934 [Arabidopsis lyrata subsp. lyrata] gi|297316758|gb|EFH47180.1| hypothetical protein ARALYDRAFT_486934 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 394 | ||||||
| TAIR|locus:2179157 | 401 | AT5G01420 [Arabidopsis thalian | 0.401 | 0.394 | 0.602 | 9.3e-67 | |
| TAIR|locus:2150640 | 384 | AT5G03870 [Arabidopsis thalian | 0.398 | 0.408 | 0.518 | 1.1e-44 | |
| TAIR|locus:2164285 | 239 | AT5G06470 [Arabidopsis thalian | 0.393 | 0.648 | 0.527 | 6.4e-44 | |
| TAIR|locus:2139252 | 334 | AT4G10630 [Arabidopsis thalian | 0.390 | 0.461 | 0.523 | 4.2e-40 | |
| TAIR|locus:2035589 | 314 | AT1G32760 [Arabidopsis thalian | 0.373 | 0.468 | 0.506 | 1.3e-38 | |
| TAIR|locus:2019479 | 368 | AT1G64500 [Arabidopsis thalian | 0.403 | 0.432 | 0.455 | 1.7e-34 | |
| TAIR|locus:2080635 | 417 | AT3G57070 [Arabidopsis thalian | 0.378 | 0.357 | 0.424 | 2.6e-32 | |
| TAIR|locus:2098408 | 428 | AT3G28850 [Arabidopsis thalian | 0.309 | 0.285 | 0.443 | 1.4e-29 | |
| TAIR|locus:2159038 | 274 | AT5G13810 [Arabidopsis thalian | 0.375 | 0.540 | 0.433 | 2.7e-29 | |
| TAIR|locus:2040267 | 402 | AT2G41330 [Arabidopsis thalian | 0.368 | 0.360 | 0.44 | 2.2e-27 |
| TAIR|locus:2179157 AT5G01420 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 522 (188.8 bits), Expect = 9.3e-67, Sum P(3) = 9.3e-67
Identities = 97/161 (60%), Positives = 123/161 (76%)
Query: 235 NPLLNFELKCPPGGDESVIFYTTTLRGIRKTFEDCSSVRFLLESFKVIFFERDVSMHIEF 294
+PLL FE +CPPGG+ESV+FYTTTLRGIRKTF+DC+ +RFLL+SFKV ++ERDVSMH E+
Sbjct: 241 DPLLEFEERCPPGGEESVVFYTTTLRGIRKTFDDCNMIRFLLDSFKVKYYERDVSMHREY 300
Query: 295 REELWKV--LDCKAVPPRLFIKGRYIGGAAEVLTLHEQGKLRPLFDGIPIDRSDGPCDGC 352
REEL ++ + + +PP LF+KGR IGGA VL LHEQGK + LF+GIPI D C C
Sbjct: 301 REELRRISAAETEVLPPVLFVKGRCIGGAQRVLGLHEQGKFKILFEGIPIT-GDERCRRC 359
Query: 353 AGVRFVLCFRCCGSHKVVTGDGLASQCQECNENGLIICPYC 393
G RF++C C GS ++++GDG QC CNENGLI+C C
Sbjct: 360 DGFRFLMCDGCRGSRRIISGDGSRIQCLICNENGLIVCVGC 400
|
|
| TAIR|locus:2150640 AT5G03870 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2164285 AT5G06470 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2139252 AT4G10630 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2035589 AT1G32760 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2019479 AT1G64500 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2080635 AT3G57070 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2098408 AT3G28850 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2159038 AT5G13810 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2040267 AT2G41330 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 394 | |||
| cd03031 | 147 | cd03031, GRX_GRX_like, Glutaredoxin (GRX) family, | 8e-66 | |
| cd02066 | 72 | cd02066, GRX_family, Glutaredoxin (GRX) family; co | 4e-15 | |
| pfam00462 | 60 | pfam00462, Glutaredoxin, Glutaredoxin | 2e-10 | |
| TIGR02181 | 79 | TIGR02181, GRX_bact, Glutaredoxin, GrxC family | 1e-06 | |
| cd03419 | 82 | cd03419, GRX_GRXh_1_2_like, Glutaredoxin (GRX) fam | 8e-06 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 1e-04 | |
| TIGR02180 | 84 | TIGR02180, GRX_euk, Glutaredoxin | 5e-04 | |
| TIGR02189 | 99 | TIGR02189, GlrX-like_plant, Glutaredoxin-like fami | 8e-04 | |
| TIGR00927 | 1096 | TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | 0.003 |
| >gnl|CDD|239329 cd03031, GRX_GRX_like, Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs | Back alignment and domain information |
|---|
Score = 205 bits (524), Expect = 8e-66
Identities = 82/147 (55%), Positives = 100/147 (68%), Gaps = 7/147 (4%)
Query: 251 SVIFYTTTLRGIRKTFEDCSSVRFLLESFKVIFFERDVSMHIEFREELWKVL--DCKAV- 307
V+ YTT+LRG+RKTFEDC++VR +LESF+V F ERDVSM FREEL ++L + KAV
Sbjct: 1 RVVLYTTSLRGVRKTFEDCNNVRAILESFRVKFDERDVSMDSGFREELRELLGAELKAVS 60
Query: 308 PPRLFIKGRYIGGAAEVLTLHEQGKLRPLFDGIPIDRSDGPCDGCAGVRFVLCFRCCGSH 367
PR+F+ GRY+GGA EVL L+E G+LR L GI G C+GC G RFV C C GS
Sbjct: 61 LPRVFVDGRYLGGAEEVLRLNESGELRKLLKGIRARAGGGVCEGCGGARFVPCSECNGSC 120
Query: 368 KVV----TGDGLASQCQECNENGLIIC 390
KV T G +C ECNENGL+ C
Sbjct: 121 KVFAENATAAGGFLRCPECNENGLVRC 147
|
This subfamily is predominantly composed of plant proteins. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins via a redox active CXXC motif using a similar dithiol mechanism employed by TRXs. GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. Proteins containing only the C-terminal cysteine are generally redox inactive. Length = 147 |
| >gnl|CDD|239017 cd02066, GRX_family, Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|215931 pfam00462, Glutaredoxin, Glutaredoxin | Back alignment and domain information |
|---|
| >gnl|CDD|233766 TIGR02181, GRX_bact, Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >gnl|CDD|239511 cd03419, GRX_GRXh_1_2_like, Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233765 TIGR02180, GRX_euk, Glutaredoxin | Back alignment and domain information |
|---|
| >gnl|CDD|233771 TIGR02189, GlrX-like_plant, Glutaredoxin-like family | Back alignment and domain information |
|---|
| >gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 394 | |||
| KOG2824 | 281 | consensus Glutaredoxin-related protein [Posttransl | 100.0 | |
| cd03031 | 147 | GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d | 100.0 | |
| cd03030 | 92 | GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 | 99.88 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 99.83 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 99.82 | |
| PRK10824 | 115 | glutaredoxin-4; Provisional | 99.82 | |
| PHA03050 | 108 | glutaredoxin; Provisional | 99.81 | |
| TIGR02181 | 79 | GRX_bact Glutaredoxin, GrxC family. This family of | 99.78 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 99.78 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 99.77 | |
| cd03418 | 75 | GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b | 99.73 | |
| KOG1752 | 104 | consensus Glutaredoxin and related proteins [Postt | 99.72 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 99.72 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 99.7 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 99.66 | |
| cd03419 | 82 | GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h | 99.65 | |
| COG0695 | 80 | GrxC Glutaredoxin and related proteins [Posttransl | 99.65 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 99.62 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 99.61 | |
| COG0278 | 105 | Glutaredoxin-related protein [Posttranslational mo | 99.59 | |
| TIGR02183 | 86 | GRXA Glutaredoxin, GrxA family. This model include | 99.57 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 99.57 | |
| PRK11200 | 85 | grxA glutaredoxin 1; Provisional | 99.56 | |
| PF04908 | 99 | SH3BGR: SH3-binding, glutamic acid-rich protein; I | 99.53 | |
| PF00462 | 60 | Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl | 99.51 | |
| KOG0911 | 227 | consensus Glutaredoxin-related protein [Posttransl | 99.45 | |
| PRK12759 | 410 | bifunctional gluaredoxin/ribonucleoside-diphosphat | 99.43 | |
| TIGR02194 | 72 | GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red | 99.31 | |
| PRK10329 | 81 | glutaredoxin-like protein; Provisional | 99.29 | |
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 99.01 | |
| cd02976 | 73 | NrdH NrdH-redoxin (NrdH) family; NrdH is a small m | 98.96 | |
| TIGR02200 | 77 | GlrX_actino Glutaredoxin-like protein. This family | 98.73 | |
| cd02973 | 67 | TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- | 98.51 | |
| cd03041 | 77 | GST_N_2GST_N GST_N family, 2 repeats of the N-term | 98.31 | |
| KOG4023 | 108 | consensus Uncharacterized conserved protein [Funct | 98.21 | |
| cd03040 | 77 | GST_N_mPGES2 GST_N family; microsomal Prostaglandi | 98.18 | |
| cd00570 | 71 | GST_N_family Glutathione S-transferase (GST) famil | 98.16 | |
| cd03037 | 71 | GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub | 98.11 | |
| cd03055 | 89 | GST_N_Omega GST_N family, Class Omega subfamily; G | 98.03 | |
| cd03059 | 73 | GST_N_SspA GST_N family, Stringent starvation prot | 97.83 | |
| cd03036 | 111 | ArsC_like Arsenate Reductase (ArsC) family, unknow | 97.81 | |
| cd02977 | 105 | ArsC_family Arsenate Reductase (ArsC) family; comp | 97.71 | |
| cd03051 | 74 | GST_N_GTT2_like GST_N family, Saccharomyces cerevi | 97.64 | |
| cd03060 | 71 | GST_N_Omega_like GST_N family, Omega-like subfamil | 97.64 | |
| PRK01655 | 131 | spxA transcriptional regulator Spx; Reviewed | 97.57 | |
| cd03045 | 74 | GST_N_Delta_Epsilon GST_N family, Class Delta and | 97.48 | |
| PF13417 | 75 | GST_N_3: Glutathione S-transferase, N-terminal dom | 97.47 | |
| TIGR00411 | 82 | redox_disulf_1 small redox-active disulfide protei | 97.46 | |
| PF05768 | 81 | DUF836: Glutaredoxin-like domain (DUF836); InterPr | 97.46 | |
| TIGR01617 | 117 | arsC_related transcriptional regulator, Spx/MgsR f | 97.43 | |
| cd03056 | 73 | GST_N_4 GST_N family, unknown subfamily 4; compose | 97.39 | |
| cd03032 | 115 | ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub | 97.36 | |
| PRK13344 | 132 | spxA transcriptional regulator Spx; Reviewed | 97.17 | |
| PRK12559 | 131 | transcriptional regulator Spx; Provisional | 97.17 | |
| cd03026 | 89 | AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid | 97.17 | |
| cd03054 | 72 | GST_N_Metaxin GST_N family, Metaxin subfamily; com | 97.13 | |
| cd03035 | 105 | ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s | 97.06 | |
| PHA02125 | 75 | thioredoxin-like protein | 96.98 | |
| cd03058 | 74 | GST_N_Tau GST_N family, Class Tau subfamily; GSTs | 96.92 | |
| cd03033 | 113 | ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p | 96.9 | |
| cd03053 | 76 | GST_N_Phi GST_N family, Class Phi subfamily; compo | 96.76 | |
| PLN03165 | 111 | chaperone protein dnaJ-related; Provisional | 96.62 | |
| PF13192 | 76 | Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY | 96.6 | |
| cd03076 | 73 | GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar | 96.58 | |
| cd03052 | 73 | GST_N_GDAP1 GST_N family, Ganglioside-induced diff | 96.57 | |
| TIGR00412 | 76 | redox_disulf_2 small redox-active disulfide protei | 96.52 | |
| KOG3029 | 370 | consensus Glutathione S-transferase-related protei | 96.51 | |
| cd03042 | 73 | GST_N_Zeta GST_N family, Class Zeta subfamily; GST | 96.49 | |
| cd03061 | 91 | GST_N_CLIC GST_N family, Chloride Intracellular Ch | 96.43 | |
| cd03039 | 72 | GST_N_Sigma_like GST_N family, Class Sigma_like; c | 96.22 | |
| cd03048 | 81 | GST_N_Ure2p_like GST_N family, Ure2p-like subfamil | 96.2 | |
| cd03049 | 73 | GST_N_3 GST_N family, unknown subfamily 3; compose | 96.14 | |
| PRK10387 | 210 | glutaredoxin 2; Provisional | 96.12 | |
| cd01659 | 69 | TRX_superfamily Thioredoxin (TRX) superfamily; a l | 96.11 | |
| TIGR02182 | 209 | GRXB Glutaredoxin, GrxB family. This model include | 96.02 | |
| cd03034 | 112 | ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s | 95.94 | |
| cd02975 | 113 | PfPDO_like_N Pyrococcus furiosus protein disulfide | 95.94 | |
| cd02947 | 93 | TRX_family TRX family; composed of two groups: Gro | 95.92 | |
| TIGR00014 | 114 | arsC arsenate reductase (glutaredoxin). composed o | 95.92 | |
| COG1393 | 117 | ArsC Arsenate reductase and related proteins, glut | 95.82 | |
| cd03080 | 75 | GST_N_Metaxin_like GST_N family, Metaxin subfamily | 95.73 | |
| cd03038 | 84 | GST_N_etherase_LigE GST_N family, Beta etherase Li | 95.58 | |
| PRK10853 | 118 | putative reductase; Provisional | 95.52 | |
| PRK10026 | 141 | arsenate reductase; Provisional | 95.32 | |
| TIGR01616 | 126 | nitro_assoc nitrogenase-associated protein. This m | 95.28 | |
| cd02953 | 104 | DsbDgamma DsbD gamma family; DsbD gamma is the C-t | 95.24 | |
| cd03050 | 76 | GST_N_Theta GST_N family, Class Theta subfamily; c | 95.19 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 95.04 | |
| cd03044 | 75 | GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo | 94.87 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 94.87 | |
| TIGR01295 | 122 | PedC_BrcD bacteriocin transport accessory protein, | 94.78 | |
| PRK09481 | 211 | sspA stringent starvation protein A; Provisional | 94.74 | |
| COG4545 | 85 | Glutaredoxin-related protein [Posttranslational mo | 94.69 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 94.63 | |
| cd02949 | 97 | TRX_NTR TRX domain, novel NADPH thioredoxin reduct | 94.55 | |
| cd03043 | 73 | GST_N_1 GST_N family, unknown subfamily 1; compose | 94.4 | |
| cd03046 | 76 | GST_N_GTT1_like GST_N family, Saccharomyces cerevi | 94.23 | |
| cd03057 | 77 | GST_N_Beta GST_N family, Class Beta subfamily; GST | 94.13 | |
| TIGR00862 | 236 | O-ClC intracellular chloride channel protein. Thes | 93.99 | |
| PF03960 | 110 | ArsC: ArsC family; InterPro: IPR006660 Several bac | 93.96 | |
| PF13409 | 70 | GST_N_2: Glutathione S-transferase, N-terminal dom | 93.89 | |
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 93.76 | |
| cd03047 | 73 | GST_N_2 GST_N family, unknown subfamily 2; compose | 93.64 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 93.36 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 93.24 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 93.17 | |
| KOG2813 | 406 | consensus Predicted molecular chaperone, contains | 92.81 | |
| cd02989 | 113 | Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior | 92.75 | |
| PTZ00051 | 98 | thioredoxin; Provisional | 92.58 | |
| PF00684 | 66 | DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 | 92.44 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 92.3 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 92.23 | |
| PHA02278 | 103 | thioredoxin-like protein | 92.16 | |
| TIGR01068 | 101 | thioredoxin thioredoxin. Several proteins, such as | 92.14 | |
| cd02957 | 113 | Phd_like Phosducin (Phd)-like family; composed of | 92.02 | |
| cd02954 | 114 | DIM1 Dim1 family; Dim1 is also referred to as U5 s | 91.6 | |
| PRK15113 | 214 | glutathione S-transferase; Provisional | 91.53 | |
| TIGR01262 | 210 | maiA maleylacetoacetate isomerase. Maleylacetoacet | 91.5 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 91.35 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 91.26 | |
| PF00085 | 103 | Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio | 91.21 | |
| cd02984 | 97 | TRX_PICOT TRX domain, PICOT (for PKC-interacting c | 91.17 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 91.1 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 91.09 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 91.08 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 91.05 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 91.03 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 91.01 | |
| KOG0406 | 231 | consensus Glutathione S-transferase [Posttranslati | 91.0 | |
| PF13098 | 112 | Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ | 90.73 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 90.71 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 90.64 | |
| PRK10877 | 232 | protein disulfide isomerase II DsbC; Provisional | 90.49 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 90.4 | |
| PRK09381 | 109 | trxA thioredoxin; Provisional | 90.37 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 90.26 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 90.08 | |
| PLN02378 | 213 | glutathione S-transferase DHAR1 | 90.02 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 89.92 | |
| cd03077 | 79 | GST_N_Alpha GST_N family, Class Alpha subfamily; G | 89.77 | |
| PLN02473 | 214 | glutathione S-transferase | 89.76 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 89.46 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 89.44 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 89.39 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 89.21 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 89.09 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 89.08 | |
| PLN02817 | 265 | glutathione dehydrogenase (ascorbate) | 89.06 | |
| cd02961 | 101 | PDI_a_family Protein Disulfide Isomerase (PDIa) fa | 89.02 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 88.92 | |
| cd02985 | 103 | TRX_CDSP32 TRX family, chloroplastic drought-induc | 88.91 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 88.87 | |
| cd02956 | 96 | ybbN ybbN protein family; ybbN is a hypothetical p | 88.49 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 88.28 | |
| cd02965 | 111 | HyaE HyaE family; HyaE is also called HupG and Hox | 88.22 | |
| PRK10996 | 139 | thioredoxin 2; Provisional | 88.02 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 87.96 | |
| cd03020 | 197 | DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil | 87.9 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 87.83 | |
| cd02951 | 125 | SoxW SoxW family; SoxW is a bacterial periplasmic | 87.66 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 87.42 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 87.19 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 87.15 | |
| TIGR01126 | 102 | pdi_dom protein disulfide-isomerase domain. This m | 87.11 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 87.04 | |
| cd03003 | 101 | PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam | 86.88 | |
| cd02996 | 108 | PDI_a_ERp44 PDIa family, endoplasmic reticulum pro | 86.84 | |
| cd02994 | 101 | PDI_a_TMX PDIa family, TMX subfamily; composed of | 86.72 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 86.71 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 86.67 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 86.58 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 86.54 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 86.42 | |
| cd02998 | 105 | PDI_a_ERp38 PDIa family, endoplasmic reticulum pro | 86.36 | |
| cd02959 | 117 | ERp19 Endoplasmic reticulum protein 19 (ERp19) fam | 86.27 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 86.16 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 86.01 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 85.84 | |
| cd03004 | 104 | PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam | 85.84 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 85.8 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 85.73 | |
| COG0178 | 935 | UvrA Excinuclease ATPase subunit [DNA replication, | 85.7 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 85.58 | |
| cd02987 | 175 | Phd_like_Phd Phosducin (Phd)-like family, Phd subf | 85.56 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 85.44 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 85.43 | |
| cd02948 | 102 | TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus | 85.35 | |
| KOG0910 | 150 | consensus Thioredoxin-like protein [Posttranslatio | 85.16 | |
| cd03078 | 73 | GST_N_Metaxin1_like GST_N family, Metaxin subfamil | 85.08 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 84.99 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 84.88 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 84.82 | |
| KOG1422 | 221 | consensus Intracellular Cl- channel CLIC, contains | 84.79 | |
| cd03001 | 103 | PDI_a_P5 PDIa family, P5 subfamily; composed of eu | 84.44 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 84.22 | |
| PF13901 | 202 | DUF4206: Domain of unknown function (DUF4206) | 84.19 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 83.65 | |
| cd02972 | 98 | DsbA_family DsbA family; consists of DsbA and DsbA | 83.59 | |
| cd02999 | 100 | PDI_a_ERp44_like PDIa family, endoplasmic reticulu | 83.59 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 83.58 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 83.42 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 83.28 | |
| PF00684 | 66 | DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 | 82.83 | |
| cd03002 | 109 | PDI_a_MPD1_like PDI family, MPD1-like subfamily; c | 82.75 | |
| cd03065 | 120 | PDI_b_Calsequestrin_N PDIb family, Calsequestrin s | 82.13 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 81.91 | |
| cd03005 | 102 | PDI_a_ERp46 PDIa family, endoplasmic reticulum pro | 81.49 | |
| cd02962 | 152 | TMX2 TMX2 family; composed of proteins similar to | 81.36 | |
| TIGR02642 | 186 | phage_xxxx uncharacterized phage protein. This unc | 81.29 | |
| PRK13972 | 215 | GSH-dependent disulfide bond oxidoreductase; Provi | 81.21 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 80.77 | |
| cd03079 | 74 | GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me | 80.73 | |
| PRK10357 | 202 | putative glutathione S-transferase; Provisional | 80.68 | |
| cd02963 | 111 | TRX_DnaJ TRX domain, DnaJ domain containing protei | 80.41 | |
| cd02952 | 119 | TRP14_like Human TRX-related protein 14 (TRP14)-li | 80.18 | |
| cd02988 | 192 | Phd_like_VIAF Phosducin (Phd)-like family, Viral i | 80.05 | |
| cd02997 | 104 | PDI_a_PDIR PDIa family, PDIR subfamily; composed o | 80.01 |
| >KOG2824 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.5e-52 Score=401.13 Aligned_cols=159 Identities=56% Similarity=1.025 Sum_probs=151.4
Q ss_pred ChhhhhhhcCCCCCCCcEEEEEecCCCCCCCCchHHHHHHHHHhCCCcEEEEEcCCCHHHHHHHHHHhCC---CCCCcEE
Q 039216 235 NPLLNFELKCPPGGDESVIFYTTTLRGIRKTFEDCSSVRFLLESFKVIFFERDVSMHIEFREELWKVLDC---KAVPPRL 311 (394)
Q Consensus 235 d~L~~f~~~cppgge~kVVLYTTSLrgIRkTCpdCkrVR~ILes~gV~yeErDVSmD~e~reELkellGg---~~tVPqV 311 (394)
.++..|..+||||++.+||||||||||||+||++|+.||+||++++|.|+|||||||..|++||++++|. ..++|+|
T Consensus 116 ~~~~e~~~~~~Pgge~~VVvY~TsLRgvRkTfE~C~~VR~ilesf~V~v~ERDVSMd~~fr~EL~~~lg~~~~~~~LPrV 195 (281)
T KOG2824|consen 116 KLLLEFKEVCPPGGEDRVVVYTTSLRGVRKTFEDCNAVRAILESFRVKVDERDVSMDSEFREELQELLGEDEKAVSLPRV 195 (281)
T ss_pred cchhhhhhcCCCCCCceEEEEEcccchhhhhHHHHHHHHHHHHhCceEEEEecccccHHHHHHHHHHHhcccccCccCeE
Confidence 4677999999999999999999999999999999999999999999999999999999999999999986 6889999
Q ss_pred EECCEEEecchhHHhHHHcCCchhhhccCCCCCCCCCCCCCCCcceeeCCCCCCcceeee---CCCccccCcccccCccc
Q 039216 312 FIKGRYIGGAAEVLTLHEQGKLRPLFDGIPIDRSDGPCDGCAGVRFVLCFRCCGSHKVVT---GDGLASQCQECNENGLI 388 (394)
Q Consensus 312 FIdGkyIGGaDEL~eL~EsGeL~kLLk~~~~~~~~~~C~~CGG~RfVpC~~C~GS~K~~~---~~~~~lRC~~CNENGLi 388 (394)
||+|+||||+++|++|||.|+|.+||+++| ..+...|.+|||.||+||..||||||++. .+++++||+.|||||||
T Consensus 196 FV~GryIGgaeeV~~LnE~GkL~~lL~~~p-~~~~~~C~~CGg~rFlpC~~C~GS~kv~~~~~~~~~~~rC~~CNENGLv 274 (281)
T KOG2824|consen 196 FVKGRYIGGAEEVVRLNEEGKLGKLLKGIP-CEGGGVCESCGGARFLPCSNCHGSCKVHEEEEDDGGVLRCLECNENGLV 274 (281)
T ss_pred EEccEEeccHHHhhhhhhcchHHHHHhcCC-CCCCCcCCCcCCcceEecCCCCCceeeeeeccCCCcEEECcccCCCCce
Confidence 999999999999999999999999999999 44567999999999999999999999998 45689999999999999
Q ss_pred cCCCCC
Q 039216 389 ICPYCC 394 (394)
Q Consensus 389 rCp~C~ 394 (394)
|||+|+
T Consensus 275 rCp~Cs 280 (281)
T KOG2824|consen 275 RCPVCS 280 (281)
T ss_pred eCCccC
Confidence 999997
|
|
| >cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs | Back alignment and domain information |
|---|
| >cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >PRK10824 glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >PHA03050 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR02181 GRX_bact Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02183 GRXA Glutaredoxin, GrxA family | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >PRK11200 grxA glutaredoxin 1; Provisional | Back alignment and domain information |
|---|
| >PF04908 SH3BGR: SH3-binding, glutamic acid-rich protein; InterPro: IPR006993 This family of proteins, which contains SH3BGRL3, is functionally uncharacterised | Back alignment and domain information |
|---|
| >PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH | Back alignment and domain information |
|---|
| >PRK10329 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >TIGR02200 GlrX_actino Glutaredoxin-like protein | Back alignment and domain information |
|---|
| >cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) | Back alignment and domain information |
|---|
| >cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins | Back alignment and domain information |
|---|
| >KOG4023 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx | Back alignment and domain information |
|---|
| >cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs | Back alignment and domain information |
|---|
| >PRK01655 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A | Back alignment and domain information |
|---|
| >TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 | Back alignment and domain information |
|---|
| >PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family | Back alignment and domain information |
|---|
| >cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes | Back alignment and domain information |
|---|
| >PRK13344 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >PRK12559 transcriptional regulator Spx; Provisional | Back alignment and domain information |
|---|
| >cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >PHA02125 thioredoxin-like protein | Back alignment and domain information |
|---|
| >cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >PLN03165 chaperone protein dnaJ-related; Provisional | Back alignment and domain information |
|---|
| >PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B | Back alignment and domain information |
|---|
| >cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 | Back alignment and domain information |
|---|
| >KOG3029 consensus Glutathione S-transferase-related protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins | Back alignment and domain information |
|---|
| >cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha | Back alignment and domain information |
|---|
| >cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >PRK10387 glutaredoxin 2; Provisional | Back alignment and domain information |
|---|
| >cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold | Back alignment and domain information |
|---|
| >TIGR02182 GRXB Glutaredoxin, GrxB family | Back alignment and domain information |
|---|
| >cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli | Back alignment and domain information |
|---|
| >cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding | Back alignment and domain information |
|---|
| >cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains | Back alignment and domain information |
|---|
| >TIGR00014 arsC arsenate reductase (glutaredoxin) | Back alignment and domain information |
|---|
| >COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs | Back alignment and domain information |
|---|
| >cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >PRK10853 putative reductase; Provisional | Back alignment and domain information |
|---|
| >PRK10026 arsenate reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01616 nitro_assoc nitrogenase-associated protein | Back alignment and domain information |
|---|
| >cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD | Back alignment and domain information |
|---|
| >cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative | Back alignment and domain information |
|---|
| >PRK09481 sspA stringent starvation protein A; Provisional | Back alignment and domain information |
|---|
| >COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains | Back alignment and domain information |
|---|
| >cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >TIGR00862 O-ClC intracellular chloride channel protein | Back alignment and domain information |
|---|
| >PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] | Back alignment and domain information |
|---|
| >PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B | Back alignment and domain information |
|---|
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >KOG2813 consensus Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif | Back alignment and domain information |
|---|
| >PTZ00051 thioredoxin; Provisional | Back alignment and domain information |
|---|
| >PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PHA02278 thioredoxin-like protein | Back alignment and domain information |
|---|
| >TIGR01068 thioredoxin thioredoxin | Back alignment and domain information |
|---|
| >cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions | Back alignment and domain information |
|---|
| >cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein | Back alignment and domain information |
|---|
| >PRK15113 glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01262 maiA maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms | Back alignment and domain information |
|---|
| >cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0406 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10877 protein disulfide isomerase II DsbC; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PRK09381 trxA thioredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PLN02378 glutathione S-transferase DHAR1 | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PLN02473 glutathione S-transferase | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PLN02817 glutathione dehydrogenase (ascorbate) | Back alignment and domain information |
|---|
| >cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO | Back alignment and domain information |
|---|
| >PRK10996 thioredoxin 2; Provisional | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR01126 pdi_dom protein disulfide-isomerase domain | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 | Back alignment and domain information |
|---|
| >cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein | Back alignment and domain information |
|---|
| >KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PF13901 DUF4206: Domain of unknown function (DUF4206) | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins | Back alignment and domain information |
|---|
| >cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation | Back alignment and domain information |
|---|
| >cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein | Back alignment and domain information |
|---|
| >cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains | Back alignment and domain information |
|---|
| >cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library | Back alignment and domain information |
|---|
| >TIGR02642 phage_xxxx uncharacterized phage protein | Back alignment and domain information |
|---|
| >PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
| >PRK10357 putative glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain | Back alignment and domain information |
|---|
| >cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 | Back alignment and domain information |
|---|
| >cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis | Back alignment and domain information |
|---|
| >cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 394 | ||||
| 2fls_A | 132 | Crystal Structure Of Human Glutaredoxin 2 Complexed | 4e-05 | ||
| 2cq9_A | 130 | Solution Structure Of Rsgi Ruh-044, An N-Terminal D | 6e-05 | ||
| 2ht9_A | 146 | The Structure Of Dimeric Human Glutaredoxin 2 Lengt | 7e-05 |
| >pdb|2FLS|A Chain A, Crystal Structure Of Human Glutaredoxin 2 Complexed With Glutathione Length = 132 | Back alignment and structure |
|
| >pdb|2CQ9|A Chain A, Solution Structure Of Rsgi Ruh-044, An N-Terminal Domain Of Glutaredoxin 2 From Human Cdna Length = 130 | Back alignment and structure |
| >pdb|2HT9|A Chain A, The Structure Of Dimeric Human Glutaredoxin 2 Length = 146 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 394 | |||
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 4e-23 | |
| 1u6t_A | 121 | SH3 domain-binding glutamic acid-rich-like protein | 1e-19 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 5e-18 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 4e-07 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 9e-07 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 1e-06 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 2e-06 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 2e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-06 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 4e-06 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 6e-06 | |
| 3l4n_A | 127 | Monothiol glutaredoxin-6; C-terminal domain of GRX | 6e-06 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 9e-06 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 9e-05 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 1e-04 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 1e-04 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 1e-04 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 2e-04 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 4e-04 | |
| 2jad_A | 362 | Yellow fluorescent protein glutaredoxin fusion pro | 4e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-04 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 6e-04 |
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Length = 93 | Back alignment and structure |
|---|
Score = 91.8 bits (228), Expect = 4e-23
Identities = 20/88 (22%), Positives = 38/88 (43%), Gaps = 1/88 (1%)
Query: 251 SVIFYTTTLRGIRKTFEDCSSVRFLLESFKVIFFERDVSMHIEFREELW-KVLDCKAVPP 309
+ Y+T++ G R+ S V +L+ ++ + D+S R+E+ + KA PP
Sbjct: 3 GLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRTLAGNPKATPP 62
Query: 310 RLFIKGRYIGGAAEVLTLHEQGKLRPLF 337
++ Y G + EQ L+
Sbjct: 63 QIVNGNHYCGDYELFVEAVEQDTLQEFL 90
|
| >1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Length = 121 | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Length = 116 | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Length = 92 | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Length = 82 | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Length = 113 | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} Length = 99 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Length = 146 | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 130 | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Length = 127 | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Length = 503 | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Length = 129 | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Length = 89 | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Length = 118 | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Length = 105 | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Length = 114 | Back alignment and structure |
|---|
| >2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Length = 362 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 394 | |||
| 2wul_A | 118 | Glutaredoxin related protein 5; chromosome 14 open | 99.84 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 99.84 | |
| 1u6t_A | 121 | SH3 domain-binding glutamic acid-rich-like protein | 99.83 | |
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 99.82 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 99.82 | |
| 3gx8_A | 121 | Monothiol glutaredoxin-5, mitochondrial; TRX fold, | 99.81 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 99.81 | |
| 3l4n_A | 127 | Monothiol glutaredoxin-6; C-terminal domain of GRX | 99.81 | |
| 2wem_A | 118 | Glutaredoxin-related protein 5; chromosome 14 open | 99.81 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 99.79 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 99.78 | |
| 2wci_A | 135 | Glutaredoxin-4; redox-active center, iron-sulfur c | 99.78 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 99.78 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 99.77 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 99.75 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 99.69 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 99.67 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 99.67 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 99.66 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 99.66 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 99.65 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 99.63 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 99.59 | |
| 2jad_A | 362 | Yellow fluorescent protein glutaredoxin fusion pro | 99.58 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 99.58 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 99.55 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 99.53 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 99.52 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 99.32 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 99.32 | |
| 3nzn_A | 103 | Glutaredoxin; structural genomics, PSI2, MCSG, pro | 99.29 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 99.28 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 99.23 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 99.14 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 99.13 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 99.11 | |
| 2k8s_A | 80 | Thioredoxin; dimer, structural genomics, PSI-2, pr | 98.8 | |
| 1ttz_A | 87 | Conserved hypothetical protein; structural genomic | 98.66 | |
| 1wjk_A | 100 | C330018D20RIK protein; glutaredoxin, thioredoxin f | 98.6 | |
| 2fgx_A | 107 | Putative thioredoxin; NET3, NESG, GFT-glutaredoxin | 98.47 | |
| 1z3e_A | 132 | Regulatory protein SPX; bacterial transcription re | 98.28 | |
| 1rw1_A | 114 | Conserved hypothetical protein YFFB; thioredoxin f | 98.22 | |
| 2axo_A | 270 | Hypothetical protein ATU2684; alpha beta protein., | 98.18 | |
| 2kok_A | 120 | Arsenate reductase; brucellosis, zoonotic, oxidore | 98.16 | |
| 3l78_A | 120 | Regulatory protein SPX; transcription, transcripti | 97.63 | |
| 3gkx_A | 120 | Putative ARSC family related protein; ARSC family | 97.55 | |
| 1s3c_A | 141 | Arsenate reductase; ARSC, arsenite, oxidoreductase | 97.54 | |
| 3fz4_A | 120 | Putative arsenate reductase; APC61768, structural | 97.48 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 97.47 | |
| 3rdw_A | 121 | Putative arsenate reductase; structural genomics, | 97.47 | |
| 3kp8_A | 106 | Vkorc1/thioredoxin domain protein; blood coagulati | 97.32 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 97.22 | |
| 3f0i_A | 119 | Arsenate reductase; structural genomics, IDP01300, | 97.15 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 97.01 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 96.92 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 96.77 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 96.77 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 96.76 | |
| 3kp9_A | 291 | Vkorc1/thioredoxin domain protein; warfarin, disul | 96.75 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 96.74 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 96.66 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 96.61 | |
| 4hoj_A | 210 | REGF protein; GST, glutathione S-transferase, enzy | 96.57 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 96.57 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 96.51 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 96.5 | |
| 3gyk_A | 175 | 27KDA outer membrane protein; APC61738.2, siliciba | 96.5 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 96.44 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 96.44 | |
| 4g10_A | 265 | Glutathione S-transferase homolog; thioredoxin fol | 96.41 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 96.38 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 96.37 | |
| 2e0q_A | 104 | Thioredoxin; electron transport; 1.49A {Sulfolobus | 96.34 | |
| 4hi7_A | 228 | GI20122; GST, glutathione S-transferase, enzyme fu | 96.32 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 96.3 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 96.3 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 96.28 | |
| 2yzu_A | 109 | Thioredoxin; redox protein, electron transport, st | 96.27 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 96.26 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 96.25 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 96.23 | |
| 1thx_A | 115 | Thioredoxin, thioredoxin 2; oxido-reductase, elect | 96.23 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 96.22 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 96.22 | |
| 3m9j_A | 105 | Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} | 96.22 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 96.22 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 96.21 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 96.2 | |
| 2vm1_A | 118 | Thioredoxin, thioredoxin H isoform 1.; oxidoreduct | 96.18 | |
| 1ep7_A | 112 | Thioredoxin CH1, H-type; electron transport; 2.10A | 96.18 | |
| 1fb6_A | 105 | Thioredoxin M; electron transport; 2.10A {Spinacia | 96.16 | |
| 2oe3_A | 114 | Thioredoxin-3; electron transport, alpha/beta sand | 96.15 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 96.15 | |
| 3d6i_A | 112 | Monothiol glutaredoxin-3; thioredoxin-like, electr | 96.15 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 96.13 | |
| 1w4v_A | 119 | Thioredoxin, mitochondrial; antioxidant enzyme, mi | 96.12 | |
| 2vim_A | 104 | Thioredoxin, TRX; thioredoxin fold, oxidoreductase | 96.11 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 96.1 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 96.09 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 96.07 | |
| 1dby_A | 107 | Chloroplast thioredoxin M CH2; thioredoxin CH2, ch | 96.07 | |
| 2i4a_A | 107 | Thioredoxin; acidophIle, disulfide exchange, oxido | 96.06 | |
| 1nsw_A | 105 | Thioredoxin, TRX; thermostability, electron transp | 96.06 | |
| 2xc2_A | 117 | Thioredoxinn; oxidoreductase, protein disulfide re | 96.02 | |
| 1ti3_A | 113 | Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul | 96.02 | |
| 4iel_A | 229 | Glutathione S-transferase, N-terminal domain PROT; | 96.01 | |
| 1syr_A | 112 | Thioredoxin; SGPP, structural genomics, PSI, prote | 96.01 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 95.96 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 95.94 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 95.92 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 95.92 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 95.9 | |
| 2vlu_A | 122 | Thioredoxin, thioredoxin H isoform 2.; oxidoreduct | 95.88 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 95.88 | |
| 1xfl_A | 124 | Thioredoxin H1; AT3G51030, structural genomics, pr | 95.88 | |
| 1xwb_A | 106 | Thioredoxin; dimerization, redox regulation, THI X | 95.87 | |
| 2i1u_A | 121 | Thioredoxin, TRX, MPT46; redox protein, electron t | 95.86 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 95.83 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 95.83 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 95.83 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 95.82 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 95.8 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 95.8 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 95.79 | |
| 1t00_A | 112 | Thioredoxin, TRX; redox regulation, multifunction | 95.79 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 95.77 | |
| 3gnj_A | 111 | Thioredoxin domain protein; APC92103, STR genomics | 95.77 | |
| 1z9h_A | 290 | Membrane-associated prostaglandin E synthase-2; me | 95.76 | |
| 1gh2_A | 107 | Thioredoxin-like protein; redox-active center, ele | 95.75 | |
| 1faa_A | 124 | Thioredoxin F; electron transport; 1.85A {Spinacia | 95.73 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 95.71 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 95.71 | |
| 1eej_A | 216 | Thiol:disulfide interchange protein; oxidoreductas | 95.71 | |
| 2trx_A | 108 | Thioredoxin; electron transport; 1.68A {Escherichi | 95.7 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 95.66 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 95.62 | |
| 1ilo_A | 77 | Conserved hypothetical protein MTH895; beta-alpha- | 95.61 | |
| 3cxg_A | 133 | Putative thioredoxin; malaria, structural GEN oxid | 95.6 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 95.6 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 95.58 | |
| 3die_A | 106 | Thioredoxin, TRX; electron transport, SWAP domain, | 95.55 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 95.54 | |
| 1r26_A | 125 | Thioredoxin; redox-active disulfide, electron tran | 95.53 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 95.51 | |
| 3f3q_A | 109 | Thioredoxin-1; His TAG, electron transport, cytopl | 95.49 | |
| 4euy_A | 105 | Uncharacterized protein; structural genomics, PSI- | 95.48 | |
| 2pu9_C | 111 | TRX-F, thioredoxin F-type, chloroplast; protein-pr | 95.46 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 95.43 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 95.43 | |
| 2l57_A | 126 | Uncharacterized protein; structural genomics, unkn | 95.43 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 95.42 | |
| 3uvt_A | 111 | Thioredoxin domain-containing protein 5; thioredox | 95.4 | |
| 1t3b_A | 211 | Thiol:disulfide interchange protein DSBC; oxidored | 95.4 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 95.37 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 95.37 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 95.33 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 95.33 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 95.32 | |
| 3tco_A | 109 | Thioredoxin (TRXA-1); disulfide oxidoreductase, ox | 95.25 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 95.23 | |
| 3hz4_A | 140 | Thioredoxin; NYSGXRC, PSI-II, reduced form, protei | 95.21 | |
| 3vk9_A | 216 | Glutathione S-transferase delta; glutathione bindi | 95.21 | |
| 4hz2_A | 230 | Glutathione S-transferase domain; glutathione,enzy | 95.16 | |
| 1v98_A | 140 | Thioredoxin; oxidoreductase, structural genomics, | 95.15 | |
| 2f51_A | 118 | Thioredoxin; electron transport; 1.90A {Trichomona | 95.15 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 95.15 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 95.15 | |
| 3qfa_C | 116 | Thioredoxin; protein-protein complex, rossmann fol | 95.14 | |
| 2voc_A | 112 | Thioredoxin; electron transport, homodimer, disulf | 95.14 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 94.98 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 94.96 | |
| 3iv4_A | 112 | Putative oxidoreductase; APC23140, meticillin-resi | 94.94 | |
| 1zma_A | 118 | Bacterocin transport accessory protein; alpha-beta | 94.91 | |
| 2j23_A | 121 | Thioredoxin; immune protein, autoreactivity, cross | 94.87 | |
| 4glt_A | 225 | Glutathione S-transferase-like protein; structural | 94.86 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 94.75 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 94.75 | |
| 3d22_A | 139 | TRXH4, thioredoxin H-type; electron transport, cyt | 94.7 | |
| 4f03_A | 253 | Glutathione transferase; GST fold; 1.80A {Phaneroc | 94.68 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 94.62 | |
| 4ikh_A | 244 | Glutathione S-transferase; enzyme function initiat | 94.6 | |
| 1x5e_A | 126 | Thioredoxin domain containing protein 1; TMX, TXND | 94.59 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 94.58 | |
| 1z6m_A | 175 | Conserved hypothetical protein; structural genomic | 94.5 | |
| 3ul3_B | 128 | Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; | 94.37 | |
| 1exk_A | 79 | DNAJ protein; extended beta-hairpin, CXXCXGXG, zin | 94.37 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 94.3 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 94.25 | |
| 3p2a_A | 148 | Thioredoxin 2, putative thioredoxin-like protein; | 94.25 | |
| 1x5d_A | 133 | Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC | 94.23 | |
| 3aps_A | 122 | DNAJ homolog subfamily C member 10; thioredoxin fo | 94.18 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 94.16 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 94.01 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 93.99 | |
| 2o8v_B | 128 | Thioredoxin 1; disulfide crosslinked complex, oxid | 93.98 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 93.89 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 93.88 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 93.87 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 93.83 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 93.82 | |
| 1mek_A | 120 | Protein disulfide isomerase; electron transport, r | 93.79 | |
| 3fk8_A | 133 | Disulphide isomerase; APC61824.1, xylella fastidio | 93.77 | |
| 3c8e_A | 288 | YGHU, glutathione S-transferase homologue; glutath | 93.66 | |
| 1v58_A | 241 | Thiol:disulfide interchange protein DSBG; reduced | 93.61 | |
| 2l5l_A | 136 | Thioredoxin; structural genomics, electron transpo | 93.57 | |
| 2ppt_A | 155 | Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc | 93.48 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 93.46 | |
| 3hxs_A | 141 | Thioredoxin, TRXP; electron transport; 2.00A {Bact | 93.43 | |
| 2ctt_A | 104 | DNAJ homolog subfamily A member 3; ZING finger, be | 93.38 | |
| 2dj1_A | 140 | Protein disulfide-isomerase A4; protein ERP-72, ER | 93.38 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 93.34 | |
| 2yj7_A | 106 | LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti | 92.45 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 93.16 | |
| 2fwh_A | 134 | Thiol:disulfide interchange protein DSBD; thioredo | 92.74 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 92.64 | |
| 1zzo_A | 136 | RV1677; thioredoxin fold, structural genomics, PSI | 92.39 | |
| 4hz4_A | 217 | Glutathione-S-transferase; enzyme function initiat | 92.36 | |
| 1wou_A | 123 | Thioredoxin -related protein, 14 kDa; electron tra | 92.34 | |
| 3h79_A | 127 | Thioredoxin-like protein; thioredoxin fold, cataly | 92.28 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 92.22 | |
| 4ecj_A | 244 | Glutathione S-transferase; transferase-like protei | 92.22 | |
| 2ju5_A | 154 | Thioredoxin disulfide isomerase; protein, oxidored | 92.11 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 92.11 | |
| 3zzx_A | 105 | Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va | 92.1 | |
| 3emx_A | 135 | Thioredoxin; structural genomics, oxidoreductase, | 91.9 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 91.65 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 91.46 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 91.28 | |
| 2dml_A | 130 | Protein disulfide-isomerase A6; thioredoxin domain | 91.15 | |
| 2kuc_A | 130 | Putative disulphide-isomerase; structural genomics | 91.12 | |
| 4id0_A | 214 | Glutathione S-transferase-like protein YIBF; GST, | 91.09 | |
| 1lu4_A | 136 | Soluble secreted antigen MPT53; thioredoxin-like f | 91.04 | |
| 2dj0_A | 137 | Thioredoxin-related transmembrane protein 2; AVLA2 | 90.98 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 90.68 | |
| 3hd5_A | 195 | Thiol:disulfide interchange protein DSBA; protein | 90.43 | |
| 2rem_A | 193 | Disulfide oxidoreductase; disulfide oxidoreductase | 90.36 | |
| 3gv1_A | 147 | Disulfide interchange protein; neisseria gonorrhoe | 90.33 | |
| 2dj3_A | 133 | Protein disulfide-isomerase A4; protein ERP-72, ER | 90.25 | |
| 4gf0_A | 215 | Glutathione S-transferase; GST, enzyme function in | 90.24 | |
| 2znm_A | 195 | Thiol:disulfide interchange protein DSBA; thioredo | 89.82 | |
| 2f9s_A | 151 | Thiol-disulfide oxidoreductase RESA; thioredoxin-l | 89.8 | |
| 3h93_A | 192 | Thiol:disulfide interchange protein DSBA; disulfid | 89.64 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 89.4 | |
| 1wmj_A | 130 | Thioredoxin H-type; structural genomics, program f | 89.17 | |
| 1nlt_A | 248 | Protein YDJ1, mitochondrial protein import protein | 89.08 | |
| 1kng_A | 156 | Thiol:disulfide interchange protein CYCY; thioredo | 89.02 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 88.35 | |
| 3ppu_A | 352 | Glutathione-S-transferase; GST fold; HET: GSH; 2.3 | 88.32 | |
| 3or5_A | 165 | Thiol:disulfide interchange protein, thioredoxin p | 88.17 | |
| 3ha9_A | 165 | Uncharacterized thioredoxin-like protein; PSI, MCS | 88.11 | |
| 2djj_A | 121 | PDI, protein disulfide-isomerase; thioredoxin fold | 88.09 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 87.94 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 87.92 | |
| 1qgv_A | 142 | Spliceosomal protein U5-15KD; snRNP, thioredoxin, | 87.9 | |
| 2lrn_A | 152 | Thiol:disulfide interchange protein; structural ge | 87.8 | |
| 2lst_A | 130 | Thioredoxin; structural genomics, NEW YORK structu | 87.57 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 87.66 | |
| 3gix_A | 149 | Thioredoxin-like protein 4B; PRE-mRNA splicing, TX | 87.58 | |
| 3ewl_A | 142 | Uncharacterized conserved protein BF1870; alpha-be | 87.57 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 87.29 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 87.2 | |
| 1o73_A | 144 | Tryparedoxin; electron transport, trypanosomatid, | 86.6 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 86.57 | |
| 3gha_A | 202 | Disulfide bond formation protein D; BDBD, DSBA-lik | 86.31 | |
| 1i5g_A | 144 | Tryparedoxin II; electron transport; HET: TS5; 1.4 | 86.16 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 85.85 | |
| 2lja_A | 152 | Putative thiol-disulfide oxidoreductase; structura | 85.55 | |
| 3lcz_A | 53 | YCZA, inhibitor of trap, regulated by T-box (Trp) | 85.55 | |
| 1o8x_A | 146 | Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot | 85.42 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 85.41 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 84.9 | |
| 2b5x_A | 148 | YKUV protein, TRXY; thioredoxin-like, oxidoreducta | 83.59 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 83.54 | |
| 1oaz_A | 123 | Thioredoxin 1; immune system, antibody/complex, an | 83.46 | |
| 3fkf_A | 148 | Thiol-disulfide oxidoreductase; structural genomic | 82.92 | |
| 1z6n_A | 167 | Hypothetical protein PA1234; alpha-beta-alpha sand | 82.58 | |
| 2trc_P | 217 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 82.03 | |
| 3eur_A | 142 | Uncharacterized protein; PSI2,MCSG, conserved prot | 81.89 | |
| 3lcz_A | 53 | YCZA, inhibitor of trap, regulated by T-box (Trp) | 81.61 | |
| 3m1g_A | 362 | Putative glutathione S-transferase; ECM4-like subf | 81.45 | |
| 3hcz_A | 148 | Possible thiol-disulfide isomerase; APC61559.2, cy | 81.34 | |
| 3ia1_A | 154 | THIO-disulfide isomerase/thioredoxin; oxidoreducta | 81.11 | |
| 3gl3_A | 152 | Putative thiol:disulfide interchange protein DSBE; | 80.55 | |
| 2av4_A | 160 | Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI | 80.4 |
| >2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.84 E-value=4e-21 Score=164.14 Aligned_cols=93 Identities=17% Similarity=0.304 Sum_probs=84.0
Q ss_pred CCCcEEEEEecCCCCCCCCchHHHHHHHHHhCCC-cEEEEEcCCCHHHHHHHHHHhCCCCCCcEEEECCEEEecchhHHh
Q 039216 248 GDESVIFYTTTLRGIRKTFEDCSSVRFLLESFKV-IFFERDVSMHIEFREELWKVLDCKAVPPRLFIKGRYIGGAAEVLT 326 (394)
Q Consensus 248 ge~kVVLYTTSLrgIRkTCpdCkrVR~ILes~gV-~yeErDVSmD~e~reELkellGg~~tVPqVFIdGkyIGGaDEL~e 326 (394)
.+++||||+++.+ -...|+||.+|+++|..++| .|.++||..+++++++|++++| ++|+|||||+|+||||+|++++
T Consensus 18 ~~~~VvvF~Kgt~-~~P~C~fc~~ak~lL~~~gv~~~~~~~v~~~~~~r~~l~~~sg-~~TvPqIFI~g~~IGG~Ddl~~ 95 (118)
T 2wul_A 18 KKDKVVVFLKGTP-EQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSN-WPTIPQVYLNGEFVGGCDILLQ 95 (118)
T ss_dssp HHSSEEEEESBCS-SSBSSHHHHHHHHHHHHTTCCSCEEEETTSCHHHHHHHHHHHT-CCSSCEEEETTEEEECHHHHHH
T ss_pred hcCCEEEEEcCCC-CCCCCHHHHHHHHHHHHhCCcCeEeecccCCHHHHHHHHHhcc-CCCCCeEeECCEEECCHHHHHH
Confidence 4478999999842 12249999999999999999 5999999999999999999997 8999999999999999999999
Q ss_pred HHHcCCchhhhccCCC
Q 039216 327 LHEQGKLRPLFDGIPI 342 (394)
Q Consensus 327 L~EsGeL~kLLk~~~~ 342 (394)
||++|+|.++|+.+..
T Consensus 96 l~~~GeL~~lL~~~Gi 111 (118)
T 2wul_A 96 MHQNGDLVEELKKLGI 111 (118)
T ss_dssp HHHHTHHHHHHHHTTC
T ss_pred HHHCCCHHHHHHHcCC
Confidence 9999999999987654
|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A | Back alignment and structure |
|---|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B | Back alignment and structure |
|---|
| >2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A | Back alignment and structure |
|---|
| >1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A | Back alignment and structure |
|---|
| >1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 | Back alignment and structure |
|---|
| >2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} | Back alignment and structure |
|---|
| >3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A | Back alignment and structure |
|---|
| >3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} | Back alignment and structure |
|---|
| >3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* | Back alignment and structure |
|---|
| >3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* | Back alignment and structure |
|---|
| >4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* | Back alignment and structure |
|---|
| >4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} | Back alignment and structure |
|---|
| >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A | Back alignment and structure |
|---|
| >4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A | Back alignment and structure |
|---|
| >2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... | Back alignment and structure |
|---|
| >2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A | Back alignment and structure |
|---|
| >1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A | Back alignment and structure |
|---|
| >1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C | Back alignment and structure |
|---|
| >2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* | Back alignment and structure |
|---|
| >3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 | Back alignment and structure |
|---|
| >1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A | Back alignment and structure |
|---|
| >2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} | Back alignment and structure |
|---|
| >1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A | Back alignment and structure |
|---|
| >2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A | Back alignment and structure |
|---|
| >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* | Back alignment and structure |
|---|
| >2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A | Back alignment and structure |
|---|
| >2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* | Back alignment and structure |
|---|
| >3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* | Back alignment and structure |
|---|
| >1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* | Back alignment and structure |
|---|
| >1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A | Back alignment and structure |
|---|
| >2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* | Back alignment and structure |
|---|
| >1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B | Back alignment and structure |
|---|
| >4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} | Back alignment and structure |
|---|
| >2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* | Back alignment and structure |
|---|
| >3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A | Back alignment and structure |
|---|
| >1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* | Back alignment and structure |
|---|
| >3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* | Back alignment and structure |
|---|
| >3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} | Back alignment and structure |
|---|
| >4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* | Back alignment and structure |
|---|
| >2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* | Back alignment and structure |
|---|
| >3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A | Back alignment and structure |
|---|
| >4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} | Back alignment and structure |
|---|
| >1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* | Back alignment and structure |
|---|
| >1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} | Back alignment and structure |
|---|
| >1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* | Back alignment and structure |
|---|
| >2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A | Back alignment and structure |
|---|
| >1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 | Back alignment and structure |
|---|
| >3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A | Back alignment and structure |
|---|
| >2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A | Back alignment and structure |
|---|
| >2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 | Back alignment and structure |
|---|
| >2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* | Back alignment and structure |
|---|
| >2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* | Back alignment and structure |
|---|
| >1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A | Back alignment and structure |
|---|
| >4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} | Back alignment and structure |
|---|
| >1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A | Back alignment and structure |
|---|
| >3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* | Back alignment and structure |
|---|
| >4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* | Back alignment and structure |
|---|
| >2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... | Back alignment and structure |
|---|
| >3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} | Back alignment and structure |
|---|
| >3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* | Back alignment and structure |
|---|
| >1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* | Back alignment and structure |
|---|
| >3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} | Back alignment and structure |
|---|
| >2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A | Back alignment and structure |
|---|
| >2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A | Back alignment and structure |
|---|
| >3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* | Back alignment and structure |
|---|
| >1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 | Back alignment and structure |
|---|
| >1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* | Back alignment and structure |
|---|
| >3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} | Back alignment and structure |
|---|
| >3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A | Back alignment and structure |
|---|
| >2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} | Back alignment and structure |
|---|
| >2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A | Back alignment and structure |
|---|
| >3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* | Back alignment and structure |
|---|
| >3gha_A Disulfide bond formation protein D; BDBD, DSBA-like, TRX-like, oxidoreductase, competence, redox-active center; 1.40A {Bacillus subtilis} PDB: 3eu4_A 3gh9_A 3eu3_A | Back alignment and structure |
|---|
| >1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* | Back alignment and structure |
|---|
| >2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A | Back alignment and structure |
|---|
| >1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A | Back alignment and structure |
|---|
| >2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 | Back alignment and structure |
|---|
| >3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A | Back alignment and structure |
|---|
| >3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 394 | ||||
| d1t1va_ | 93 | c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [Tax | 5e-19 | |
| d1wika_ | 109 | c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (M | 6e-10 | |
| d1fova_ | 82 | c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) | 1e-09 | |
| d1ktea_ | 105 | c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) | 5e-07 | |
| d1egoa_ | 85 | c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) | 0.003 |
| >d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 93 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: SH3BGR (SH3-binding, glutamic acid-rich protein-like) domain: SH3BGRL3 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 79.2 bits (195), Expect = 5e-19
Identities = 18/88 (20%), Positives = 36/88 (40%), Gaps = 1/88 (1%)
Query: 251 SVIFYTTTLRGIRKTFEDCSSVRFLLESFKVIFFERDVSMHIEFREELWKVLDCKAV-PP 309
+ Y+T++ G R+ S V +L+ ++ + D+S R+E+ + PP
Sbjct: 3 GLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRTLAGNPKATPP 62
Query: 310 RLFIKGRYIGGAAEVLTLHEQGKLRPLF 337
++ Y G + EQ L+
Sbjct: 63 QIVNGNHYCGDYELFVEAVEQDTLQEFL 90
|
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Length = 82 | Back information, alignment and structure |
|---|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 105 | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Length = 85 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 394 | |||
| d1t1va_ | 93 | SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | 99.86 | |
| d1fova_ | 82 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 99.86 | |
| d1wika_ | 109 | Thioredoxin-like protein 2 {Mouse (Mus musculus) [ | 99.83 | |
| d1ktea_ | 105 | Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr | 99.8 | |
| d1nm3a1 | 74 | C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus | 99.66 | |
| d1r7ha_ | 74 | Glutaredoxin-like NRDH-redoxin {Corynebacterium am | 99.61 | |
| d1egoa_ | 85 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 99.61 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 99.6 | |
| d1abaa_ | 87 | Glutaredoxin (Grx, thioltransferase) {Bacteriophag | 99.5 | |
| d1wjka_ | 100 | Thioredoxin-like structure containing protein C330 | 98.42 | |
| d1ttza_ | 75 | Hypothetical protein XCC2852 {Xanthomonas campestr | 98.3 | |
| d1hyua4 | 96 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 98.06 | |
| d1g7oa2 | 75 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 97.96 | |
| d1gwca2 | 83 | Class tau GST {Aegilops tauschii, also known as Tr | 97.78 | |
| d1oyja2 | 84 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 97.77 | |
| d1eema2 | 98 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 97.56 | |
| d1e6ba2 | 80 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 97.5 | |
| d1v2aa2 | 83 | Class delta GST {Mosquito (Anopheles dirus b), iso | 97.46 | |
| d1k0ma2 | 86 | Chloride intracellular channel 1 (clic1) {Human (H | 97.41 | |
| d1z9ha2 | 113 | Microsomal prostaglandin E synthase-2 {Crab-eating | 97.35 | |
| d1k0da2 | 92 | Yeast prion protein ure2p, nitrogen regulation fra | 97.05 | |
| d1aw9a2 | 81 | Class phi GST {Maize (Zea mays), type III [TaxId: | 97.02 | |
| d1r5aa2 | 85 | Class delta GST {Mosquito (Anopheles dirus b), iso | 96.89 | |
| d1fw1a2 | 83 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 96.85 | |
| d1axda2 | 80 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 96.79 | |
| d1ljra2 | 79 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 96.69 | |
| d1nhoa_ | 85 | MTH807, thioredoxin/glutaredoxin-like protein {Arc | 96.45 | |
| d1gnwa2 | 84 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 96.36 | |
| d1z3ea1 | 114 | Regulatory protein Spx {Bacillus subtilis [TaxId: | 96.16 | |
| d1a8la2 | 107 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 96.11 | |
| d1jlva2 | 84 | Class delta GST {Mosquito (Anopheles dirus b), iso | 95.96 | |
| d1rw1a_ | 114 | Hypothetical protein PA3664 (YffB) {Pseudomonas ae | 95.9 | |
| d2a2ra2 | 77 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 95.53 | |
| d1thxa_ | 108 | Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | 95.3 | |
| d1nlta3 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 95.03 | |
| d1exka_ | 79 | Cysteine-rich domain of the chaperone protein DnaJ | 94.84 | |
| d1eeja1 | 156 | Disulfide bond isomerase, DsbC, C-terminal domain | 94.46 | |
| d1ep7a_ | 112 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 94.25 | |
| d2cvda2 | 74 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 94.17 | |
| d1r26a_ | 113 | Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | 94.08 | |
| d1gula2 | 77 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 93.87 | |
| d1j9ba_ | 138 | Arsenate reductase ArsC {Escherichia coli [TaxId: | 93.68 | |
| d1xfla_ | 114 | Thioredoxin {Thale cress (Arabidopsis thaliana) [T | 93.65 | |
| d1t3ba1 | 150 | Disulfide bond isomerase, DsbC, C-terminal domain | 93.25 | |
| d1dbya_ | 107 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 93.25 | |
| d1syra_ | 103 | Thioredoxin {Malarial parasite (Plasmodium falcipa | 93.13 | |
| d1gh2a_ | 107 | Thioredoxin-like protein, N-terminal domain {Human | 92.96 | |
| d1fo5a_ | 85 | MJ0307, thioredoxin/glutaredoxin-like protein {Arc | 92.77 | |
| d2ifqa1 | 105 | Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | 92.69 | |
| d1nw2a_ | 105 | Thioredoxin {Alicyclobacillus acidocaldarius, form | 92.35 | |
| d1b48a2 | 78 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 92.31 | |
| d1ti3a_ | 113 | Thioredoxin {European aspen (Populus tremula), thi | 92.26 | |
| d1fb6a_ | 104 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 92.12 | |
| d1exka_ | 79 | Cysteine-rich domain of the chaperone protein DnaJ | 91.51 | |
| d1k3ya2 | 79 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 91.51 | |
| d1okta2 | 85 | Pf GST {Malarial parasite (Plasmodium falciparum) | 91.45 | |
| d1iloa_ | 77 | MTH985, a thioredoxin {Archaeon Methanobacterium t | 91.1 | |
| d1f9ma_ | 112 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 90.98 | |
| d1woua_ | 119 | Putative 42-9-9 protein (thioredoxin containing pr | 90.77 | |
| d2gsqa2 | 75 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 90.7 | |
| d1qgva_ | 137 | spliceosomal protein U5-15Kd {Human (Homo sapiens) | 90.51 | |
| d1zmaa1 | 115 | Bacterocin transport accessory protein Bta {Strept | 89.56 | |
| d1z6ma1 | 172 | Hypothetical protein EF0770 {Enterococcus faecalis | 89.47 | |
| d2trxa_ | 108 | Thioredoxin {Escherichia coli [TaxId: 562]} | 89.03 | |
| d1xwaa_ | 111 | Thioredoxin {Fruit fly (Drosophila melanogaster) [ | 88.65 | |
| d2b5ea4 | 119 | Protein disulfide isomerase, PDI {Baker's yeast (S | 87.86 | |
| d1nlta3 | 74 | Mitochondrial protein import protein mas5 (Hsp40, | 86.15 | |
| d1fhea2 | 80 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 85.92 | |
| d1m0ua2 | 76 | Class sigma GST {Fruit fly (Drosophila melanogaste | 85.75 | |
| d2c4ja2 | 84 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 84.27 | |
| d2fwha1 | 117 | Thiol:disulfide interchange protein DsbD, C-termin | 83.77 | |
| d1v58a1 | 169 | Thiol:disulfide interchange protein DsbG, C-termin | 83.66 | |
| d1duga2 | 80 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 83.41 | |
| d1tu7a2 | 77 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 83.37 | |
| d1tw9a2 | 77 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 80.51 |
| >d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: SH3BGR (SH3-binding, glutamic acid-rich protein-like) domain: SH3BGRL3 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.86 E-value=2.4e-22 Score=160.83 Aligned_cols=90 Identities=22% Similarity=0.341 Sum_probs=85.4
Q ss_pred CcEEEEEecCCCCCCCCchHHHHHHHHHhCCCcEEEEEcCCCHHHHHHHHHHhCC-CCCCcEEEECCEEEecchhHHhHH
Q 039216 250 ESVIFYTTTLRGIRKTFEDCSSVRFLLESFKVIFFERDVSMHIEFREELWKVLDC-KAVPPRLFIKGRYIGGAAEVLTLH 328 (394)
Q Consensus 250 ~kVVLYTTSLrgIRkTCpdCkrVR~ILes~gV~yeErDVSmD~e~reELkellGg-~~tVPqVFIdGkyIGGaDEL~eL~ 328 (394)
..|+||+||+.|+|++..+|.++++||++++|.|+++||+.|...++++.+++|. ..++|||||||+||||++++.+|+
T Consensus 2 ~~i~vy~ts~~~~~~~~~~~~r~~~lL~~~~I~y~~iDi~~d~~~~~~~~~~~g~~~~t~Pqifv~~~~iGg~del~~~~ 81 (93)
T d1t1va_ 2 SGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRTLAGNPKATPPQIVNGNHYCGDYELFVEAV 81 (93)
T ss_dssp CCEEEEECSSCSCHHHHHHHHHHHHHHHHTTCCCEEEETTSCHHHHHHHHHHTTCTTCCSCEEEETTEEEEEHHHHHHHH
T ss_pred CCEEEEEccCcCChhhHHHHHHHHHHHHHCCCceEEEEecCchhHHHHHHHhccCCCceeEEEEECCEEEecHHHHHHHH
Confidence 4699999999999999999999999999999999999999999999999999873 579999999999999999999999
Q ss_pred HcCCchhhhcc
Q 039216 329 EQGKLRPLFDG 339 (394)
Q Consensus 329 EsGeL~kLLk~ 339 (394)
++|+|.++|+.
T Consensus 82 e~g~L~~~lk~ 92 (93)
T d1t1va_ 82 EQDTLQEFLKL 92 (93)
T ss_dssp HTTCHHHHTTC
T ss_pred HCCCHHHHhcc
Confidence 99999999974
|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} | Back information, alignment and structure |
|---|
| >d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|