Citrus Sinensis ID: 039237
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 98 | ||||||
| 225429924 | 233 | PREDICTED: uncharacterized protein LOC10 | 0.714 | 0.300 | 0.662 | 4e-21 | |
| 357466667 | 239 | Mitogen-activated protein kinase kinase | 0.724 | 0.297 | 0.666 | 5e-20 | |
| 224089008 | 241 | predicted protein [Populus trichocarpa] | 0.734 | 0.298 | 0.628 | 9e-19 | |
| 255550920 | 246 | conserved hypothetical protein [Ricinus | 0.673 | 0.268 | 0.611 | 9e-18 | |
| 356518350 | 230 | PREDICTED: uncharacterized protein LOC10 | 0.673 | 0.286 | 0.602 | 1e-16 | |
| 449461325 | 244 | PREDICTED: mitogen-activated protein kin | 0.642 | 0.258 | 0.555 | 1e-16 | |
| 357117835 | 259 | PREDICTED: mitogen-activated protein kin | 0.591 | 0.223 | 0.532 | 3e-13 | |
| 242093302 | 270 | hypothetical protein SORBIDRAFT_10g02188 | 0.642 | 0.233 | 0.492 | 8e-12 | |
| 125555710 | 263 | hypothetical protein OsI_23347 [Oryza sa | 0.561 | 0.209 | 0.543 | 1e-11 | |
| 125597549 | 266 | hypothetical protein OsJ_21669 [Oryza sa | 0.561 | 0.206 | 0.526 | 2e-11 |
| >gi|225429924|ref|XP_002281202.1| PREDICTED: uncharacterized protein LOC100266212 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 105 bits (261), Expect = 4e-21, Method: Compositional matrix adjust.
Identities = 49/74 (66%), Positives = 61/74 (82%), Gaps = 4/74 (5%)
Query: 1 MGSGERLVACGTCKNLIHEECWVTWKRSRGRRAASCVICRGRWRDNRTDQDKYLNLAAFV 60
MG GE++VACGTC+N IHEEC +TWKR+RGRR+ASCVICR RW NRTDQ++YLNLAA+V
Sbjct: 159 MGRGEKVVACGTCRNPIHEECLLTWKRTRGRRSASCVICRARW-SNRTDQERYLNLAAYV 217
Query: 61 SQEDHHHQAAEDSG 74
+ +D + AE G
Sbjct: 218 TDDD---EVAEGDG 228
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|357466667|ref|XP_003603618.1| Mitogen-activated protein kinase kinase kinase [Medicago truncatula] gi|355492666|gb|AES73869.1| Mitogen-activated protein kinase kinase kinase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224089008|ref|XP_002308599.1| predicted protein [Populus trichocarpa] gi|222854575|gb|EEE92122.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255550920|ref|XP_002516508.1| conserved hypothetical protein [Ricinus communis] gi|223544328|gb|EEF45849.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356518350|ref|XP_003527842.1| PREDICTED: uncharacterized protein LOC100775505 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449461325|ref|XP_004148392.1| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like [Cucumis sativus] gi|449507250|ref|XP_004162976.1| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357117835|ref|XP_003560667.1| PREDICTED: mitogen-activated protein kinase kinase kinase 1-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|242093302|ref|XP_002437141.1| hypothetical protein SORBIDRAFT_10g021880 [Sorghum bicolor] gi|241915364|gb|EER88508.1| hypothetical protein SORBIDRAFT_10g021880 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|125555710|gb|EAZ01316.1| hypothetical protein OsI_23347 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|125597549|gb|EAZ37329.1| hypothetical protein OsJ_21669 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 98 | ||||||
| TAIR|locus:2181915 | 273 | AT5G11620 [Arabidopsis thalian | 0.581 | 0.208 | 0.428 | 3.1e-11 | |
| ASPGD|ASPL0000071211 | 333 | AN4359 [Emericella nidulans (t | 0.714 | 0.210 | 0.306 | 0.00039 |
| TAIR|locus:2181915 AT5G11620 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 157 (60.3 bits), Expect = 3.1e-11, P = 3.1e-11
Identities = 30/70 (42%), Positives = 42/70 (60%)
Query: 7 LVACGTCKNLIHEECWVTWKRSRGRRAASCVICRGRWRDNRTDQDK-------------Y 53
+V C CKN +H+EC + W++SRGRR A CV+CR RW NR+ ++ Y
Sbjct: 192 VVKCRVCKNKVHDECMLAWRKSRGRRPAICVVCRARWPANRSSKNPNVGDNNENCHGNCY 251
Query: 54 LNLAAFVSQE 63
LNLA +V +E
Sbjct: 252 LNLAPYVDEE 261
|
|
| ASPGD|ASPL0000071211 AN4359 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 98 | |||
| COG5219 | 1525 | COG5219, COG5219, Uncharacterized conserved protei | 9e-05 |
| >gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
Score = 39.3 bits (91), Expect = 9e-05
Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 2/31 (6%)
Query: 10 CGTCKNLIHEECWVTWKRSRGRRAASCVICR 40
C TCKN H C W S R ++C +CR
Sbjct: 1491 CATCKNKFHTRCLYKWFASSAR--SNCPLCR 1519
|
Length = 1525 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 98 | |||
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 98.98 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.28 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 98.25 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.14 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 98.06 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 97.82 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 97.73 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 97.62 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 97.57 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 96.91 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 96.76 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 96.65 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 96.57 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 96.56 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 96.56 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 96.54 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 96.5 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 96.42 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.23 | |
| PHA02862 | 156 | 5L protein; Provisional | 95.98 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 95.74 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 95.63 | |
| PF12906 | 47 | RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. | 95.58 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 95.38 | |
| PF10272 | 358 | Tmpp129: Putative transmembrane protein precursor; | 95.16 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 95.04 | |
| KOG3268 | 234 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.91 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 94.48 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.43 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.2 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 94.15 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 94.12 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 93.92 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 93.78 | |
| KOG3053 | 293 | consensus Uncharacterized conserved protein [Funct | 93.26 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.53 | |
| PF15353 | 107 | HECA: Headcase protein family homologue | 91.33 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 90.76 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 90.26 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 90.18 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 86.71 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 86.45 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 86.42 | |
| KOG1609 | 323 | consensus Protein involved in mRNA turnover and st | 86.14 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 84.08 | |
| KOG0269 | 839 | consensus WD40 repeat-containing protein [Function | 83.44 | |
| KOG1952 | 950 | consensus Transcription factor NF-X1, contains NFX | 82.83 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 81.81 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 80.63 | |
| PF13901 | 202 | DUF4206: Domain of unknown function (DUF4206) | 80.27 |
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
Probab=98.98 E-value=3.5e-10 Score=77.44 Aligned_cols=42 Identities=26% Similarity=0.685 Sum_probs=35.1
Q ss_pred CCCCceeecccccchhHHHHHHHHHHhcCCCCcccccccccccC
Q 039237 2 GSGERLVACGTCKNLIHEECWVTWKRSRGRRAASCVICRGRWRD 45 (98)
Q Consensus 2 gs~e~lVwC~~CGnniHkeCf~~W~~s~~~~~vtCp~CRs~W~~ 45 (98)
|.+-.|||+ .|+++||..|+.+|.++.+. +.+||+||++|+-
T Consensus 42 gd~Cplv~g-~C~H~FH~hCI~kWl~~~~~-~~~CPmCR~~w~~ 83 (85)
T PF12861_consen 42 GDDCPLVWG-KCSHNFHMHCILKWLSTQSS-KGQCPMCRQPWKF 83 (85)
T ss_pred CCCCceeec-cCccHHHHHHHHHHHccccC-CCCCCCcCCeeee
Confidence 344567777 59999999999999999754 4699999999974
|
|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >KOG3053 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15353 HECA: Headcase protein family homologue | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG0269 consensus WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13901 DUF4206: Domain of unknown function (DUF4206) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 98 | |||
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 3e-04 |
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 | Back alignment and structure |
|---|
Score = 37.0 bits (85), Expect = 3e-04
Identities = 9/39 (23%), Positives = 13/39 (33%), Gaps = 2/39 (5%)
Query: 8 VACGTCKNLIHEECWVTWKRSRGRRAASCVICRGRWRDN 46
+C TC +H C + +S C C W
Sbjct: 194 QSCETCGIRMHLPCVAKYFQSNAEP--RCPHCNDYWPHE 230
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 98 | |||
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 98.93 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.51 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.5 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.34 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.31 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.26 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.25 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.25 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.24 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.2 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 98.19 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.18 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 98.17 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.14 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 98.1 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.1 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.04 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 98.01 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 97.93 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 97.89 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 97.86 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 97.86 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 97.83 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 97.83 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 97.83 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 97.8 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 97.8 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 97.73 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 97.68 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 97.65 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 97.64 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 97.61 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 97.6 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 97.58 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 97.56 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 97.56 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 97.54 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 97.5 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 97.47 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 97.47 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 97.46 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 97.44 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 97.34 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 97.32 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 97.3 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 97.18 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 97.13 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 97.13 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 96.95 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 96.73 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 96.58 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 96.55 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 96.1 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 96.07 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 95.7 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 94.86 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 94.7 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 94.68 | |
| 2gmg_A | 105 | Hypothetical protein PF0610; winged-helix like pro | 94.56 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 94.48 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 94.21 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 94.21 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 94.16 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 94.12 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 94.08 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 93.78 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 93.74 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 92.32 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 91.62 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 90.79 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 90.7 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 90.23 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 89.12 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 87.78 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 87.11 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 86.24 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 84.87 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 84.66 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 83.1 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 82.47 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 80.51 |
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=98.93 E-value=2.4e-10 Score=74.23 Aligned_cols=38 Identities=24% Similarity=0.594 Sum_probs=32.9
Q ss_pred eecccccchhHHHHHHHHHHhcCCCCcccccccccccCCC
Q 039237 8 VACGTCKNLIHEECWVTWKRSRGRRAASCVICRGRWRDNR 47 (98)
Q Consensus 8 VwC~~CGnniHkeCf~~W~~s~~~~~vtCp~CRs~W~~~~ 47 (98)
..|.+|++.||..|+++|++++. ..+||+||++|....
T Consensus 29 ~~C~~C~h~fH~~Ci~kWl~~~~--~~~CP~Cr~~w~~~~ 66 (74)
T 2ct0_A 29 QSCETCGIRMHLPCVAKYFQSNA--EPRCPHCNDYWPHEI 66 (74)
T ss_dssp EECSSSCCEECHHHHHHHSTTCS--SCCCTTTCSCCCSCC
T ss_pred CccCCCCchhhHHHHHHHHHhcC--CCCCCCCcCcCCCCC
Confidence 46889999999999999998864 478999999999653
|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 98 | |||
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.99 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.85 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.8 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.76 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.57 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.23 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.19 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 97.9 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 97.65 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 97.35 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 97.25 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 96.72 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 96.67 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 96.27 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 95.75 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 95.73 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 94.81 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 94.2 | |
| d2gmga1 | 105 | Hypothetical protein PF0610 {Pyrococcus furiosus [ | 92.07 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 91.69 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 87.34 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 81.62 |
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: Deltex protein 2 RING-H2 domain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=98.99 E-value=1.5e-10 Score=75.63 Aligned_cols=43 Identities=14% Similarity=0.353 Sum_probs=35.1
Q ss_pred Cceeec-ccccchhHHHHHHHHHHhcC-CCCcccccccccccCCC
Q 039237 5 ERLVAC-GTCKNLIHEECWVTWKRSRG-RRAASCVICRGRWRDNR 47 (98)
Q Consensus 5 e~lVwC-~~CGnniHkeCf~~W~~s~~-~~~vtCp~CRs~W~~~~ 47 (98)
+..+++ ..||+.||.+|+.+|++++. ....+||+||+.|....
T Consensus 52 ~~~~~~~~~CgH~FH~~Ci~~Wl~~~~~~~~~~CP~CR~~~~~~~ 96 (114)
T d1v87a_ 52 PMVVGRLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKTIYGEKT 96 (114)
T ss_dssp SSCCEEESSSCCEECHHHHHHHHHHTCCSSCCBCTTTCCBSSSCS
T ss_pred cccceEECCCCChhhHHHHHHHHHhcCcCCCCccccccchhccCc
Confidence 345677 78999999999999999864 24689999999997653
|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gmga1 a.4.5.82 (A:1-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|