Citrus Sinensis ID: 039248

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400
MVLLDNHISKPDWCCSNTDGNGFFGDRYFDPNEWMKGLSFVADRFKEKRQVVAISLRNELRGPRQNEPDWYKYISEGARVVHKRNPHVLVFVSGLNFDLDLRFLQKSPLALDLDNKLVYEIHWYSFSQDQNMWKTQPTNIVCYKVTQSFINRAVFLTTRKNPAPLVLSEFGFDQREVNLADNLYMTCLMAYAAETDLDWALWALQGSYYLRGGLKGAEETFGALDSTWQHPRNPNFLERLRFLQTKTHVPTTSRTRTSYIIFHPLSGNCVNANARNELYASNRGPFSRWSYGGDGTPIRLMDRSLCLKVVGDGLPPMLSNDCQSNQSAWSLVSSSKLHLATKDDEHGGELLCLQISIWTESLRFERAIQEKNLASQSLQGPIQIQDWADRQRAHYLQPSA
cEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEccccccccccccHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccccccccccHHHHHHHHHHHHHHcccccEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccEEEccccccEEEccccccccccccccccccEEcccccEEEEcccccEEEEcccccccEEccccccccccEEEEEcccEEEEEEEcccccEEEEEEEccccccEEEEcccccccccccccccccccccHHHHHccccccccc
cEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEEcccccccccccccEEEcccccEEEEcccccccccccccccccccccccHHHHHHHHcccEEEEcccccEEEEEEcccccccccccHHHHHHHHHHHHHHccccEEEEEEcccEEEEccccccccccccccccccccccHHHHHHHHHHHccccccccccccccEEEEcccccEEEEEccccccccEEcccccccEEcccccEEEEEcccEEEEEcccccccEEccccccccccEEEEEcccEEEEEEEccccccEEEEEEEEccccEEEEEEEEEccccccccccccEHccHHHHHHHHHccccc
mvlldnhiskpdwccsntdgngffgdryfdpnewmkGLSFVADRFKEKRQVVAISLRnelrgprqnepdwykYISEGArvvhkrnpHVLVFVSGlnfdldlrflqksplaldldnklVYEIHWYSfsqdqnmwktqptnivCYKVTQSFINRAVFLttrknpaplvlsefgfdqrevnladNLYMTCLMAYAAETDLDWALWALQGSYylrgglkgaeetfgaldstwqhprnpnFLERLRFLQtkthvpttsrtrtsyiifhplsgncvnanarnelyasnrgpfsrwsyggdgtpirlMDRSLCLKvvgdglppmlsndcqsnqsaWSLVSssklhlatkddehggELLCLQISIWTESLRFERAIQEKNlasqslqgpiqiQDWADRqrahylqpsa
mvlldnhiskpdwccsnTDGNGFFGDRYFDPNEWMKGLSFVADRFKEKRQVVAIslrnelrgprqnepDWYKYISEGARVVHKRNPHVLVFVSGLNFDLDLRFLQKSPLALDLDNKLVYEIHWYSFSQDQNMWKTQPTNIVCYKVTQSFINRAVFLTTRKNPAPLVLSEFGFDQREVNLADNLYMTCLMAYAAETDLDWALWALQGSYYLRGGLKGAEETFGALDSTWQHPRNPNFLERLRFLQtkthvpttsrtrtsYIIFHPLSGNCVNANARNELYasnrgpfsrwsYGGDGTPIRLMDRSLCLKVVGDGLPPMLSNDCQSNQSAWSLVSSSKLHLATKDDEHGGELLCLQISIWTESLRFERAIQEKnlasqslqgpIQIQDWADRQRAHYLQPSA
MVLLDNHISKPDWCCSNTDGNGFFGDRYFDPNEWMKGLSFVADRFKEKRQVVAISLRNELRGPRQNEPDWYKYISEGARVVHKRNPHVLVFVSGLNFDLDLRFLQKSPLALDLDNKLVYEIHWYSFSQDQNMWKTQPTNIVCYKVTQSFINRAVFLTTRKNPAPLVLSEFGFDQREVNLADNLYMTCLMAYAAETDLDWALWALQGSYYLRGGLKGAEETFGALDSTWQHPRNPNFLERLRFLQTKTHVPTTSRTRTSYIIFHPLSGNCVNANARNELYASNRGPFSRWSYGGDGTPIRLMDRSLCLKVVGDGLPPMLSNDCQSNQSAWSLVSSSKLHLATKDDEHGGELLCLQISIWTESLRFERAIQEKNLASQSLQGPIQIQDWADRQRAHYLQPSA
*****NHISKPDWCCSNTDGNGFFGDRYFDPNEWMKGLSFVADRFKEKRQVVAISLRNELRG***NEPDWYKYISEGARVVHKRNPHVLVFVSGLNFDLDLRFLQKSPLALDLDNKLVYEIHWYSFSQDQNMWKTQPTNIVCYKVTQSFINRAVFLTTRKNPAPLVLSEFGFDQREVNLADNLYMTCLMAYAAETDLDWALWALQGSYYLRGGLKGAEETFGALDSTWQHPRNPNFLERLRFLQTKTHVPTTSRTRTSYIIFHPLSGNCVNANARNELYASNRGPFSRWSYGGDGTPIRLMDRSLCLKVVGDGLPPML**********WSLV****LHLATKDDEHGGELLCLQISIWTESLRFERAIQE*************I****************
MVLLDNHISKPDWCCSNTDGNGFFGDRYFDPNEWMKGLSFVADRFKEKRQVVAISLRNELRGPRQNEPDWYKYISEGARVVHKRNPHVLVFVSGLNFDLDLRFLQKSPLALDLDNKLVYEIHWYSFSQDQNMWKTQPTNIVCYKVTQSFINRAVFLTTRKNPAPLVLSEFGFDQREVNLADNLYMTCLMAYAAETDLDWALWALQGSYYLRGGLKGAEETFGALDSTWQHPRNPNFLERLRFLQ*************SYIIFHPLSGNCV*************GPFSRWSYGGDGTPIRLMDRSLCLKVVGDGLPPMLSN********WS*VSSSKLHLATKDDEHGGELLCLQISIWTESLRFERAIQEKNLASQSLQGPIQI***ADRQ**H******
MVLLDNHISKPDWCCSNTDGNGFFGDRYFDPNEWMKGLSFVADRFKEKRQVVAISLRNELRGPRQNEPDWYKYISEGARVVHKRNPHVLVFVSGLNFDLDLRFLQKSPLALDLDNKLVYEIHWYSFSQDQNMWKTQPTNIVCYKVTQSFINRAVFLTTRKNPAPLVLSEFGFDQREVNLADNLYMTCLMAYAAETDLDWALWALQGSYYLRGGLKGAEETFGALDSTWQHPRNPNFLERLRFLQTKTHVPTTSRTRTSYIIFHPLSGNCVNANARNELYASNRGPFSRWSYGGDGTPIRLMDRSLCLKVVGDGLPPMLSNDCQSNQSAWSLVSSSKLHLATKDDEHGGELLCLQISIWTESLRFERAIQEKNLASQSLQGPIQIQDWADRQRAHYLQPSA
MVLLDNHISKPDWCCSNTDGNGFFGDRYFDPNEWMKGLSFVADRFKEKRQVVAISLRNELRGPRQNEPDWYKYISEGARVVHKRNPHVLVFVSGLNFDLDLRFLQKSPLALDLDNKLVYEIHWYSFSQDQNMWKTQPTNIVCYKVTQSFINRAVFLTTRKNPAPLVLSEFGFDQREVNLADNLYMTCLMAYAAETDLDWALWALQGSYYLRGGLKGAEETFGALDSTWQHPRNPNFLERLRFLQTKTHVPTTSRTRTSYIIFHPLSGNCVNANARNELYASNRGPFSRWSYGGDGTPIRLMDRSLCLKVVGDGLPPMLSNDCQSNQSAWSLVSSSKLHLATKDDEHGGELLCLQISIWTESLRFERAIQEKNLASQSLQGPIQIQDWADRQRAHYL****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLLDNHISKPDWCCSNTDGNGFFGDRYFDPNEWMKGLSFVADRFKEKRQVVAISLRNELRGPRQNEPDWYKYISEGARVVHKRNPHVLVFVSGLNFDLDLRFLQKSPLALDLDNKLVYEIHWYSFSQDQNMWKTQPTNIVCYKVTQSFINRAVFLTTRKNPAPLVLSEFGFDQREVNLADNLYMTCLMAYAAETDLDWALWALQGSYYLRGGLKGAEETFGALDSTWQHPRNPNFLERLRFLQTKTHVPTTSRTRTSYIIFHPLSGNCVNANARNELYASNRGPFSRWSYGGDGTPIRLMDRSLCLKVVGDGLPPMLSNDCQSNQSAWSLVSSSKLHLATKDDEHGGELLCLQISIWTESLRFERAIQEKNLASQSLQGPIQIQDWADRQRAHYLQPSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query400 2.2.26 [Sep-21-2011]
P23548397 Endoglucanase OS=Paenibac yes no 0.465 0.468 0.223 2e-07
P54583562 Endoglucanase E1 OS=Acido yes no 0.505 0.359 0.245 2e-06
P104741039 Endoglucanase/exoglucanas yes no 0.462 0.178 0.242 9e-05
>sp|P23548|GUN_PAEPO Endoglucanase OS=Paenibacillus polymyxa PE=3 SV=2 Back     alignment and function desciption
 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 88/219 (40%), Gaps = 33/219 (15%)

Query: 34  WMKGLSFVADRFKEKRQVVAISLRNELRG-----PRQNEPDWYKYISEGARVVHKRNPHV 88
           W+     +ADR+K    V+   L NE  G           DW          +   NP+ 
Sbjct: 169 WISDWKMLADRYKNNPTVIGADLHNEPHGQASWGTGNASTDWRLAAQRAGNAILSVNPNW 228

Query: 89  LVFVSGLNFDL-----------DLRFLQKSPLALDLDNKLVYEIHWYSFSQDQNMWKTQP 137
           L+ V G++ ++           +L  +   P+ LD+ N++VY  H Y        W   P
Sbjct: 229 LILVEGVDHNVQGNNSQYWWGGNLTGVANYPVVLDVPNRVVYSPHDYGPGVSSQPWFNDP 288

Query: 138 ---TNI-VCYKVTQSFINRAVFLTTRKNPAPLVLSEFGFDQREVNLADNLYMTCLMAYAA 193
              +N+   +  T  +I       +++N AP+++ EFG    +++  +  +   L+ Y  
Sbjct: 289 AFPSNLPAIWDQTWGYI-------SKQNIAPVLVGEFGGRNVDLSCPEGKWQNALVHYIG 341

Query: 194 ETDLDWALWALQGSYYLRGGLKGAEETFGALDSTWQHPR 232
             +L +  W+L  +    GGL   + T      TW  P+
Sbjct: 342 ANNLYFTYWSLNPNSGDTGGLLLDDWT------TWNRPK 374

Paenibacillus polymyxa (taxid: 1406)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 4
>sp|P54583|GUN1_ACIC1 Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=Acel_0614 PE=1 SV=1 Back     alignment and function description
>sp|P10474|GUNB_CALSA Endoglucanase/exoglucanase B OS=Caldocellum saccharolyticum GN=celB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query400
255537625 542 hydrolase, hydrolyzing O-glycosyl compou 0.907 0.669 0.567 1e-111
225426108 532 PREDICTED: uncharacterized protein LOC10 0.875 0.657 0.550 1e-111
359474310 530 PREDICTED: uncharacterized protein LOC10 0.88 0.664 0.550 1e-110
297742258477 unnamed protein product [Vitis vinifera] 0.88 0.737 0.550 1e-110
357475987 536 Endoglucanase [Medicago truncatula] gi|8 0.942 0.703 0.493 1e-107
449523497 535 PREDICTED: uncharacterized protein LOC10 0.877 0.656 0.521 1e-105
225426116 545 PREDICTED: endoglucanase/exoglucanase B 0.875 0.642 0.537 1e-104
297742255 561 unnamed protein product [Vitis vinifera] 0.875 0.623 0.537 1e-104
356527943 531 PREDICTED: uncharacterized protein LOC10 0.945 0.711 0.477 1e-103
297742256 970 unnamed protein product [Vitis vinifera] 0.885 0.364 0.508 1e-102
>gi|255537625|ref|XP_002509879.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] gi|223549778|gb|EEF51266.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  409 bits (1051), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 209/368 (56%), Positives = 259/368 (70%), Gaps = 5/368 (1%)

Query: 1   MVLLDNHISKPDWCCSNTDGNGFFGDRYFDPNEWMKGLSFVADRFKEKRQVVAISLRNEL 60
           MVLLDNH+S+P WCC   D NGFFGD +F P EW++GL+ VA  F+ K QVVA+S+RNEL
Sbjct: 144 MVLLDNHVSQPKWCCPQDDENGFFGDIHFHPKEWLRGLAIVAKIFQGKSQVVAMSMRNEL 203

Query: 61  RGPRQNEPDWYKYISEGARVVHKRNPHVLVFVSGLNFDLDLRFLQKSP--LALDLDNKLV 118
           RGP QNE DWYKYI EGAR+VHK NP VLV VSGL +  DL FL+K P  L L+LDNKLV
Sbjct: 204 RGPYQNEHDWYKYIQEGARMVHKLNPEVLVLVSGLVWGTDLSFLKKKPLHLGLNLDNKLV 263

Query: 119 YEIHWYSFSQDQNMWKTQPTNIVCYKVTQSFINRAVFLTTRKNPAPLVLSEFGFDQREVN 178
           YE HWYSFS D  +W+ QP N +C   TQ  ++ + F+ T +NP PL L E G DQR VN
Sbjct: 264 YEAHWYSFSGDPKVWEVQPLNRICDLKTQIQVDLSGFVITGENPVPLFLGEVGIDQRGVN 323

Query: 179 LADNLYMTCLMAYAAETDLDWALWALQGSYYLRGGLKGAEETFGALDSTWQHPRNPNFLE 238
            ADN + TC +AY AE DLDW LWA QGSYY + G+ G +E +G ++  W + R+P F +
Sbjct: 324 RADNRFFTCFLAYVAENDLDWGLWAFQGSYYFKEGIAGPDENYGLMNFDWNYLRSPEFDD 383

Query: 239 RLRFLQTKTHVPTTSRTRTSYIIFHPLSGNCVNANARNELYASNRGPFSRWSYGGDGTPI 298
           R+  ++     P  S   TSY+++HPLSGNCV+A+ +NE+YAS     SRWS+ GDG PI
Sbjct: 384 RIWLIKRMIQDP-DSILSTSYLMYHPLSGNCVHASEKNEIYASRFQQHSRWSHDGDGAPI 442

Query: 299 RLMDRSLCLKVVGDGLPPMLSNDCQSNQSAWSLVSSSKLHLATKDDEHGGELLCLQISIW 358
           RLM  +LCLK +GDGL P+LSNDC S QS+W L+SSSKLHL  K DEH GE LCL+   +
Sbjct: 443 RLMGSALCLKAIGDGLEPVLSNDCFSQQSSWKLLSSSKLHLGVK-DEH-GEYLCLEKESF 500

Query: 359 TESLRFER 366
             S  F R
Sbjct: 501 NSSKVFTR 508

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225426108|ref|XP_002272386.1| PREDICTED: uncharacterized protein LOC100250178 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359474310|ref|XP_002272422.2| PREDICTED: uncharacterized protein LOC100245045 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297742258|emb|CBI34407.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357475987|ref|XP_003608279.1| Endoglucanase [Medicago truncatula] gi|87240496|gb|ABD32354.1| Glycoside hydrolase, family 5; Ricin B-related lectin [Medicago truncatula] gi|355509334|gb|AES90476.1| Endoglucanase [Medicago truncatula] Back     alignment and taxonomy information
>gi|449523497|ref|XP_004168760.1| PREDICTED: uncharacterized protein LOC101223816 [Cucumis sativus] Back     alignment and taxonomy information
>gi|225426116|ref|XP_002272534.1| PREDICTED: endoglucanase/exoglucanase B [Vitis vinifera] Back     alignment and taxonomy information
>gi|297742255|emb|CBI34404.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356527943|ref|XP_003532565.1| PREDICTED: uncharacterized protein LOC100811735 [Glycine max] Back     alignment and taxonomy information
>gi|297742256|emb|CBI34405.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query400
TAIR|locus:2031850552 AT1G13130 [Arabidopsis thalian 0.865 0.626 0.445 2.6e-79
TAIR|locus:2093571508 AT3G26140 [Arabidopsis thalian 0.865 0.681 0.426 8.1e-76
TAIR|locus:2093551551 AT3G26130 [Arabidopsis thalian 0.857 0.622 0.419 7e-70
TAIR|locus:2157482526 AT5G17500 [Arabidopsis thalian 0.862 0.655 0.408 1.3e-66
TAIR|locus:2149005488 AT5G16700 [Arabidopsis thalian 0.525 0.430 0.467 1.1e-58
ASPGD|ASPL0000037062412 AN9166 [Emericella nidulans (t 0.59 0.572 0.347 9.2e-36
UNIPROTKB|G4N8V8423 MGG_03374 "Beta-1,6-galactanas 0.607 0.574 0.306 1.4e-32
UNIPROTKB|G4MKY3480 MGG_05381 "Beta-1,6-galactanas 0.247 0.206 0.420 9.4e-27
UNIPROTKB|G4NBI5411 MGG_00530 "Endoglucanase E1" [ 0.547 0.532 0.25 7.3e-13
TAIR|locus:2031850 AT1G13130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 797 (285.6 bits), Expect = 2.6e-79, P = 2.6e-79
 Identities = 160/359 (44%), Positives = 214/359 (59%)

Query:     1 MVLLDNHISKPDWCCSNTDGNGFFGDRYFDPNEWMKGLSFVADRFKEKRQVVAISLRNEL 60
             MV+LDNH++KP WCC+N DGNGFFGD++FDP  W+  L  +A  F     VV +SLRNEL
Sbjct:   154 MVILDNHLTKPGWCCANDDGNGFFGDQFFDPTVWVAALKKMAATFNGVSNVVGMSLRNEL 213

Query:    61 RGPRQNEPDWYKYISEGARVVHKRNPHVLVFVSGLNFDLDLRFLQKSPLALDLDNKLVYE 120
             RGP+QN  DW+KY+ +GA  VH  N  VLV +SGL+FD DL F++  P+ L    KLV+E
Sbjct:   214 RGPKQNVNDWFKYMQQGAEAVHSANNKVLVILSGLSFDADLSFVRSRPVKLSFTGKLVFE 273

Query:   121 IHWYSFSQDQNMWKTQPTNIVCYKVTQSFINRAVFLTTRKNPAPLVLSEFGFDQREVNLA 180
             +HWYSFS D N W     N +C +V     N   +L  +    PL LSEFG D+R VN  
Sbjct:   274 LHWYSFS-DGNSWAANNPNDICGRVLNRIGNGGGYLLNQG--FPLFLSEFGIDERGVNTN 330

Query:   181 DNLYMTCLMAYAAETDLDWALWALQGSYYLRGGLKGAEETFGALDSTWQHPRNPNFLERL 240
             DN Y  CL  +AAE D+DW+LWAL GSYYLR G  G  E +G LDS W   RN +FL+++
Sbjct:   331 DNRYFGCLTGWAAENDVDWSLWALTGSYYLRQGKVGMNEYYGVLDSDWISVRNSSFLQKI 390

Query:   241 RFLQTKTHVPTTSRTRTSYIIFHPLSGNCVNANARNELYASNRGPFSR---WSYGGDGTP 297
              FLQ+    P   RT    ++FHPL+G C+   + ++      GP +    WSY      
Sbjct:   391 SFLQSPLQGPGP-RTDAYNLVFHPLTGLCI-VRSLDDPKMLTLGPCNSSEPWSYTKKA-- 446

Query:   298 IRLMDRSLCLKVVGDGLP-PMLSNDCQSNQSAWSLVSSSKLHLATKDDEHGGELLCLQI 355
             +R+ D+ LCL+  G   P  M    C ++ S W  +S+S++HLA+         LCL +
Sbjct:   447 LRIKDQQLCLQSNGPKNPVTMTRTSCSTSGSKWQTISASRMHLASTTSNKTS--LCLDV 503
GO:0003824 "catalytic activity" evidence=IEA
GO:0004553 "hydrolase activity, hydrolyzing O-glycosyl compounds" evidence=IEA;ISS
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0043169 "cation binding" evidence=IEA
TAIR|locus:2093571 AT3G26140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093551 AT3G26130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157482 AT5G17500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149005 AT5G16700 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000037062 AN9166 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4N8V8 MGG_03374 "Beta-1,6-galactanase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|G4MKY3 MGG_05381 "Beta-1,6-galactanase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|G4NBI5 MGG_00530 "Endoglucanase E1" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query400
pfam00150269 pfam00150, Cellulase, Cellulase (glycosyl hydrolas 4e-07
>gnl|CDD|215751 pfam00150, Cellulase, Cellulase (glycosyl hydrolase family 5) Back     alignment and domain information 
 Score = 50.4 bits (121), Expect = 4e-07
 Identities = 45/211 (21%), Positives = 71/211 (33%), Gaps = 32/211 (15%)

Query: 2   VLLDNHISKPDWCCSNTDGNGFFGDRYFDPNEWMKGL-SFVADRFKEKRQVVAISLRNEL 60
           V++D H         +    G           + K L + +A R+      V   L NE 
Sbjct: 79  VIIDWH---------HDTWPGDPNGNIDTAKAFFKKLWTQIATRYGNN-PNVIFELMNEP 128

Query: 61  RGPRQNE--PDWYKYISEGARVVHKRNPHVLVFVSGLNF--DLDLRFLQKSPLALDLDNK 116
            G        D   Y  E    +    P+ L+ V G ++  + D   L   P   + D+ 
Sbjct: 129 HGVDPATWDDDVKDYAQEAIDAIRAAGPNNLIIVGGPSWSQNPDGAALND-P---NDDDN 184

Query: 117 LVYEIHWYS---FSQDQNMWKTQPTNIVCYKVTQSFINRAVFLTTRKNPAPLVLSEFGFD 173
           L+Y +H+Y+   FS          TN+      Q    RA       N  P+ + EFG  
Sbjct: 185 LIYSVHFYAPSHFSGTWFGC-EDKTNL-----AQRL--RAAANYALDNGIPVFIGEFGGG 236

Query: 174 QREVNLADNLYMTCLMAYAAETDLDWALWAL 204
             +    D       + Y  E  + W  W+ 
Sbjct: 237 NADGPCRD--EAEKWLDYLKENGISWTGWSN 265

Length = 269

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 400
PF00150281 Cellulase: Cellulase (glycosyl hydrolase family 5) 99.94
COG2730407 BglC Endoglucanase [Carbohydrate transport and met 99.63
smart00458117 RICIN Ricin-type beta-trefoil. Carbohydrate-bindin 98.53
smart00633254 Glyco_10 Glycosyl hydrolase family 10. 98.33
cd00161124 RICIN Ricin-type beta-trefoil; Carbohydrate-bindin 98.21
PRK10150604 beta-D-glucuronidase; Provisional 98.13
PF1287688 Cellulase-like: Sugar-binding cellulase-like; Inte 98.13
PF02836298 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM 97.82
PF00652124 Ricin_B_lectin: Ricin-type beta-trefoil lectin dom 97.74
PF07745332 Glyco_hydro_53: Glycosyl hydrolase family 53; Inte 97.68
smart00458117 RICIN Ricin-type beta-trefoil. Carbohydrate-bindin 97.32
PF11790239 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; 97.24
PF00652124 Ricin_B_lectin: Ricin-type beta-trefoil lectin dom 97.02
PF00331320 Glyco_hydro_10: Glycosyl hydrolase family 10; Inte 96.87
cd00161124 RICIN Ricin-type beta-trefoil; Carbohydrate-bindin 96.75
COG3934 587 Endo-beta-mannanase [Carbohydrate transport and me 96.71
PF01229486 Glyco_hydro_39: Glycosyl hydrolases family 39; Int 96.54
PF02449374 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 96.27
COG3867403 Arabinogalactan endo-1,4-beta-galactosidase [Carbo 96.11
PF14200105 RicinB_lectin_2: Ricin-type beta-trefoil lectin do 95.88
PRK10340 1021 ebgA cryptic beta-D-galactosidase subunit alpha; R 95.16
PRK09525 1027 lacZ beta-D-galactosidase; Reviewed 95.13
PF14200105 RicinB_lectin_2: Ricin-type beta-trefoil lectin do 94.51
PF03198314 Glyco_hydro_72: Glucanosyltransferase; InterPro: I 93.63
PF14587384 Glyco_hydr_30_2: O-Glycosyl hydrolase family 30; P 91.79
KOG3738559 consensus Predicted polypeptide N-acetylgalactosam 90.77
PF13204289 DUF4038: Protein of unknown function (DUF4038); PD 89.06
TIGR03356427 BGL beta-galactosidase. 88.19
KOG3736578 consensus Polypeptide N-acetylgalactosaminyltransf 86.05
COG3693345 XynA Beta-1,4-xylanase [Carbohydrate transport and 82.74
KOG3736578 consensus Polypeptide N-acetylgalactosaminyltransf 80.79
>PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 Back     alignment and domain information 
Probab=99.94  E-value=3.7e-26  Score=219.18  Aligned_cols=195  Identities=24%  Similarity=0.454  Sum_probs=143.5

Q ss_pred             CeEEecCCCCCCcccCCCCCCCCCCCCCCCHHHHHHHHHHHHHHhcCCCcEEEEeccCCCCCCCCC-------hhhHHHH
Q 039248            1 MVLLDNHISKPDWCCSNTDGNGFFGDRYFDPNEWMKGLSFVADRFKEKRQVVAISLRNELRGPRQN-------EPDWYKY   73 (400)
Q Consensus         1 ~VILD~H~~~~~Wcc~~~dgn~~~~d~~~~~d~wi~~W~~lA~ryk~~p~Vvg~DL~NEP~~~~~~-------~~dW~~~   73 (400)
                      +||||+|.. |+|+...   +. +....-..+.+.++|+.||+|||+++.|++|||+|||+.....       ...|.++
T Consensus        77 ~vild~h~~-~~w~~~~---~~-~~~~~~~~~~~~~~~~~la~~y~~~~~v~~~el~NEP~~~~~~~~w~~~~~~~~~~~  151 (281)
T PF00150_consen   77 YVILDLHNA-PGWANGG---DG-YGNNDTAQAWFKSFWRALAKRYKDNPPVVGWELWNEPNGGNDDANWNAQNPADWQDW  151 (281)
T ss_dssp             EEEEEEEES-TTCSSST---ST-TTTHHHHHHHHHHHHHHHHHHHTTTTTTEEEESSSSGCSTTSTTTTSHHHTHHHHHH
T ss_pred             eEEEEeccC-ccccccc---cc-cccchhhHHHHHhhhhhhccccCCCCcEEEEEecCCccccCCccccccccchhhhhH
Confidence            599999987 6675332   11 2222123455778999999999999999999999999986321       2678999


Q ss_pred             HHHHHHHHHhcCCCcEEEEeCCCCCccchh-hhcCCCcCCCCCcEEEEEeecCCCCCCCcccCCCCchhhhhHHHHHHhh
Q 039248           74 ISEGARVVHKRNPHVLVFVSGLNFDLDLRF-LQKSPLALDLDNKLVYEIHWYSFSQDQNMWKTQPTNIVCYKVTQSFINR  152 (400)
Q Consensus        74 ~~~~~~AIr~~nP~~lI~VeG~~~~~dLs~-l~~~Pv~l~~~~~lVYs~H~Y~ps~~~~~W~~~~~~~~~~~~~~~~~~~  152 (400)
                      +++++++||+++|+++|+|+|..|+.++.. ....|.  ...+++||++|.|.+..+.+.+..... .....+...+...
T Consensus       152 ~~~~~~~Ir~~~~~~~i~~~~~~~~~~~~~~~~~~P~--~~~~~~~~~~H~Y~~~~~~~~~~~~~~-~~~~~~~~~~~~~  228 (281)
T PF00150_consen  152 YQRAIDAIRAADPNHLIIVGGGGWGADPDGAAADNPN--DADNNDVYSFHFYDPYDFSDQWNPGNW-GDASALESSFRAA  228 (281)
T ss_dssp             HHHHHHHHHHTTSSSEEEEEEHHHHTBHHHHHHHSTT--TTTTSEEEEEEEETTTCHHTTTSTCSH-HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHhcCCcceeecCCCccccccchhhhcCcc--cccCceeEEeeEeCCCCcCCccccccc-hhhhHHHHHHHHH
Confidence            999999999999999999999999877766 444552  235899999999997665433332110 1112344555555


Q ss_pred             HHHHhhcCCCCCEEEeccCCCCCCCChhhHHHHHHHHHHHHHCCCceEEeccCc
Q 039248          153 AVFLTTRKNPAPLVLSEFGFDQREVNLADNLYMTCLMAYAAETDLDWALWALQG  206 (400)
Q Consensus       153 ~gfl~~~~~g~Pv~iGEFG~~~~~~~~~d~~w~~~~l~~l~~~gi~wa~Wa~~G  206 (400)
                      ..++.+  .+.||+|||||....... ....++..+++++++++++|++|++++
T Consensus       229 ~~~~~~--~g~pv~~gE~G~~~~~~~-~~~~~~~~~~~~~~~~~~g~~~W~~~~  279 (281)
T PF00150_consen  229 LNWAKK--NGKPVVVGEFGWSNNDGN-GSTDYADAWLDYLEQNGIGWIYWSWKP  279 (281)
T ss_dssp             HHHHHH--TTSEEEEEEEESSTTTSC-HHHHHHHHHHHHHHHTTCEEEECEESS
T ss_pred             HHHHHH--cCCeEEEeCcCCcCCCCC-cCHHHHHHHHHHHHHCCCeEEEEecCC
Confidence            556654  789999999999855432 346788888999999999999999984

2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 5 GH5 from CAZY comprises enzymes with several known activities; endoglucanase (3.2.1.4 from EC); beta-mannanase (3.2.1.78 from EC); exo-1,3-glucanase (3.2.1.58 from EC); endo-1,6-glucanase (3.2.1.75 from EC); xylanase (3.2.1.8 from EC); endoglycoceramidase (3.2.1.123 from EC). The microbial degradation of cellulose and xylans requires several types of enzymes. Fungi and bacteria produces a spectrum of cellulolytic enzymes (cellulases) and xylanases which, on the basis of sequence similarities, can be classified into families. One of these families is known as the cellulase family A [] or as the glycosyl hydrolases family 5 []. One of the conserved regions in this family contains a conserved glutamic acid residue which is potentially involved [] in the catalytic mechanism.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 3NDY_A 3NDZ_B 1LF1_A 1TVP_B 1TVN_A 3AYR_A 3AYS_A 1QI0_A 1W3K_A 1OCQ_A ....
>COG2730 BglC Endoglucanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00458 RICIN Ricin-type beta-trefoil Back     alignment and domain information
>smart00633 Glyco_10 Glycosyl hydrolase family 10 Back     alignment and domain information
>cd00161 RICIN Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication Back     alignment and domain information
>PRK10150 beta-D-glucuronidase; Provisional Back     alignment and domain information
>PF12876 Cellulase-like: Sugar-binding cellulase-like; InterPro: IPR024778 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF02836 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM barrel domain; InterPro: IPR006103 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF00652 Ricin_B_lectin: Ricin-type beta-trefoil lectin domain; InterPro: IPR000772 Ricin is a legume lectin from the seeds of the castor bean plant, Ricinus communis Back     alignment and domain information
>PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 Back     alignment and domain information
>smart00458 RICIN Ricin-type beta-trefoil Back     alignment and domain information
>PF11790 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; InterPro: IPR024655 This entry represents the glycosyl hydrolase catalytic core of a group of uncharacterised proteins Back     alignment and domain information
>PF00652 Ricin_B_lectin: Ricin-type beta-trefoil lectin domain; InterPro: IPR000772 Ricin is a legume lectin from the seeds of the castor bean plant, Ricinus communis Back     alignment and domain information
>PF00331 Glyco_hydro_10: Glycosyl hydrolase family 10; InterPro: IPR001000 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd00161 RICIN Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication Back     alignment and domain information
>COG3934 Endo-beta-mannanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01229 Glyco_hydro_39: Glycosyl hydrolases family 39; InterPro: IPR000514 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A Back     alignment and domain information
>PRK10340 ebgA cryptic beta-D-galactosidase subunit alpha; Reviewed Back     alignment and domain information
>PRK09525 lacZ beta-D-galactosidase; Reviewed Back     alignment and domain information
>PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A Back     alignment and domain information
>PF03198 Glyco_hydro_72: Glucanosyltransferase; InterPro: IPR004886 This family is a group of yeast glycolipid proteins anchored to the membrane Back     alignment and domain information
>PF14587 Glyco_hydr_30_2: O-Glycosyl hydrolase family 30; PDB: 3CLW_B Back     alignment and domain information
>KOG3738 consensus Predicted polypeptide N-acetylgalactosaminyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13204 DUF4038: Protein of unknown function (DUF4038); PDB: 3KZS_D Back     alignment and domain information
>TIGR03356 BGL beta-galactosidase Back     alignment and domain information
>KOG3736 consensus Polypeptide N-acetylgalactosaminyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3693 XynA Beta-1,4-xylanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3736 consensus Polypeptide N-acetylgalactosaminyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query400
1vrx_A358 Endocellulase E1 From Acidothermus Cellulolyticus M 1e-07
1ece_A358 Acidothermus Cellulolyticus Endocellulase E1 Cataly 2e-07
>pdb|1VRX|A Chain A, Endocellulase E1 From Acidothermus Cellulolyticus Mutant Y245g Length = 358 Back     alignment and structure 
Iteration: 1

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 81/215 (37%), Gaps = 33/215 (15%)
Query: 34  WMKGLSFVADRFKEKRQVVAISLRNELRGPRQ---NEP--DWYKYISEGARVVHKRNPHV 88
           W+  L  +A R+K    VV   L NE   P      +P  DW          V   NP++
Sbjct: 137 WISDLQALAQRYKGNPTVVGFDLHNEPHDPACWGCGDPSIDWRLAAERAGNAVLSVNPNL 196
Query: 89  LVFVSGLN--------FDLDLRFLQKSPLALDLDNKLVYEIHWYSFSQDQNMWKTQPTNI 140
           L+FV G+         +  +L+   + P+ L++ N+LVY  H Y+ S     W + PT  
Sbjct: 197 LIFVEGVQSYNGDSYWWGGNLQGAGQYPVVLNVPNRLVYSAHDYATSVGPQTWFSDPT-- 254
Query: 141 VCYKVTQSFINRAVFLTTRKNPAPLVLSEFGFDQREVNLADNLYMTCLMAYAAET----- 195
                     N+       +N AP+ L EFG   +     D  ++  L+ Y   T     
Sbjct: 255 -FPNNMPGIWNKNWGYLFNQNIAPVWLGEFGTTLQST--TDQTWLKTLVQYLRPTAQYGA 311
Query: 196 -DLDWALWALQGSYYLRGGLKGAEETFGALDSTWQ 229
               W  W+             + +T G L   WQ
Sbjct: 312 DSFQWTFWSWN---------PDSGDTGGILKDDWQ 337
>pdb|1ECE|A Chain A, Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose Length = 358 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query400
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 3e-40
3qho_A458 Endoglucanase, 458AA long hypothetical endo-1,4-be 2e-31
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 8e-16
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 1e-14
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 1e-14
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 6e-14
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 2e-13
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 4e-13
2osx_A481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 4e-13
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 2e-12
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 2e-12
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 2e-12
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 2e-10
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 2e-10
2cks_A306 Endoglucanase E-5; carbohydrate metabolism, polysa 4e-10
1wky_A464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 7e-10
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 7e-10
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 1e-09
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 1e-08
1ceo_A343 Cellulase CELC; glycosyl hydrolase, family A/5 of 2e-08
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 2e-08
3icg_A515 Endoglucanase D; cellulase, xylanase, carbohydrate 2e-08
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 4e-08
1g01_A364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 6e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 2e-05
3a07_A118 Actinohivin; carbohydrate-binding module family 13 2e-05
1uuq_A440 Mannosyl-oligosaccharide glucosidase; hydrolase, m 8e-05
1qnr_A344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 1e-04
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Length = 358 Back     alignment and structure
 Score =  145 bits (368), Expect = 3e-40
 Identities = 56/269 (20%), Positives = 91/269 (33%), Gaps = 40/269 (14%)

Query: 1   MVLLDNHISKPDWCCSNTDGNGFFGDRYFDPNEWMKGLSFVADRFKEKRQVVAISLRNEL 60
            ++LD H             +  +         W+  L  +A R+K    VV   L NE 
Sbjct: 110 RIILDRHRPDCSG------QSALWYTSSVSEATWISDLQALAQRYKGNPTVVGFDLHNEP 163

Query: 61  RGP-----RQNEPDWYKYISEGARVVHKRNPHVLVFVSGLN--------FDLDLRFLQKS 107
             P          DW          V   NP++L+FV G+         +  +L+   + 
Sbjct: 164 HDPACWGCGDPSIDWRLAAERAGNAVLSVNPNLLIFVEGVQSYNGDSYWWGGNLQGAGQY 223

Query: 108 PLALDLDNKLVYEIHWYSFSQDQNMWKTQPTNIVCYKVTQSFINRAVFLTTRKNPAPLVL 167
           P+ L++ N+LVY  H Y+ S     W + PT      +   +     +L   +N AP+ L
Sbjct: 224 PVVLNVPNRLVYSAHDYATSVYPQTWFSDPTF--PNNMPGIWNKNWGYL-FNQNIAPVWL 280

Query: 168 SEFGFDQREVNLADNLYMTCLMAY------AAETDLDWALWALQGSYYLRGGLKGAEETF 221
            EFG   +     D  ++  L+ Y             W  W+               +T 
Sbjct: 281 GEFGTTLQSTT--DQTWLKTLVQYLRPTAQYGADSFQWTFWSWNPDS---------GDTG 329

Query: 222 GALDSTWQHPRNPNFLERLRFLQTKTHVP 250
           G L   WQ          L  +++    P
Sbjct: 330 GILKDDWQTVDTV-KDGYLAPIKSSIFDP 357
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Length = 458 Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Length = 376 Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Length = 380 Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Length = 320 Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Length = 345 Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Length = 302 Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Length = 395 Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Length = 481 Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Length = 317 Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Length = 341 Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Length = 327 Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Length = 305 Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Length = 340 Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Length = 306 Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Length = 464 Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Length = 345 Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Length = 294 Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Length = 303 Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Length = 343 Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Length = 293 Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Length = 364 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Length = 291 Back     alignment and structure
>3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} Length = 118 Back     alignment and structure
>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Length = 440 Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Length = 344 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query400
3qho_A458 Endoglucanase, 458AA long hypothetical endo-1,4-be 100.0
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 100.0
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 100.0
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 99.97
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 99.97
3icg_A515 Endoglucanase D; cellulase, xylanase, carbohydrate 99.97
1ceo_A343 Cellulase CELC; glycosyl hydrolase, family A/5 of 99.97
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 99.96
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 99.96
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 99.96
4hty_A359 Cellulase; (alpha/beta)8 barrel, family 5 endogluc 99.96
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 99.96
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 99.96
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 99.96
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 99.96
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 99.95
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 99.95
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 99.95
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 99.94
1g01_A364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 99.94
2cks_A306 Endoglucanase E-5; carbohydrate metabolism, polysa 99.94
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 99.94
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 99.94
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 99.93
1wky_A464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 99.92
2osx_A481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 99.91
2y8k_A491 Arabinoxylanase, carbohydrate binding family 6; hy 99.88
1h4p_A408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 99.87
3n9k_A399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 99.86
1qnr_A344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 99.75
2d1z_A436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 99.67
4awe_A387 Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana 99.64
2c0h_A353 Mannan endo-1,4-beta-mannosidase; hydrolase, signa 99.63
1rh9_A373 Endo-beta-mannanase; endo-beta-mannase, retaining, 99.62
1uuq_A440 Mannosyl-oligosaccharide glucosidase; hydrolase, m 99.61
3pzg_A383 Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 99.54
3vup_A351 Beta-1,4-mannanase; TIM barrel, digestive fluid, H 99.51
2dry_A130 29-kDa galactose-binding lectin; earthworm lumbric 99.06
3hn3_A613 Beta-G1, beta-glucuronidase; lysosomal enzyme, aci 98.86
3a07_A118 Actinohivin; carbohydrate-binding module family 13 98.86
2ao3_A130 29-kDa galactose-binding lectin; earthworm lumbric 98.8
1ur4_A399 Galactanase; hydrolase, beta-1, glycoside hydrolas 98.63
3lpf_A605 Beta-glucuronidase; alpha/beta barrel, sugar-bindi 98.62
1knl_A130 Endo-1,4-beta-xylanase A; carbohydrate binding mod 98.61
1fob_A334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 98.6
1hjs_A332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 98.47
3cmg_A667 Putative beta-galactosidase; structural genomics, 98.47
2aai_B 262 Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG 98.42
3pg0_A165 Threefoil; symmetric design, beta-trefoil, enginee 98.42
2w61_A555 GAS2P, glycolipid-anchored surface protein 2; glyc 98.33
4ekj_A500 Beta-xylosidase; TIM-barrel fold, hemicellulase, h 98.3
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 98.28
3c9z_A 258 Agglutinin II, SNA-II; beta-trefoil, ricin-B domai 98.25
1abr_B 267 Abrin-A; glycosidase/carbohydrate complex, lectin, 98.23
1m2t_B 263 Mistletoe lectin I B chain; ribosome inactivation, 98.23
3phz_A 286 Ricin B-related lectin; beta trefoil, saccharide b 98.23
1w91_A503 Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 98.22
3fn9_A692 Putative beta-galactosidase; structural genomics, 98.21
1ggp_B 254 TKL-1, protein (lectin 1 B chain); sugar binding p 98.21
3a07_A118 Actinohivin; carbohydrate-binding module family 13 98.15
1vcl_A 432 Hemolytic lectin CEL-III; hemolysis, hemagglutinat 98.12
1vcl_A 432 Hemolytic lectin CEL-III; hemolysis, hemagglutinat 98.1
1uhv_A500 Beta-xylosidase; family 39 glycoside hydrolase, xy 98.09
3vsf_A526 Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactana 98.06
2vlc_A 570 Cinnamomin, type 2 ribosome-inactivating protein c 98.04
1m2t_B263 Mistletoe lectin I B chain; ribosome inactivation, 98.03
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 98.0
1ta3_B303 Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), 98.0
1nq6_A302 XYS1; glycoside hydrolase family 10, xylanase, xyl 97.99
1ggp_B254 TKL-1, protein (lectin 1 B chain); sugar binding p 97.99
3ef2_A 293 Agglutinin, lectin; beta-trefoil, calcium-binding, 97.99
3a21_A614 Putative secreted alpha-galactosidase; beta-alpha- 97.99
1n82_A331 Xylanase, intra-cellular xylanase; hydrolase; 1.45 97.98
3c9z_A258 Agglutinin II, SNA-II; beta-trefoil, ricin-B domai 97.96
1i1w_A303 Endo-1,4-beta-xylanase; xylan degradation, hydrola 97.93
2aai_B262 Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG 97.93
1xyz_A347 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrola 97.9
3cui_A315 EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine 97.88
2dry_A130 29-kDa galactose-binding lectin; earthworm lumbric 97.86
2vlc_A570 Cinnamomin, type 2 ribosome-inactivating protein c 97.84
1v0l_A313 Endo-1,4-beta-xylanase A; glycoside hydrolase fami 97.83
1abr_B267 Abrin-A; glycosidase/carbohydrate complex, lectin, 97.82
2ffu_A501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 97.79
1ur1_A378 Endoxylanase; hydrolase, family 10, glycoside hydr 97.75
2dep_A356 Xylanase B, thermostable celloxylanase; glycosidas 97.71
3bga_A 1010 Beta-galactosidase; NYSGXRC, protein structure ini 97.69
1jz7_A 1023 Lactase, beta-galactosidase, LACZ; TIM barrel (alp 97.69
4aw7_A591 GH86A beta-porphyranase; hydrolase, porphyran-hexa 97.64
2ao3_A130 29-kDa galactose-binding lectin; earthworm lumbric 97.59
3nbc_A148 Ricin B-like lectin; lactose, sugar BIND protein; 97.59
1knl_A130 Endo-1,4-beta-xylanase A; carbohydrate binding mod 97.56
1kwg_A 645 Beta-galactosidase; TIM barrel, glycoside hydrolas 97.51
3pg0_A165 Threefoil; symmetric design, beta-trefoil, enginee 97.5
1yq2_A 1024 Beta-galactosidase; glycosyl hydrolase family 2, T 97.49
3niy_A341 Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.5 97.48
3u7b_A327 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 97.47
3aj6_A286 Main hemagglutinin component; toxin, beta-trefoil; 97.43
3emz_A331 Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 ba 97.38
1w32_A348 Endo-1,4-beta-xylanase A precursor; mutant, calciu 97.38
1us2_A530 Xylanase10C, endo-beta-1,4-xylanase; hydrolase, ca 97.36
1r85_A379 Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A 97.34
3oba_A 1032 Beta-galactosidase; TIM barrel, tetramer, GH2, gly 97.27
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 97.2
3civ_A343 Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. 97.18
2uwf_A356 Endoxylanase, alkaline active endoxylanase; hydrol 97.08
1ybi_A288 HA33A, HA33/A, non-toxin haemagglutinin HA34; beta 97.08
2d1z_A436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 96.98
3vsf_A526 Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactana 96.93
2vse_A 841 MTX holotoxin, mosquitocidal toxin; ADP-ribosyltra 96.9
1qw9_A502 Arabinosidase, alpha-L-arabinofuranosidase; hydrol 96.88
3phz_A286 Ricin B-related lectin; beta trefoil, saccharide b 96.86
2w5f_A540 Endo-1,4-beta-xylanase Y; cellulosome, glycosidase 96.8
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 96.75
3ef2_A293 Agglutinin, lectin; beta-trefoil, calcium-binding, 96.74
2c7f_A513 Alpha-L-arabinofuranosidase; glycosidase, xylan, a 96.66
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 96.59
2ffu_A501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 96.49
2je8_A848 Beta-mannosidase; glycoside hydrolase, hydrolase; 96.45
3gm8_A801 Glycoside hydrolase family 2, candidate beta-GLYC; 96.37
4f8x_A335 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 96.34
3a21_A614 Putative secreted alpha-galactosidase; beta-alpha- 96.24
3vny_A488 Beta-glucuronidase; TIM barrel, greek-KEY, glycosi 96.11
1ug6_A431 Beta-glycosidase; glucosidase, atomic resolution, 96.01
3ik2_A517 Endoglucanase A; TIM-like barrel, hydrolase; 2.20A 95.9
2vse_A 841 MTX holotoxin, mosquitocidal toxin; ADP-ribosyltra 95.57
3aj6_A286 Main hemagglutinin component; toxin, beta-trefoil; 95.45
2y2w_A574 Arabinofuranosidase; hydrolase, arabinoxylan, glyc 95.44
3clw_A507 Conserved exported protein; structural genomics, u 95.42
3tp4_A475 Computational design of enzyme; structural genomic 95.31
1dqg_A135 Mannose receptor; beta trefoil, multilectin recept 94.94
3fj0_A465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 94.82
2v3g_A283 Endoglucanase H; beta-1 4 beta-1 3 glucanase, lich 94.42
3ug3_A504 Alpha-L-arabinofuranosidase; TIM barrel, hydrolase 94.42
2y24_A383 Xylanase; hydrolase, GH5 family, aldotetraouronic 94.38
1ybi_A288 HA33A, HA33/A, non-toxin haemagglutinin HA34; beta 94.07
3ii1_A535 Cellulase; CELM2, glucanase-xyanase, glucanase, xy 93.76
2vx5_A396 Cellvibrio japonicus mannanase cjman26C; hydrolase 93.57
2vrq_A496 Alpha-L-arabinofuranosidase; hydrolase, glycosidas 92.84
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 92.8
1odz_A386 Mannanase A; hydrolase, family 26, glycoside-hydro 92.73
2ddx_A333 Beta-1,3-xylanase; glycoside hydrolase, TIM barrel 92.59
2wnw_A447 Activated by transcription factor SSRB; hydrolase, 92.34
2vzs_A 1032 CSXA, EXO-beta-D-glucosaminidase; hydrolase, GH2, 91.97
1xez_A 721 Hemolysin, cytolysin; pore-forming toxin, Pro-toxi 91.91
2yih_A524 CEL44C, xyloglucanase; hydrolase, GH44, endo-gluca 91.61
1xez_A 721 Hemolysin, cytolysin; pore-forming toxin, Pro-toxi 91.47
2xhy_A479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 91.19
3kzs_A463 Glycosyl hydrolase family 5; structural genomics, 91.08
3nbc_A148 Ricin B-like lectin; lactose, sugar BIND protein; 90.74
2nt0_A497 Glucosylceramidase; cerezyme, glucocerebrosidase, 87.86
1dqg_A135 Mannose receptor; beta trefoil, multilectin recept 86.82
3d3a_A 612 Beta-galactosidase; protein structure initiative I 84.34
3tty_A 675 Beta-GAL, beta-galactosidase; TIM barrel, glycosid 84.29
1qox_A449 Beta-glucosidase; hydrolase, cellulose degradation 83.68
1e4i_A447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 82.86
1sr4_A206 CDT A, cytolethal distending toxin subunit A; bact 81.71
3gyc_A393 Putative glycoside hydrolase; YP_001304622.1, stru 81.09
2o9p_A454 Beta-glucosidase B; family 1 glycoside hydrolase; 80.78
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Back     alignment and structure
Probab=100.00  E-value=1.9e-43  Score=364.82  Aligned_cols=228  Identities=21%  Similarity=0.307  Sum_probs=193.8

Q ss_pred             CeEEecCCCCCCcccCCCCCCCCCCCCCCCHHHHHHHHHHHHHHhcCCCcEEEEeccCCCCCCC----------------
Q 039248            1 MVLLDNHISKPDWCCSNTDGNGFFGDRYFDPNEWMKGLSFVADRFKEKRQVVAISLRNELRGPR----------------   64 (400)
Q Consensus         1 ~VILD~H~~~~~Wcc~~~dgn~~~~d~~~~~d~wi~~W~~lA~ryk~~p~Vvg~DL~NEP~~~~----------------   64 (400)
                      |||||+|.....    . . .+.|.+..++.++|+++|++||+|||++|+|++|||+|||++..                
T Consensus       149 ~VIldlH~~~~~----~-~-~~~W~~~~~~~~~~~~~w~~lA~ryk~~p~Vi~~eL~NEP~~~~~~~~~~~~~~~~~W~~  222 (458)
T 3qho_A          149 FVLLDYHRIGCT----H-I-EPLWYTEDFSEEDFINTWIEVAKRFGKYWNVIGADLKNEPHSVTSPPAAYTDGTGATWGM  222 (458)
T ss_dssp             EEEEEEEESSSS----S-C-CSSSCBTTBCHHHHHHHHHHHHHHHTTSTTEEEEECSSCCCCSSCTTGGGTSSSSCBSSS
T ss_pred             EEEEecccCCCc----c-C-CCccCCchhhHHHHHHHHHHHHHHhCCCCCEEEEEccCCCCcccccccccccccccccCC
Confidence            699999987532    1 1 23444444678999999999999999999999999999999731                


Q ss_pred             -CChhhHHHHHHHHHHHHHhcCCCcEEEEeCCCCCc-----------------cchhhhcCCCcCCCCCcEEEEEeecCC
Q 039248           65 -QNEPDWYKYISEGARVVHKRNPHVLVFVSGLNFDL-----------------DLRFLQKSPLALDLDNKLVYEIHWYSF  126 (400)
Q Consensus        65 -~~~~dW~~~~~~~~~AIr~~nP~~lI~VeG~~~~~-----------------dLs~l~~~Pv~l~~~~~lVYs~H~Y~p  126 (400)
                       .+..+|+.++++++++||++||+++|||+|+.|++                 +|+.+.+.|+.++ .+||||++|+|++
T Consensus       223 ~~~~~~w~~~~~~ai~aIRa~dp~~lIiv~G~~w~~~~~~~~~~~~~~~wwg~~l~~v~~~Pi~l~-~~nlvYs~H~Y~~  301 (458)
T 3qho_A          223 GNPATDWNLAAERIGKAILKVAPHWLIFVEGTQFTNPKTDSSYKWGYNAWWGGNLMAVKDYPVNLP-RNKLVYSPHVFGP  301 (458)
T ss_dssp             SCTTTBHHHHHHHHHHHHHHHCTTCEEEECCBSCCCHHHHHTSTTTTCCCTTCBCGGGTTSCCCSC-TTTEEECCBCCCT
T ss_pred             CCcHHHHHHHHHHHHHHHHHhCCCCEEEEcCCcccCccccccccccccCcCCCCchhhhcCCCcCC-CCCEEEEEEECCC
Confidence             12468999999999999999999999999999865                 8999999999876 6999999999999


Q ss_pred             CCCCCcccCCCCchhhhhHHHHHHhhHHHHhhcCCCCCEEEeccCCCCCC-CChhhHHHHHHHHHHHHHCCC-ceEEecc
Q 039248          127 SQDQNMWKTQPTNIVCYKVTQSFINRAVFLTTRKNPAPLVLSEFGFDQRE-VNLADNLYMTCLMAYAAETDL-DWALWAL  204 (400)
Q Consensus       127 s~~~~~W~~~~~~~~~~~~~~~~~~~~gfl~~~~~g~Pv~iGEFG~~~~~-~~~~d~~w~~~~l~~l~~~gi-~wa~Wa~  204 (400)
                      +++.++|+..+ ...|.++.+.|++.++|+.+ ++++||||||||+.+.. .+..+.+|++++++||++++| +|++|++
T Consensus       302 ~~~~~~~~~~~-~~~~~~~~~~w~~~~g~l~~-~~~~Pl~igEfG~~~~~g~~~~~~~w~~~~~~yl~~~~i~~w~~W~~  379 (458)
T 3qho_A          302 DVYNQPYFGPA-KGFPDNLPDIWYHHFGYVKL-ELGYSVVIGEFGGKYGHGGDPRDVIWQNKLVDWMIENKFCDFFYWSW  379 (458)
T ss_dssp             TTCCCGGGSGG-GTTTTTHHHHHHHHTTHHHH-TTCCCBCBCBCCCCTTSSSCTHHHHHHHHHHHHHHHTTCCCEEESCS
T ss_pred             CCCCCccccCc-cchHHHHHHHHHhhhhhHhh-cCCCcEEEEecCCCcCCCCCcchHHHHHHHHHHHHhcCCCCEEEEec
Confidence            99888998543 23467888999999999974 58999999999999853 444578999999999999997 8999999


Q ss_pred             CccccccCCCCCCCCccccccCCCCCCCChhHHHHHHHhhhcccCC
Q 039248          205 QGSYYLRGGLKGAEETFGALDSTWQHPRNPNFLERLRFLQTKTHVP  250 (400)
Q Consensus       205 ~Gsyy~r~g~~~~~et~Gll~~dW~t~r~~~~l~rl~~l~~~~~~p  250 (400)
                      +         |+++||+|||++||++++.+    ++++|++.+...
T Consensus       380 n---------p~s~dt~Gll~~dW~t~~~~----k~~~l~~~~~~~  412 (458)
T 3qho_A          380 N---------PDSGDTGGILQDDWTTIWED----KYNNLKRLMDSC  412 (458)
T ss_dssp             S---------SCCTTTCCSBCTTSSSBCHH----HHHHHGGGGC--
T ss_pred             C---------CCCCCCCcccccccCCcChH----HHHHHHHHhccc
Confidence            9         78899999999999999998    568888888553
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Back     alignment and structure
>4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Back     alignment and structure
>2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} Back     alignment and structure
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Back     alignment and structure
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} Back     alignment and structure
>2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 Back     alignment and structure
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Back     alignment and structure
>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Back     alignment and structure
>3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* Back     alignment and structure
>3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} Back     alignment and structure
>2dry_A 29-kDa galactose-binding lectin; earthworm lumbricus terrestris, sialic acid, in vitro evolution, beta-trefoil fold, sugar binding protein; HET: PGE; 1.80A {Lumbricus terrestris} PDB: 2drz_A* 2ds0_A* 2zqn_A* 2zqo_A* Back     alignment and structure
>3hn3_A Beta-G1, beta-glucuronidase; lysosomal enzyme, acid hydrolase, glycosidase, disease mutat glycoprotein, hydrolase, lysosome, mucopolysaccharidosis; HET: NDG NAG BMA MAN GUP; 1.70A {Homo sapiens} PDB: 1bhg_A* Back     alignment and structure
>3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>3lpf_A Beta-glucuronidase; alpha/beta barrel, sugar-binding domain, beta-sandwich domai glycosyl hydrolase, glycosida hydrolase; HET: Z77; 2.26A {Escherichia coli} PDB: 3k46_A* 3k4d_A* 3lpg_A* 3k4a_A Back     alignment and structure
>1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>3cmg_A Putative beta-galactosidase; structural genomics, PSI-2, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides fragilis} Back     alignment and structure
>2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* Back     alignment and structure
>3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} Back     alignment and structure
>2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* Back     alignment and structure
>4ekj_A Beta-xylosidase; TIM-barrel fold, hemicellulase, hydrolase; 2.50A {Caulobacter vibrioides} Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure
>3c9z_A Agglutinin II, SNA-II; beta-trefoil, ricin-B domain, glycosylation, glycoprotein, L sugar binding protein, plant protein; HET: NAG FUC SO4; 1.35A {Sambucus nigra} PDB: 3ca0_A* 3ca1_A* 3ca3_A* 3ca4_A* 3ca5_A* 3ca6_A* 3cah_A* 1hwm_B* 1hwn_B* 1hwo_B* 1hwp_B* Back     alignment and structure
>1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* Back     alignment and structure
>1m2t_B Mistletoe lectin I B chain; ribosome inactivation, ribosome inhibitor, hydrolase; HET: NAG FUC ADE; 1.89A {Viscum album} SCOP: b.42.2.1 b.42.2.1 PDB: 2r9k_B* 3d7w_B* 3cef_B* 1sz6_B* 1pum_B* 1puu_B* 2rg9_B* 3o5w_B* 1onk_B* 1oql_B* 1tfm_B* 1pc8_B* 1yf8_B* 1ce7_B* 2mll_B* Back     alignment and structure
>3phz_A Ricin B-related lectin; beta trefoil, saccharide binding lectin, 2,6-sialyl-lactosam sugar binding protein; HET: NAG GAL SIA; 1.70A {Polyporus squamosus} Back     alignment and structure
>1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* Back     alignment and structure
>3fn9_A Putative beta-galactosidase; structural genomics, glycosidas hydrolase, PSI-2, protein structure initiative; 2.70A {Bacteroides fragilis} Back     alignment and structure
>1ggp_B TKL-1, protein (lectin 1 B chain); sugar binding protein; 2.70A {Trichosanthes kirilowii} SCOP: b.42.2.1 b.42.2.1 Back     alignment and structure
>3a07_A Actinohivin; carbohydrate-binding module family 13, antiviral protein, LE; 1.19A {Actinomycete} Back     alignment and structure
>1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* Back     alignment and structure
>1vcl_A Hemolytic lectin CEL-III; hemolysis, hemagglutination, pore-forming, calcium, toxin; HET: BTB; 1.70A {Cucumaria echinata} SCOP: b.42.2.1 b.42.2.1 d.281.1.1 PDB: 2z48_A* 2z49_A* Back     alignment and structure
>1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A Back     alignment and structure
>3vsf_A Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactanase, sugar binding protein; 2.76A {Clostridium thermocellum} PDB: 3vsz_A* 3vt0_A* 3vt1_B* 3vt2_A* Back     alignment and structure
>2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} Back     alignment and structure
>1m2t_B Mistletoe lectin I B chain; ribosome inactivation, ribosome inhibitor, hydrolase; HET: NAG FUC ADE; 1.89A {Viscum album} SCOP: b.42.2.1 b.42.2.1 PDB: 2r9k_B* 3d7w_B* 3cef_B* 1sz6_B* 1pum_B* 1puu_B* 2rg9_B* 3o5w_B* 1onk_B* 1oql_B* 1tfm_B* 1pc8_B* 1yf8_B* 1ce7_B* 2mll_B* Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
>1ta3_B Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Emericella nidulans} SCOP: c.1.8.3 Back     alignment and structure
>1nq6_A XYS1; glycoside hydrolase family 10, xylanase, xylan degradation,, hydrolase; 1.78A {Streptomyces halstedii} SCOP: c.1.8.3 Back     alignment and structure
>1ggp_B TKL-1, protein (lectin 1 B chain); sugar binding protein; 2.70A {Trichosanthes kirilowii} SCOP: b.42.2.1 b.42.2.1 Back     alignment and structure
>3ef2_A Agglutinin, lectin; beta-trefoil, calcium-binding, carbohydrate-binding, sugar-binding, sugar binding protein; HET: FUC GAL GLA; 1.80A {Marasmius oreades} PDB: 2iho_A* Back     alignment and structure
>3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* Back     alignment and structure
>1n82_A Xylanase, intra-cellular xylanase; hydrolase; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 3mua_A* 2q8x_A* 3msd_A* 3msg_A* 3mui_A* 3ms8_A Back     alignment and structure
>3c9z_A Agglutinin II, SNA-II; beta-trefoil, ricin-B domain, glycosylation, glycoprotein, L sugar binding protein, plant protein; HET: NAG FUC SO4; 1.35A {Sambucus nigra} PDB: 3ca0_A* 3ca1_A* 3ca3_A* 3ca4_A* 3ca5_A* 3ca6_A* 3cah_A* 1hwm_B* 1hwn_B* 1hwo_B* 1hwp_B* Back     alignment and structure
>1i1w_A Endo-1,4-beta-xylanase; xylan degradation, hydrolase, glycosidase, enzyme, ultra HIG resolution, cryo temperature, 1; HET: PCA; 0.89A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1i1x_A* 2bnj_A* 1gok_A 1gom_A 1goo_A 1goq_A* 1gor_A* 1k6a_A 3o2l_A 3nyd_A* 1tux_A 1b31_A 1b30_A 1b3v_A* 1b3w_A* 1b3x_A* 1b3y_A* 1b3z_A* 1bg4_A Back     alignment and structure
>2aai_B Ricin (B chain); glycosidase; HET: GAL BGC NDG NAG BMA MAN; 2.50A {Ricinus communis} SCOP: b.42.2.1 b.42.2.1 PDB: 3rti_B* 3rtj_B* 1rzo_B* Back     alignment and structure
>1xyz_A 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrolase, xylanase, family F/10 of glycosyl hydrolases, glycosyltransferase; 1.40A {Clostridium thermocellum} SCOP: c.1.8.3 Back     alignment and structure
>3cui_A EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine inhibitor, TIM barrel, cellulose degradation, glycosidase, hydrolase; HET: X4S; 1.50A {Cellulomonas fimi} PDB: 3cug_A* 3cuh_A* 3cuf_A* 3cuj_A* 1fh9_A* 1fh7_A 1fh8_A 1exp_A* 1fhd_A* 1j01_A* 2exo_A 2xyl_A 2his_A* Back     alignment and structure
>2dry_A 29-kDa galactose-binding lectin; earthworm lumbricus terrestris, sialic acid, in vitro evolution, beta-trefoil fold, sugar binding protein; HET: PGE; 1.80A {Lumbricus terrestris} PDB: 2drz_A* 2ds0_A* 2zqn_A* 2zqo_A* Back     alignment and structure
>2vlc_A Cinnamomin, type 2 ribosome-inactivating protein cinnamomin III; ribosome inhibiting proteins, toxin, hydrolase, plant defense; HET: AS5 BMA XYP XYS; 2.95A {Cinnamomum camphora} Back     alignment and structure
>1v0l_A Endo-1,4-beta-xylanase A; glycoside hydrolase family 10, xylan degradation, isofagomine, hydrolase; 0.98A {Streptomyces lividans} SCOP: c.1.8.3 PDB: 1e0x_A 1e0w_A* 1od8_A 1v0k_A 1v0m_A 1v0n_A 1e0v_A* 1xas_A 2g3i_A 2g3j_A* 2g4f_A 1v6y_A Back     alignment and structure
>1abr_B Abrin-A; glycosidase/carbohydrate complex, lectin, lectin (agglutinin), glycoprotein, plant SEED protein, plant toxin; HET: NDG NGZ MAN BMA BGC; 2.14A {Abrus precatorius} SCOP: b.42.2.1 b.42.2.1 PDB: 2zr1_B* 2q3n_B* Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
>1ur1_A Endoxylanase; hydrolase, family 10, glycoside hydrolase, hemicellulose, xylan degradation; HET: XYS AHR; 1.43A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uqy_A* 1uqz_A* 1ur2_A* 2cnc_A* Back     alignment and structure
>2dep_A Xylanase B, thermostable celloxylanase; glycosidase, xylan degradation, family 10, structural genomics, NPPSFA; 1.80A {Clostridium stercorarium} Back     alignment and structure
>3bga_A Beta-galactosidase; NYSGXRC, protein structure initiative II (PSI-II), glycosyl hydrolase family 2, jelly-roll fold; 2.10A {Bacteroides thetaiotaomicron vpi-5482} PDB: 3dec_A Back     alignment and structure
>1jz7_A Lactase, beta-galactosidase, LACZ; TIM barrel (alpha/beta barrel), jelly-roll barrel, immunoglobulin, beta supersandwich, hydrolase; HET: GAL; 1.50A {Escherichia coli} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 PDB: 1hn1_A 1jyx_A* 1jz3_A* 1jz4_A* 1jz5_A* 1jz6_A* 1dp0_A* 3iap_A* 1jz8_A* 1jyn_A* 1jyv_A* 1jyw_A* 3iaq_A* 1px3_A 1px4_A* 3czj_A* 3i3e_A 3i3d_A* 3i3b_A 3dym_A ... Back     alignment and structure
>4aw7_A GH86A beta-porphyranase; hydrolase, porphyran-hexa-oligosaccharide, complex; HET: GLA GAL L6S AAL; 1.33A {Bacteroides plebeius} Back     alignment and structure
>3nbc_A Ricin B-like lectin; lactose, sugar BIND protein; HET: LAT; 1.01A {Clitocybe nebularis} PDB: 3nbd_A* 3nbe_A* Back     alignment and structure
>1knl_A Endo-1,4-beta-xylanase A; carbohydrate binding module, CBM13 xylan binding domain, LEC ricin B-like, beta-trefoil fold, hydrolase; 1.20A {Streptomyces lividans} SCOP: b.42.2.1 PDB: 1knm_A* 1mc9_A* Back     alignment and structure
>1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* Back     alignment and structure
>3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} Back     alignment and structure
>1yq2_A Beta-galactosidase; glycosyl hydrolase family 2, TIM barrel, hexamer; 1.90A {Arthrobacter SP} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 Back     alignment and structure
>3niy_A Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.58A {Thermotoga petrophila rku-1} SCOP: c.1.8.3 PDB: 3nj3_A* 1vbr_A* 1vbu_A Back     alignment and structure
>3u7b_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA MAN; 1.94A {Fusarium oxysporum} Back     alignment and structure
>3aj6_A Main hemagglutinin component; toxin, beta-trefoil; HET: NGA; 1.48A {Clostridium botulinum} PDB: 1qxm_A 3aj5_A* 2ehm_A* 2ehi_A* 2ehn_A* 3ah1_A* 3ah2_A* 3ah4_A* 2e4m_A Back     alignment and structure
>3emz_A Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 barrel, GH10 enzyme complex, hydrolase; HET: HXH; 2.08A {Bacillus SP} SCOP: c.1.8.3 PDB: 3emq_A* 3emc_A* Back     alignment and structure
>1w32_A Endo-1,4-beta-xylanase A precursor; mutant, calcium ION, thermostable, glycosyle hydrolase, family 10, error prone PCR, hydrolase; 1.2A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1w2p_A 1w2v_A 1w3h_A 1clx_A 1e5n_A* 1xys_A Back     alignment and structure
>1us2_A Xylanase10C, endo-beta-1,4-xylanase; hydrolase, carbohydrate binding module, xylan degradation; HET: XYP; 1.85A {Cellvibrio japonicus} SCOP: b.18.1.11 c.1.8.3 PDB: 1us3_A Back     alignment and structure
>1r85_A Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 1hiz_A* 1r87_A* 3mmd_A* 1r86_A Back     alignment and structure
>3oba_A Beta-galactosidase; TIM barrel, tetramer, GH2, glycosidase, hydrolase; 2.75A {Kluyveromyces lactis} PDB: 3ob8_A Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Back     alignment and structure
>3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2uwf_A Endoxylanase, alkaline active endoxylanase; hydrolase, xylan degradation, xylanase structure, glycosidase, alkaliphilic; 2.10A {Bacillus halodurans} PDB: 2f8q_A 2fgl_A* Back     alignment and structure
>1ybi_A HA33A, HA33/A, non-toxin haemagglutinin HA34; beta-trefoil; 1.50A {Clostridium botulinum} Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>3vsf_A Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactanase, sugar binding protein; 2.76A {Clostridium thermocellum} PDB: 3vsz_A* 3vt0_A* 3vt1_B* 3vt2_A* Back     alignment and structure
>2vse_A MTX holotoxin, mosquitocidal toxin; ADP-ribosyltransferase, lectin, ricin-B-like domain; 2.5A {Lysinibacillus sphaericus} PDB: 2vsa_A Back     alignment and structure
>1qw9_A Arabinosidase, alpha-L-arabinofuranosidase; hydrolase; HET: KHP; 1.20A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 1pz2_A* 1qw8_A* 1pz3_A Back     alignment and structure
>3phz_A Ricin B-related lectin; beta trefoil, saccharide binding lectin, 2,6-sialyl-lactosam sugar binding protein; HET: NAG GAL SIA; 1.70A {Polyporus squamosus} Back     alignment and structure
>2w5f_A Endo-1,4-beta-xylanase Y; cellulosome, glycosidase, xylan degradation, hydrolase; HET: XYP; 1.90A {Clostridium thermocellum} PDB: 2wze_A* 2wys_A* Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure
>3ef2_A Agglutinin, lectin; beta-trefoil, calcium-binding, carbohydrate-binding, sugar-binding, sugar binding protein; HET: FUC GAL GLA; 1.80A {Marasmius oreades} PDB: 2iho_A* Back     alignment and structure
>2c7f_A Alpha-L-arabinofuranosidase; glycosidase, xylan, arabinan, hydrolase; HET: AHR; 2.7A {Clostridium thermocellum} SCOP: b.71.1.2 c.1.8.3 PDB: 2c8n_A Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
>2je8_A Beta-mannosidase; glycoside hydrolase, hydrolase; HET: B3P; 1.7A {Bacteroides thetaiotaomicron} SCOP: b.1.4.1 b.1.4.1 b.1.4.1 b.18.1.5 c.1.8.3 PDB: 2vr4_A* 2vl4_A* 2vmf_A* 2vo5_A* 2vot_A* 2vqt_A* 2vjx_A* 2vqu_A* 2wbk_A* Back     alignment and structure
>3gm8_A Glycoside hydrolase family 2, candidate beta-GLYC; structural genomics, glycosidase, PSI-2, protein initiative; 2.40A {Bacteroides vulgatus} Back     alignment and structure
>4f8x_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA; 1.47A {Penicillium canescens} Back     alignment and structure
>3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* Back     alignment and structure
>3vny_A Beta-glucuronidase; TIM barrel, greek-KEY, glycoside hydrolase family 79, hydrol; 1.50A {Acidobacterium capsulatum} PDB: 3vnz_A* 3vo0_A* Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Back     alignment and structure
>3ik2_A Endoglucanase A; TIM-like barrel, hydrolase; 2.20A {Clostridium acetobutylicum} Back     alignment and structure
>2vse_A MTX holotoxin, mosquitocidal toxin; ADP-ribosyltransferase, lectin, ricin-B-like domain; 2.5A {Lysinibacillus sphaericus} PDB: 2vsa_A Back     alignment and structure
>3aj6_A Main hemagglutinin component; toxin, beta-trefoil; HET: NGA; 1.48A {Clostridium botulinum} PDB: 1qxm_A 3aj5_A* 2ehm_A* 2ehi_A* 2ehn_A* 3ah1_A* 3ah2_A* 3ah4_A* 2e4m_A Back     alignment and structure
>2y2w_A Arabinofuranosidase; hydrolase, arabinoxylan, glycoside hydrolase family 51; 2.50A {Bifidobacterium longum} Back     alignment and structure
>3clw_A Conserved exported protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3tp4_A Computational design of enzyme; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.98A {Synthetic construct} PDB: 2x2y_A 2bvy_A 2bvt_A Back     alignment and structure
>1dqg_A Mannose receptor; beta trefoil, multilectin receptor, pituitary hormones, sulfated carbohydrate, sugar binding protein; 1.70A {Mus musculus} SCOP: b.42.2.2 PDB: 1dqo_A* 1fwu_A* 1fwv_A* Back     alignment and structure
>2v3g_A Endoglucanase H; beta-1 4 beta-1 3 glucanase, lichenase, hydrolase, glycosidase, glycoside hydrolase family 26; HET: BGC NOY; 1.20A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 2bv9_A 2bvd_A* 2cip_A* 2cit_A* 2vi0_A* Back     alignment and structure
>3ug3_A Alpha-L-arabinofuranosidase; TIM barrel, hydrolase; 1.80A {Thermotoga maritima} PDB: 3ug4_A* 3ug5_A* 3s2c_A 4atw_A Back     alignment and structure
>2y24_A Xylanase; hydrolase, GH5 family, aldotetraouronic acid; HET: XYP GCV PG4 PGE; 1.39A {Erwinia chrysanthemi} PDB: 1nof_A* Back     alignment and structure
>1ybi_A HA33A, HA33/A, non-toxin haemagglutinin HA34; beta-trefoil; 1.50A {Clostridium botulinum} Back     alignment and structure
>3ii1_A Cellulase; CELM2, glucanase-xyanase, glucanase, xylanase, bifunctional enzyme, hydrolase; HET: BGC; 2.25A {Uncultured bacterium} PDB: 3fw6_A Back     alignment and structure
>2vx5_A Cellvibrio japonicus mannanase cjman26C; hydrolase; HET: BMA; 1.47A {Cellvibrio japonicus} PDB: 2vx4_A* 2vx6_A* 2vx7_A* Back     alignment and structure
>2vrq_A Alpha-L-arabinofuranosidase; hydrolase, glycosidase; HET: XYP; 2.00A {Thermobacillus xylanilyticus} PDB: 2vrk_A Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Back     alignment and structure
>1odz_A Mannanase A; hydrolase, family 26, glycoside-hydrolase, glycosynthase, manno-oligosaccharide; HET: MAN BMA; 1.4A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1r7o_A* 2whm_A* 1j9y_A 1gvy_A* 1gw1_A* Back     alignment and structure
>2ddx_A Beta-1,3-xylanase; glycoside hydrolase, TIM barrel, hydrola; 0.86A {Vibrio SP} Back     alignment and structure
>2wnw_A Activated by transcription factor SSRB; hydrolase, salmonella typhimurium, O-glycosyl hydrolase family 30; 2.00A {Salmonella enterica subsp} Back     alignment and structure
>2vzs_A CSXA, EXO-beta-D-glucosaminidase; hydrolase, GH2, glucosamine, glycoside hydrolase; HET: GCS; 1.85A {Amycolatopsis orientalis} SCOP: b.1.4.1 b.1.4.1 b.1.4.1 b.18.1.5 c.1.8.3 PDB: 2x05_A* 2x09_A* 2vzo_A 2vzt_A* 2vzv_A* 2vzu_A* Back     alignment and structure
>1xez_A Hemolysin, cytolysin; pore-forming toxin, Pro-toxin, water- soluble monomer, beta-prism, beta-trefoil; HET: BOG; 2.30A {Vibrio cholerae} PDB: 3o44_A Back     alignment and structure
>2yih_A CEL44C, xyloglucanase; hydrolase, GH44, endo-glucanase, carbohydrate-binding protei; HET: BGC; 1.70A {Paenibacillus polymyxa} PDB: 2yjq_A* 2ykk_A* 3zq9_A* Back     alignment and structure
>1xez_A Hemolysin, cytolysin; pore-forming toxin, Pro-toxin, water- soluble monomer, beta-prism, beta-trefoil; HET: BOG; 2.30A {Vibrio cholerae} PDB: 3o44_A Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Back     alignment and structure
>3kzs_A Glycosyl hydrolase family 5; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3nbc_A Ricin B-like lectin; lactose, sugar BIND protein; HET: LAT; 1.01A {Clitocybe nebularis} PDB: 3nbd_A* 3nbe_A* Back     alignment and structure
>2nt0_A Glucosylceramidase; cerezyme, glucocerebrosidase, glucosylceramide, hydrolysis, disease, hydrolase; HET: NAG; 1.79A {Homo sapiens} SCOP: b.71.1.2 c.1.8.3 PDB: 1y7v_A* 2f61_A* 2j25_A* 2nsx_A* 1ogs_A* 2nt1_A* 3gxd_A* 3gxf_A* 3gxi_A* 3gxm_A* 3rik_A* 3ril_A* 2v3f_A* 2v3e_A* 2v3d_A* 2vt0_A* 2wcg_A* 2xwd_A* 2xwe_A* 2wkl_A* ... Back     alignment and structure
>1dqg_A Mannose receptor; beta trefoil, multilectin receptor, pituitary hormones, sulfated carbohydrate, sugar binding protein; 1.70A {Mus musculus} SCOP: b.42.2.2 PDB: 1dqo_A* 1fwu_A* 1fwv_A* Back     alignment and structure
>3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Back     alignment and structure
>1sr4_A CDT A, cytolethal distending toxin subunit A; bacterial, virulence, DNA damage, genotoxin, cytotoxins, cell cycle, apoptosis, lectin; 2.00A {Haemophilus ducreyi} SCOP: b.42.2.1 PDB: 2f2f_A Back     alignment and structure
>3gyc_A Putative glycoside hydrolase; YP_001304622.1, structural GEN joint center for structural genomics, JCSG; HET: MSE; 1.85A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 400
d1ecea_358 c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellul 2e-18
d1edga_380 c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellu 2e-16
d1h1na_305 c.1.8.3 (A:) Endocellulase EngI {Thermoascus auran 1e-12
d1vjza_325 c.1.8.3 (A:) Endoglucanase homologue TM1752 {Therm 2e-12
d1bqca_302 c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca 7e-12
d1ceoa_340 c.1.8.3 (A:) Endoglucanase CelC {Clostridium therm 1e-11
d1tvna1293 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalter 2e-08
d1g01a_357 c.1.8.3 (A:) Alkaline cellulase K catalytic domain 2e-08
d1egza_291 c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysant 7e-08
d7a3ha_300 c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradh 9e-08
d1qnra_344 c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [T 1e-06
d1wkya2297 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JA 7e-06
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Length = 358 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: beta-glycanases
domain: Endocellulase E1
species: Acidothermus cellulolyticus [TaxId: 28049]

 Score = 84.0 bits (206), Expect = 2e-18
 Identities = 52/254 (20%), Positives = 83/254 (32%), Gaps = 34/254 (13%)

Query: 13  WCCSNTDGNGFFGDRYFDPNEWMKGLSFVADRFKEKRQVVAISLRNELRGP-----RQNE 67
                +  +  +         W+  L  +A R+K    VV   L NE   P         
Sbjct: 116 HRPDCSGQSALWYTSSVSEATWISDLQALAQRYKGNPTVVGFDLHNEPHDPACWGCGDPS 175

Query: 68  PDWYKYISEGARVVHKRNPHVLVFVSGLNFDL--------DLRFLQKSPLALDLDNKLVY 119
            DW          V   NP++L+FV G+            +L+   + P+ L++ N+LVY
Sbjct: 176 IDWRLAAERAGNAVLSVNPNLLIFVEGVQSYNGDSYWWGGNLQGAGQYPVVLNVPNRLVY 235

Query: 120 EIHWYSFSQDQNMWKTQPTNIVCYKVTQSFINRAVFLTTRKNPAPLVLSEFGFDQREVNL 179
             H Y+ S     W + PT            N+       +N AP+ L EFG   +    
Sbjct: 236 SAHDYATSVYPQTWFSDPT---FPNNMPGIWNKNWGYLFNQNIAPVWLGEFGTTLQSTT- 291

Query: 180 ADNLYMTCLMAY------AAETDLDWALWALQGSYYLRGGLKGAEETFGALDSTWQHPRN 233
            D  ++  L+ Y             W  W+               +T G L   WQ    
Sbjct: 292 -DQTWLKTLVQYLRPTAQYGADSFQWTFWSWNPDS---------GDTGGILKDDWQTVDT 341

Query: 234 PNFLERLRFLQTKT 247
                 L  +++  
Sbjct: 342 VK-DGYLAPIKSSI 354
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Length = 380 Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Length = 305 Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Length = 325 Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Length = 302 Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Length = 340 Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Length = 293 Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Length = 357 Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Length = 291 Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Length = 300 Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Length = 344 Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Length = 297 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query400
d1ecea_358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 100.0
d1ceoa_340 Endoglucanase CelC {Clostridium thermocellum [TaxI 99.97
d1g01a_357 Alkaline cellulase K catalytic domain {Bacillus sp 99.96
d1tvna1293 Endoglucanase Cel5a {Pseudoalteromonas haloplankti 99.96
d1egza_291 Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 99.96
d1h1na_305 Endocellulase EngI {Thermoascus aurantiacus [TaxId 99.95
d1edga_380 Endoglucanase CelA {Clostridium cellulolyticum [Ta 99.95
d7a3ha_300 Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId 99.95
d1vjza_325 Endoglucanase homologue TM1752 {Thermotoga maritim 99.95
d1wkya2297 Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 99.94
d1bqca_302 Beta-mannanase {Thermomonospora fusca [TaxId: 2021 99.93
d2pb1a1394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 99.82
d1qnra_344 Beta-mannanase {Trichoderma reesei [TaxId: 51453]} 99.75
d1h4pa_408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 99.67
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 99.61
d2c0ha1350 endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed 99.51
d1uuqa_410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 99.3
d1ur4a_387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 99.07
d1uhva2346 Beta-D-xylosidase, catalytic domain {Thermoanaerob 98.89
d1hjsa_332 Beta-1,4-galactanase {Thielavia heterothallica, ak 98.88
d1foba_334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 98.85
d2zqna1130 29-kDa galactose-binding lectin {Lumbricus terrest 98.81
d1ggpb2128 Plant cytotoxin B-chain (lectin) {Mongolian snake- 98.8
d1bhga3304 beta-Glucuronidase, domain 3 {Human (Homo sapiens) 98.73
d1knma_129 Xylan binding domain, CBM13 (Endo-1,4-beta-xylanas 98.71
d1xhba1131 Polypeptide N-acetylgalactosaminyltransferase 1, C 98.69
d1vcla2133 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 98.62
d1vcla1150 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 98.57
d1abrb2127 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 98.55
d1m2tb2126 Plant cytotoxin B-chain (lectin) {European mistlet 98.53
d2aaib2127 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 98.49
d1dqga_134 Mannose receptor {Mouse (Mus musculus) [TaxId: 100 98.49
d1vbua1324 Xylanase {Thermotoga maritima [TaxId: 2336]} 98.46
d1xyza_320 Xylanase {Clostridium thermocellum, XynZ [TaxId: 1 98.43
d1nq6a_302 Xylanase A, catalytic core {Streptomyces halstedii 98.42
d1hwmb2131 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 98.41
d1fh9a_312 Xylanase A, catalytic core {Cellulomonas fimi [Tax 98.41
d1ggpb1126 Plant cytotoxin B-chain (lectin) {Mongolian snake- 98.4
d1hwmb1133 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 98.4
d1n82a_330 Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId 98.21
d1rzob1135 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 98.08
d1v0la_302 Xylanase A, catalytic core {Streptomyces lividans 98.05
d1m2tb1136 Plant cytotoxin B-chain (lectin) {European mistlet 97.99
d1abrb1140 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 97.96
d1us3a2364 Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] 97.93
d1qxma1145 Hemagglutinin component Ha1 {Clostridium botulinum 97.68
d1m2tb2126 Plant cytotoxin B-chain (lectin) {European mistlet 97.66
d1knma_129 Xylan binding domain, CBM13 (Endo-1,4-beta-xylanas 97.61
d1ggpb2128 Plant cytotoxin B-chain (lectin) {Mongolian snake- 97.56
d1ta3b_301 Xylanase A, catalytic core {Emericella nidulans (A 97.56
d2ihoa1154 Agglutinin MOA, N-terminal domain {Fairy-ring mush 97.55
d1hwmb2131 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 97.55
d1xhba1131 Polypeptide N-acetylgalactosaminyltransferase 1, C 97.54
d1qxma2138 Hemagglutinin component Ha1 {Clostridium botulinum 97.51
d1vcla2133 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 97.49
d2zqna1130 29-kDa galactose-binding lectin {Lumbricus terrest 97.37
d1ggpb1126 Plant cytotoxin B-chain (lectin) {Mongolian snake- 97.37
d1abrb2127 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 97.25
d2v3ga1273 Endoglucanase H N-terminal domain {Clostridium the 97.24
d2aaib2127 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 97.2
d1i1wa_303 Xylanase A, catalytic core {Thermoascus aurantiacu 97.2
d1dqga_134 Mannose receptor {Mouse (Mus musculus) [TaxId: 100 97.19
d1upsa2131 GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosi 97.12
d1sr4a_167 Cytolethal distending toxin subunit A {Haemophilus 97.1
d1m2tb1136 Plant cytotoxin B-chain (lectin) {European mistlet 97.07
d1ur1a_350 Xylanase {Cellvibrio mixtus [TaxId: 39650]} 96.97
d1sr4a_167 Cytolethal distending toxin subunit A {Haemophilus 96.87
d1hwmb1133 Plant cytotoxin B-chain (lectin) {Sambucus ebulus, 96.77
d1rzob1135 Plant cytotoxin B-chain (lectin) {Castor bean (Ric 96.73
d1vcla1150 Hemolytic lectin CEL-III, domains 1 and 2 {Cucumar 96.63
d1abrb1140 Plant cytotoxin B-chain (lectin) {Abrus precatoriu 96.63
d1w32a_346 Xylanase A, catalytic core {Pseudomonas fluorescen 96.59
d1yq2a5297 beta-Galactosidase, domain 3 {Arthrobacter sp. c2- 96.36
d1r85a_371 Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 96.24
d1qxma2138 Hemagglutinin component Ha1 {Clostridium botulinum 95.96
d1jz8a5292 beta-Galactosidase, domain 3 {Escherichia coli [Ta 95.29
d1qxma1145 Hemagglutinin component Ha1 {Clostridium botulinum 95.06
d1qw9a2367 Alpha-L-arabinofuranosidase, catalytic domain {Bac 95.0
d2ihoa1154 Agglutinin MOA, N-terminal domain {Fairy-ring mush 94.58
d2nt0a2354 Glucosylceramidase, catalytic domain {Human (Homo 93.96
d2vzsa5339 Exochitosanase CsxA {Amycolatopsis orientalis [Tax 93.89
d1upsa2131 GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosi 92.75
d1nofa2277 Glycosyl hydrolase family 5 xylanase, catalytic do 92.29
d2bvya2366 Mannanase A, ManA {Cellulomonas fimi [TaxId: 1708] 91.39
d1odza_381 Mannanase A, ManA {Pseudomonas cellulosa (Cellvibr 85.67
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: beta-glycanases
domain: Endocellulase E1
species: Acidothermus cellulolyticus [TaxId: 28049]

Probab=100.00  E-value=5.1e-32  Score=263.23  Aligned_cols=227  Identities=24%  Similarity=0.445  Sum_probs=171.2

Q ss_pred             CeEEecCCCCCCcccCCCCCCCCCCCCCCCHHHHHHHHHHHHHHhcCCCcEEEEeccCCCCCCC-----CChhhHHHHHH
Q 039248            1 MVLLDNHISKPDWCCSNTDGNGFFGDRYFDPNEWMKGLSFVADRFKEKRQVVAISLRNELRGPR-----QNEPDWYKYIS   75 (400)
Q Consensus         1 ~VILD~H~~~~~Wcc~~~dgn~~~~d~~~~~d~wi~~W~~lA~ryk~~p~Vvg~DL~NEP~~~~-----~~~~dW~~~~~   75 (400)
                      +||||+|...+.      ..+.+|.+.....+.|+++|+.||+|||++|+|++|||+|||+.+.     .....|.++++
T Consensus       110 ~Vildlh~~~~~------~~~~~~~~~~~~~~~~~~~~~~ia~~~~~~~~v~~~el~NEP~~~~~~~~~~~~~~~~~~~~  183 (358)
T d1ecea_         110 RIILDRHRPDCS------GQSALWYTSSVSEATWISDLQALAQRYKGNPTVVGFDLHNEPHDPACWGCGDPSIDWRLAAE  183 (358)
T ss_dssp             EEEEEEEESBTT------BCCSSSCCSSSCHHHHHHHHHHHHHHTTTCTTEEEEECSSCCCTTCBSSCCCTTTBHHHHHH
T ss_pred             ceeeeccccccc------CCCccccCChHHHHHHHHHHHHHHHhhcCccceEeeeeccccccCCcCCccchhhhHHHHHH
Confidence            599999976542      2344455445778999999999999999999999999999998763     23567999999


Q ss_pred             HHHHHHHhcCCCcEEEEeCCC--------CCccchhhhcCCCcCCCCCcEEEEEeecCCCCCCCcccCCCCchhhhhHHH
Q 039248           76 EGARVVHKRNPHVLVFVSGLN--------FDLDLRFLQKSPLALDLDNKLVYEIHWYSFSQDQNMWKTQPTNIVCYKVTQ  147 (400)
Q Consensus        76 ~~~~AIr~~nP~~lI~VeG~~--------~~~dLs~l~~~Pv~l~~~~~lVYs~H~Y~ps~~~~~W~~~~~~~~~~~~~~  147 (400)
                      +++++||+++|+++|+|+|..        |+.++......++.+...+++||++|.|.+..+++.+......  ...+..
T Consensus       184 ~~~~~Ir~~d~~~~v~v~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~H~Y~~~~~~~~~~~~~~~--~~~~~~  261 (358)
T d1ecea_         184 RAGNAVLSVNPNLLIFVEGVQSYNGDSYWWGGNLQGAGQYPVVLNVPNRLVYSAHDYATSVYPQTWFSDPTF--PNNMPG  261 (358)
T ss_dssp             HHHHHHHHHCTTSEEEEECBSEETTEECSTTTBCTTTTTSCCCCSSSSCEEEEEECCCTTTCCCGGGSCTTT--TTTHHH
T ss_pred             HHHHHHHhhCCCcEEEEeccccCccccccccccccchhhCCccCCccCceEEEeeecCCCcCCccccccchh--hhhHHH
Confidence            999999999999999999876        3445666666666666678999999999988776544433221  234555


Q ss_pred             HHHhhHHHHhhcCCCCCEEEeccCCCCCCCChhhHHHHHHHHHHHH------HCCCceEEeccCccccccCCCCCCCCcc
Q 039248          148 SFINRAVFLTTRKNPAPLVLSEFGFDQREVNLADNLYMTCLMAYAA------ETDLDWALWALQGSYYLRGGLKGAEETF  221 (400)
Q Consensus       148 ~~~~~~gfl~~~~~g~Pv~iGEFG~~~~~~~~~d~~w~~~~l~~l~------~~gi~wa~Wa~~Gsyy~r~g~~~~~et~  221 (400)
                      .+.+.+++... +.++||+|||||+....+  .+.+|++++.++++      +.+++|+||+++         ++.++++
T Consensus       262 ~~~~~~~~~~~-~~~~Pv~igEfG~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~gw~~W~~k---------~~~~~~~  329 (358)
T d1ecea_         262 IWNKNWGYLFN-QNIAPVWLGEFGTTLQST--TDQTWLKTLVQYLRPTAQYGADSFQWTFWSWN---------PDSGDTG  329 (358)
T ss_dssp             HHHHHTHHHHH-TTSSCEEEEECCCCCCSH--HHHHHHHHHHHHTCCHHHHTTSSCEEEESCSC---------SCCTTTC
T ss_pred             HHHHHHHHHHH-hcCCeEEEecCCCCCCCC--ChHHHHHHHHHHHHHHHHhcccCceEEEEcCC---------CCCCCCc
Confidence            56666666554 578999999999987643  34567777666653      578999999998         5677899


Q ss_pred             ccccCCCCCCCChhHHHHHHHhhhccc
Q 039248          222 GALDSTWQHPRNPNFLERLRFLQTKTH  248 (400)
Q Consensus       222 Gll~~dW~t~r~~~~l~rl~~l~~~~~  248 (400)
                      |++.+||.+++.++ ...|..++..+.
T Consensus       330 G~~~~dw~~~~~~~-~~~i~~~~~~~~  355 (358)
T d1ecea_         330 GILKDDWQTVDTVK-DGYLAPIKSSIF  355 (358)
T ss_dssp             CSBCTTSSSBCHHH-HHHHGGGCCCCC
T ss_pred             ceecCCCCCCChhh-hhhccccccccC
Confidence            99999999998874 334444444443
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d2zqna1 b.42.2.1 (A:131-260) 29-kDa galactose-binding lectin {Lumbricus terrestris [TaxId: 6398]} Back     information, alignment and structure
>d1ggpb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vcla2 b.42.2.1 (A:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1dqga_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vbua1 c.1.8.3 (A:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]} Back     information, alignment and structure
>d1nq6a_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces halstedii [TaxId: 1944]} Back     information, alignment and structure
>d1hwmb2 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1fh9a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d1hwmb1 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1n82a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]} Back     information, alignment and structure
>d1rzob1 b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1v0la_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} Back     information, alignment and structure
>d1qxma1 b.42.2.1 (A:4-148) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d1knma_ b.42.2.1 (A:) Xylan binding domain, CBM13 (Endo-1,4-beta-xylanase C-terminal domain) {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1ggpb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d1ta3b_ c.1.8.3 (B:) Xylanase A, catalytic core {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]} Back     information, alignment and structure
>d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} Back     information, alignment and structure
>d1hwmb2 b.42.2.1 (B:136-266) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1xhba1 b.42.2.1 (A:423-553) Polypeptide N-acetylgalactosaminyltransferase 1, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qxma2 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d1vcla2 b.42.2.1 (A:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d2zqna1 b.42.2.1 (A:131-260) 29-kDa galactose-binding lectin {Lumbricus terrestris [TaxId: 6398]} Back     information, alignment and structure
>d1ggpb1 b.42.2.1 (B:11-140) Plant cytotoxin B-chain (lectin) {Mongolian snake-gourd (Trichosanthes kirilowii), Lectin 1 [TaxId: 3677]} Back     information, alignment and structure
>d1abrb2 b.42.2.1 (B:141-267) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d2v3ga1 c.1.8.3 (A:8-280) Endoglucanase H N-terminal domain {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2aaib2 b.42.2.1 (B:136-262) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1i1wa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1dqga_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} Back     information, alignment and structure
>d1sr4a_ b.42.2.1 (A:) Cytolethal distending toxin subunit A {Haemophilus ducreyi [TaxId: 730]} Back     information, alignment and structure
>d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]} Back     information, alignment and structure
>d1ur1a_ c.1.8.3 (A:) Xylanase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1sr4a_ b.42.2.1 (A:) Cytolethal distending toxin subunit A {Haemophilus ducreyi [TaxId: 730]} Back     information, alignment and structure
>d1hwmb1 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]} Back     information, alignment and structure
>d1rzob1 b.42.2.1 (B:2001-2135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]} Back     information, alignment and structure
>d1vcla1 b.42.2.1 (A:1-150) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]} Back     information, alignment and structure
>d1abrb1 b.42.2.1 (B:1-140) Plant cytotoxin B-chain (lectin) {Abrus precatorius [TaxId: 3816]} Back     information, alignment and structure
>d1w32a_ c.1.8.3 (A:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1yq2a5 c.1.8.3 (A:313-609) beta-Galactosidase, domain 3 {Arthrobacter sp. c2-2 [TaxId: 192168]} Back     information, alignment and structure
>d1r85a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} Back     information, alignment and structure
>d1qxma2 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d1jz8a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qxma1 b.42.2.1 (A:4-148) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d1qw9a2 c.1.8.3 (A:18-384) Alpha-L-arabinofuranosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} Back     information, alignment and structure
>d2nt0a2 c.1.8.3 (A:78-431) Glucosylceramidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} Back     information, alignment and structure
>d1nofa2 c.1.8.3 (A:44-320) Glycosyl hydrolase family 5 xylanase, catalytic domain {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2bvya2 c.1.8.3 (A:5-370) Mannanase A, ManA {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d1odza_ c.1.8.3 (A:) Mannanase A, ManA {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]} Back     information, alignment and structure