Citrus Sinensis ID: 039237

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MGSGERLVACGTCKNLIHEECWVTWKRSRGRRAASCVICRGRWRDNRTDQDKYLNLAAFVSQEDHHHQAAEDSGSRICGLEAVEEDNEIQVQVNFHDS
cccccEEEEccccccHHHHHHHHHHHHHcccccEEEEEEccccccccccccccEEHHHccccccccccccccccccEEEEEEEEcccEEEEEEEEccc
cccccEEEEEcccccHHHHHHHHHHHHHccccccEEEEEEcccccccccHccHEEHHHHcccccccccccccccccccccccccccccEEEEEEcccc
mgsgerlvacgtcknliheecwvtwkrsrgrraascvicrgrwrdnrtdqdKYLNLAAFvsqedhhhqaaedsgsricgleaveedneIQVQVNFHDS
mgsgerlvacgtcknliheecwvtwkrsrgrraascvicrgrwrdnrtdQDKYLNLAAFVSQEDHHHQAAEDSGSRICGLEAVeedneiqvqvnfhds
MGSGERLVACGTCKNLIHEECWVTWKRSRGRRAASCVICRGRWRDNRTDQDKYLNLAAFVSQEDHHHQAAEDSGSRICGLEAVEEDNEIQVQVNFHDS
******LVACGTCKNLIHEECWVTWKRSRGRRAASCVICRGRWRDNRTDQDKYLNLAAFV**************************************
****ERL*ACGTCKNLIHEECWVTWKRSRGRRAASCVICRGRW**********LNLAAFVSQEDHHHQAAEDSGSRICGLEAVEEDNEIQVQVNF***
MGSGERLVACGTCKNLIHEECWVTWK********SCVICRGRWRDNRTDQDKYLNLAAFVSQ***********GSRICGLEAVEEDNEIQVQVNFHDS
****ERLVACGTCKNLIHEECWVTWKRSRGRRAASCVICRGRWRDNRTDQDKYLNLAAFVSQEDHHHQAA*DSGSRICGLEAVEEDNEIQVQVNFH**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooo
iiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSGERLVACGTCKNLIHEECWVTWKRSRGRRAASCVICRGRWRDNRTDQDKYLNLAAFVSQEDHHHQAAEDSGSRICGLEAVEEDNEIQVQVNFHDS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query98
225429924 233 PREDICTED: uncharacterized protein LOC10 0.714 0.300 0.662 4e-21
357466667 239 Mitogen-activated protein kinase kinase 0.724 0.297 0.666 5e-20
224089008 241 predicted protein [Populus trichocarpa] 0.734 0.298 0.628 9e-19
255550920 246 conserved hypothetical protein [Ricinus 0.673 0.268 0.611 9e-18
356518350 230 PREDICTED: uncharacterized protein LOC10 0.673 0.286 0.602 1e-16
449461325 244 PREDICTED: mitogen-activated protein kin 0.642 0.258 0.555 1e-16
357117835 259 PREDICTED: mitogen-activated protein kin 0.591 0.223 0.532 3e-13
242093302 270 hypothetical protein SORBIDRAFT_10g02188 0.642 0.233 0.492 8e-12
125555710 263 hypothetical protein OsI_23347 [Oryza sa 0.561 0.209 0.543 1e-11
125597549 266 hypothetical protein OsJ_21669 [Oryza sa 0.561 0.206 0.526 2e-11
>gi|225429924|ref|XP_002281202.1| PREDICTED: uncharacterized protein LOC100266212 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  105 bits (261), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 61/74 (82%), Gaps = 4/74 (5%)

Query: 1   MGSGERLVACGTCKNLIHEECWVTWKRSRGRRAASCVICRGRWRDNRTDQDKYLNLAAFV 60
           MG GE++VACGTC+N IHEEC +TWKR+RGRR+ASCVICR RW  NRTDQ++YLNLAA+V
Sbjct: 159 MGRGEKVVACGTCRNPIHEECLLTWKRTRGRRSASCVICRARW-SNRTDQERYLNLAAYV 217

Query: 61  SQEDHHHQAAEDSG 74
           + +D   + AE  G
Sbjct: 218 TDDD---EVAEGDG 228

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357466667|ref|XP_003603618.1| Mitogen-activated protein kinase kinase kinase [Medicago truncatula] gi|355492666|gb|AES73869.1| Mitogen-activated protein kinase kinase kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|224089008|ref|XP_002308599.1| predicted protein [Populus trichocarpa] gi|222854575|gb|EEE92122.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255550920|ref|XP_002516508.1| conserved hypothetical protein [Ricinus communis] gi|223544328|gb|EEF45849.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356518350|ref|XP_003527842.1| PREDICTED: uncharacterized protein LOC100775505 [Glycine max] Back     alignment and taxonomy information
>gi|449461325|ref|XP_004148392.1| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like [Cucumis sativus] gi|449507250|ref|XP_004162976.1| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357117835|ref|XP_003560667.1| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|242093302|ref|XP_002437141.1| hypothetical protein SORBIDRAFT_10g021880 [Sorghum bicolor] gi|241915364|gb|EER88508.1| hypothetical protein SORBIDRAFT_10g021880 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|125555710|gb|EAZ01316.1| hypothetical protein OsI_23347 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|125597549|gb|EAZ37329.1| hypothetical protein OsJ_21669 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query98
TAIR|locus:2181915273 AT5G11620 [Arabidopsis thalian 0.581 0.208 0.428 3.1e-11
ASPGD|ASPL0000071211333 AN4359 [Emericella nidulans (t 0.714 0.210 0.306 0.00039
TAIR|locus:2181915 AT5G11620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 157 (60.3 bits), Expect = 3.1e-11, P = 3.1e-11
 Identities = 30/70 (42%), Positives = 42/70 (60%)

Query:     7 LVACGTCKNLIHEECWVTWKRSRGRRAASCVICRGRWRDNRTDQDK-------------Y 53
             +V C  CKN +H+EC + W++SRGRR A CV+CR RW  NR+ ++              Y
Sbjct:   192 VVKCRVCKNKVHDECMLAWRKSRGRRPAICVVCRARWPANRSSKNPNVGDNNENCHGNCY 251

Query:    54 LNLAAFVSQE 63
             LNLA +V +E
Sbjct:   252 LNLAPYVDEE 261
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
ASPGD|ASPL0000071211 AN4359 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query98
COG52191525 COG5219, COG5219, Uncharacterized conserved protei 9e-05
>gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information 
 Score = 39.3 bits (91), Expect = 9e-05
 Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 2/31 (6%)

Query: 10   CGTCKNLIHEECWVTWKRSRGRRAASCVICR 40
            C TCKN  H  C   W  S  R  ++C +CR
Sbjct: 1491 CATCKNKFHTRCLYKWFASSAR--SNCPLCR 1519

Length = 1525

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 98
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.98
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.28
COG52191525 Uncharacterized conserved protein, contains RING Z 98.25
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.14
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 98.06
cd0016245 RING RING-finger (Really Interesting New Gene) dom 97.82
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 97.73
KOG149384 consensus Anaphase-promoting complex (APC), subuni 97.62
PHA02929238 N1R/p28-like protein; Provisional 97.57
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 96.91
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 96.76
PHA02926242 zinc finger-like protein; Provisional 96.65
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 96.57
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 96.56
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 96.56
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 96.54
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 96.5
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 96.42
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 96.23
PHA02862156 5L protein; Provisional 95.98
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 95.74
PF1463444 zf-RING_5: zinc-RING finger domain 95.63
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 95.58
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 95.38
PF10272358 Tmpp129: Putative transmembrane protein precursor; 95.16
PHA02825162 LAP/PHD finger-like protein; Provisional 95.04
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 94.91
smart0050463 Ubox Modified RING finger domain. Modified RING fi 94.48
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 94.43
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 94.2
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 94.15
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 94.12
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 93.92
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 93.78
KOG3053 293 consensus Uncharacterized conserved protein [Funct 93.26
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 91.53
PF15353107 HECA: Headcase protein family homologue 91.33
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 90.76
KOG0825 1134 consensus PHD Zn-finger protein [General function 90.26
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 90.18
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 86.71
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 86.45
PRK11088 272 rrmA 23S rRNA methyltransferase A; Provisional 86.42
KOG1609 323 consensus Protein involved in mRNA turnover and st 86.14
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 84.08
KOG0269839 consensus WD40 repeat-containing protein [Function 83.44
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 82.83
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 81.81
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 80.63
PF13901202 DUF4206: Domain of unknown function (DUF4206) 80.27
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information 
Probab=98.98  E-value=3.5e-10  Score=77.44  Aligned_cols=42  Identities=26%  Similarity=0.685  Sum_probs=35.1

Q ss_pred             CCCCceeecccccchhHHHHHHHHHHhcCCCCcccccccccccC
Q 039237            2 GSGERLVACGTCKNLIHEECWVTWKRSRGRRAASCVICRGRWRD   45 (98)
Q Consensus         2 gs~e~lVwC~~CGnniHkeCf~~W~~s~~~~~vtCp~CRs~W~~   45 (98)
                      |.+-.|||+ .|+++||..|+.+|.++.+. +.+||+||++|+-
T Consensus        42 gd~Cplv~g-~C~H~FH~hCI~kWl~~~~~-~~~CPmCR~~w~~   83 (85)
T PF12861_consen   42 GDDCPLVWG-KCSHNFHMHCILKWLSTQSS-KGQCPMCRQPWKF   83 (85)
T ss_pred             CCCCceeec-cCccHHHHHHHHHHHccccC-CCCCCCcCCeeee
Confidence            344567777 59999999999999999754 4699999999974

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15353 HECA: Headcase protein family homologue Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13901 DUF4206: Domain of unknown function (DUF4206) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query98
3nw0_A238 Non-structural maintenance of chromosomes element 3e-04
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
 Score = 37.0 bits (85), Expect = 3e-04
 Identities = 9/39 (23%), Positives = 13/39 (33%), Gaps = 2/39 (5%)

Query: 8   VACGTCKNLIHEECWVTWKRSRGRRAASCVICRGRWRDN 46
            +C TC   +H  C   + +S       C  C   W   
Sbjct: 194 QSCETCGIRMHLPCVAKYFQSNAEP--RCPHCNDYWPHE 230

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query98
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.93
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.51
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.5
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.34
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.31
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.26
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.25
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.25
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.24
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.2
3nw0_A238 Non-structural maintenance of chromosomes element 98.19
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.18
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 98.17
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.14
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.1
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.1
2ect_A78 Ring finger protein 126; metal binding protein, st 98.04
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.01
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 97.93
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 97.89
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.86
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 97.86
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 97.83
2ecw_A85 Tripartite motif-containing protein 30; metal bind 97.83
2ysl_A73 Tripartite motif-containing protein 31; ring-type 97.83
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 97.8
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 97.8
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 97.73
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.68
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 97.65
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 97.64
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 97.61
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 97.6
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.58
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.56
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 97.56
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 97.54
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 97.5
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.47
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.47
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 97.46
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 97.44
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 97.34
2ysj_A63 Tripartite motif-containing protein 31; ring-type 97.32
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 97.3
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 97.18
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 97.13
1z6u_A150 NP95-like ring finger protein isoform B; structura 97.13
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 96.95
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 96.73
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 96.58
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 96.55
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.1
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 96.07
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 95.7
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 94.86
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 94.7
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 94.68
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 94.56
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 94.48
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 94.21
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 94.21
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 94.16
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 94.12
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 94.08
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 93.78
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 93.74
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 92.32
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 91.62
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 90.79
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 90.7
2f42_A179 STIP1 homology and U-box containing protein 1; cha 90.23
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 89.12
1wil_A89 KIAA1045 protein; ring finger domain, structural g 87.78
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 87.11
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 86.24
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 84.87
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 84.66
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 83.1
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 82.47
2ea5_A68 Cell growth regulator with ring finger domain prot 80.51
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
Probab=98.93  E-value=2.4e-10  Score=74.23  Aligned_cols=38  Identities=24%  Similarity=0.594  Sum_probs=32.9

Q ss_pred             eecccccchhHHHHHHHHHHhcCCCCcccccccccccCCC
Q 039237            8 VACGTCKNLIHEECWVTWKRSRGRRAASCVICRGRWRDNR   47 (98)
Q Consensus         8 VwC~~CGnniHkeCf~~W~~s~~~~~vtCp~CRs~W~~~~   47 (98)
                      ..|.+|++.||..|+++|++++.  ..+||+||++|....
T Consensus        29 ~~C~~C~h~fH~~Ci~kWl~~~~--~~~CP~Cr~~w~~~~   66 (74)
T 2ct0_A           29 QSCETCGIRMHLPCVAKYFQSNA--EPRCPHCNDYWPHEI   66 (74)
T ss_dssp             EECSSSCCEECHHHHHHHSTTCS--SCCCTTTCSCCCSCC
T ss_pred             CccCCCCchhhHHHHHHHHHhcC--CCCCCCCcCcCCCCC
Confidence            46889999999999999998864  478999999999653
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query98
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.99
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.85
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.8
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.76
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.57
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.23
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.19
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 97.9
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 97.65
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 97.35
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 97.25
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 96.72
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 96.67
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 96.27
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 95.75
d2c2la280 STIP1 homology and U box-containing protein 1, STU 95.73
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 94.81
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 94.2
d2gmga1105 Hypothetical protein PF0610 {Pyrococcus furiosus [ 92.07
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 91.69
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 87.34
d1wema_76 Death associated transcription factor 1, Datf1 (DI 81.62
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Deltex protein 2 RING-H2 domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=98.99  E-value=1.5e-10  Score=75.63  Aligned_cols=43  Identities=14%  Similarity=0.353  Sum_probs=35.1

Q ss_pred             Cceeec-ccccchhHHHHHHHHHHhcC-CCCcccccccccccCCC
Q 039237            5 ERLVAC-GTCKNLIHEECWVTWKRSRG-RRAASCVICRGRWRDNR   47 (98)
Q Consensus         5 e~lVwC-~~CGnniHkeCf~~W~~s~~-~~~vtCp~CRs~W~~~~   47 (98)
                      +..+++ ..||+.||.+|+.+|++++. ....+||+||+.|....
T Consensus        52 ~~~~~~~~~CgH~FH~~Ci~~Wl~~~~~~~~~~CP~CR~~~~~~~   96 (114)
T d1v87a_          52 PMVVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKT   96 (114)
T ss_dssp             SSCCEEESSSCCEECHHHHHHHHHHTCCSSCCBCTTTCCBSSSCS
T ss_pred             cccceEECCCCChhhHHHHHHHHHhcCcCCCCccccccchhccCc
Confidence            345677 78999999999999999864 24689999999997653
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gmga1 a.4.5.82 (A:1-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure