Citrus Sinensis ID: 039268


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270------
MAGRNRIPREVYSDRRGFPPERPFIRGPPMPQPPPHPALLEEELEIQHAEIQRLLGDNRRLVEDRMAMQRELAAAKEELHRMNLVIGEIRAEQEVHVRDLVEKGLKLEADLRATEPLKKEAVQLRAEVQKLNNLRNELNGKVQTLQKDLAKLQADNQQIPLLRAEIDGLHQELMHARAAVDYEKKANIELMEQRQAMEKNLVSMAREVEKLRAELTNFDGRPWGVGGPYGMNFSGVDGSFPAPFGDGYGVHRGLADKGPMYGPRPASWDKPRMARR
ccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
magrnriprevysdrrgfpperpfirgppmpqppphpallEEELEIQHAEIQRLLGDNRRLVEDRMAMQRELAAAKEELHRMNLVIGEIRAEQEVHVRDLVEKGLKLEADLRATEPLKKEAVQLRAEVQKLNNLRNELNGKVQTLQKDLAKLQADNQQIPLLRAEIDGLHQELMHARAAVDYEKKANIELMEQRQAMEKNLVSMAREVEKLRAELtnfdgrpwgvggpygmnfsgvdgsfpapfgdgygvhrgladkgpmygprpaswdkprmarr
magrnriprevysdrrgfppERPFIRGPPMPQPPPHPALLEEELEIQHAEIQRLLGDNRRLVEDRMAMQRELAAAKEELHRMNLVIGeiraeqevhVRDLVEKGLKLEADLRATEPLKKEAVQLRAEVQKLNNLRNELNGKVQTLQKDLAKLQADNQQIPLLRAEIDGLHQELMHARAAVDYEKKANIELMEQRQAMEKNLVSMAREVEKLRAEltnfdgrpwGVGGPYGMNFSGVDGSFPAPFGDGYGVHRgladkgpmygprpaswdkprmarr
MAGRNRIPREVYSDRRGFPPERPFIRGppmpqppphpalleeeleIQHAEIQRLLGDNRRLVEDRMAMQRELAAAKEELHRMNLVIGEIRAEQEVHVRDLVEKGLKLEADLRATEPLKKEAVQLRAEVQKLNNLRNELNGKVQTLQKDLAKLQADNQQIPLLRAEIDGLHQELMHARAAVDYEKKANIELMEQRQAMEKNLVSMAREVEKLRAELTNFDGRPWGVGGPYGMNFSGVDGSFPAPFGDGYGVHRGLADKGPMYGPRPASWDKPRMARR
*****************************************************LL**********************ELHRMNLVIGEIRAEQEVHVRDLVEKGLKLEADL****************************************L***NQQIPLLRAEIDGLHQELMHARAAVDYEKKANI*******************VEKLRAELTNFDGRPWGVGGPYGMNFSGVDGSFPAPFGDGYGVHRGL**********************
************************************************************************************************************************************************************************************************************************************************************************************
MAGRNRIPREVYSDRRGFPPERPFIRGPPMPQPPPHPALLEEELEIQHAEIQRLLGDNRRLVEDRMAMQRELAAAKEELHRMNLVIGEIRAEQEVHVRDLVEKGLKLEADLRATEPLKKEAVQLRAEVQKLNNLRNELNGKVQTLQKDLAKLQADNQQIPLLRAEIDGLHQELMHARAAVDYEKKANIELMEQRQAMEKNLVSMAREVEKLRAELTNFDGRPWGVGGPYGMNFSGVDGSFPAPFGDGYGVHRGLADKGPMYGPRPASWDKPRMARR
*******************PERPFIRGPPMPQPPPHPALLEEELEIQHAEIQRLLGDNRRLVEDRMAMQRELAAAKEELHRMNLVIGEIRAEQEVHVRDLVEKGLKLEADLRATEPLKKEAVQLRAEVQKLNNLRNELNGKVQTLQKDLAKLQADNQQIPLLRAEIDGLHQELMHARAAVDYEKKANIELMEQRQAMEKNLVSMAREVEKLRAELTNFDGRPWGVGGPYGMNFSGVDGSFPAPFGDGYGVHRGLADKGPMYGPRPASWDK******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGRNRIPREVYSDRRGFPPERPFIRGPPMPQPPPHPALLEEELEIQHAEIQRLLGDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQEVHVRDLVEKGLKLEADLRATEPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNQQIPLLRAEIDGLHQELMHARAAVDYEKKAxxxxxxxxxxxxxxxxxxxxxxxxxxxxLTNFDGRPWGVGGPYGMNFSGVDGSFPAPFGDGYGVHRGLADKGPMYGPRPASWDKPRMARR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query276 2.2.26 [Sep-21-2011]
Q9D180 1249 WD repeat-containing prot yes no 0.637 0.140 0.256 0.0001
Q96MR6 1250 WD repeat-containing prot yes no 0.637 0.140 0.256 0.0002
>sp|Q9D180|WDR65_MOUSE WD repeat-containing protein 65 OS=Mus musculus GN=Wdr65 PE=2 SV=3 Back     alignment and function desciption
 Score = 47.0 bits (110), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 49/191 (25%), Positives = 91/191 (47%), Gaps = 15/191 (7%)

Query: 40   LEEELEIQHAEIQRLLGDNRRLVEDRMAMQRELAAAKEELHR-MNLVIGEIRAEQEVHVR 98
            LEE  E   A++Q   G      ED     RE    K+++    +  I +I+ + E  +R
Sbjct: 823  LEELTEFYEAKLQEKTGLLEEAQEDVRQQLREFEETKKQIEEDEDREIQDIKTKYERKLR 882

Query: 99   DLVEKGLKLEADL----RATEPLKKEAVQLRAEVQKLNNLRNELNGKVQTLQKDLAKLQA 154
            D  E  L+L+ +     +    L+KE  +   +++ L + + +L G +++L+KD+  L+ 
Sbjct: 883  DEKESNLRLKGETGIMRKKFSSLQKEIEERTNDIELLKSEQMKLQGIIRSLEKDIQGLKR 942

Query: 155  DNQQ----IPLLRAEIDGL---HQELMHARAAVDYEKKANIELMEQRQAMEKNLVSMARE 207
            + Q+    I      I  L   +QEL   +  +DY+ K   EL +Q +  E  +  M  +
Sbjct: 943  EIQERDETIQDKEKRIYDLKKKNQELEKFKFVLDYKIK---ELKKQIEPRENEIKVMKEQ 999

Query: 208  VEKLRAELTNF 218
            ++++ AEL  F
Sbjct: 1000 IQEMEAELERF 1010





Mus musculus (taxid: 10090)
>sp|Q96MR6|WDR65_HUMAN WD repeat-containing protein 65 OS=Homo sapiens GN=WDR65 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query276
224134975271 predicted protein [Populus trichocarpa] 0.971 0.988 0.731 1e-109
147810266279 hypothetical protein VITISV_027853 [Viti 1.0 0.989 0.741 1e-109
359482838282 PREDICTED: uncharacterized protein LOC10 1.0 0.978 0.734 1e-108
358344687283 hypothetical protein MTR_040s0047 [Medic 0.996 0.971 0.669 1e-103
255572969270 conserved hypothetical protein [Ricinus 0.967 0.988 0.713 1e-102
357454679271 hypothetical protein MTR_2g100240 [Medic 0.952 0.970 0.682 1e-102
356556722286 PREDICTED: uncharacterized protein LOC10 0.996 0.961 0.675 2e-97
363806838285 uncharacterized protein LOC100787621 [Gl 1.0 0.968 0.670 1e-92
388504176284 unknown [Lotus japonicus] 0.989 0.961 0.606 2e-83
297847874273 hypothetical protein ARALYDRAFT_474572 [ 0.985 0.996 0.6 4e-83
>gi|224134975|ref|XP_002327536.1| predicted protein [Populus trichocarpa] gi|222836090|gb|EEE74511.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/279 (73%), Positives = 235/279 (84%), Gaps = 11/279 (3%)

Query: 1   MAGRNRIPREVYSDRRGFPPERPFIRGPPMPQPPPHPALLEEELEIQHAEIQRLLGDNRR 60
           MAGRNRIPRE+Y+DRRGF  ERPFIRG PMPQP    A LEEELE+QHAEI+RLLGDNRR
Sbjct: 1   MAGRNRIPRELYNDRRGFIVERPFIRGHPMPQP----AFLEEELEMQHAEIRRLLGDNRR 56

Query: 61  LVEDRMAMQRELAAAKEELHRMNLVIGEIRAEQEVHVRDLVEKGLKLEADLRATEPLKKE 120
           L+EDRM +Q+EL AAKEELHRMN+VI EIRAEQ+V    L++KGLKLEADLR TEPLK E
Sbjct: 57  LIEDRMGLQQELGAAKEELHRMNIVIAEIRAEQDV----LIKKGLKLEADLRVTEPLKNE 112

Query: 121 AVQLRAEVQKLNNLRNELNGKVQTLQKDLAKLQADNQQIPLLRAEIDGLHQELMHARAAV 180
            VQLRAE+QKL++ + EL G+VQTL++D+A+LQADN QIPLLR EI+GLHQELMH RAA+
Sbjct: 113 TVQLRAEIQKLSSSKQELVGQVQTLKQDVARLQADNHQIPLLRGEIEGLHQELMHTRAAI 172

Query: 181 DYEKKANIELMEQRQAMEKNLVSMAREVEKLRAELTNFDGR-PW--GVGGPYGMNFSGVD 237
           +YEKKANIEL+EQRQ+MEKNLVSMAREVEKLR EL++ D R PW    GG YGM F   +
Sbjct: 173 EYEKKANIELVEQRQSMEKNLVSMAREVEKLRVELSSSDNRPPWSASAGGSYGMKFGIPE 232

Query: 238 GSFPAPFGDGYGVHRGLADKGPMYGPRPASWDKPRMARR 276
           G+FP P+GDGY VH G ADKGP YGP PASW+KPRM RR
Sbjct: 233 GAFPPPYGDGYAVHLGAADKGPFYGPGPASWEKPRMPRR 271




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147810266|emb|CAN71449.1| hypothetical protein VITISV_027853 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359482838|ref|XP_002278937.2| PREDICTED: uncharacterized protein LOC100253153 [Vitis vinifera] gi|297743072|emb|CBI35939.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|358344687|ref|XP_003636419.1| hypothetical protein MTR_040s0047 [Medicago truncatula] gi|355502354|gb|AES83557.1| hypothetical protein MTR_040s0047 [Medicago truncatula] Back     alignment and taxonomy information
>gi|255572969|ref|XP_002527415.1| conserved hypothetical protein [Ricinus communis] gi|223533225|gb|EEF34981.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|357454679|ref|XP_003597620.1| hypothetical protein MTR_2g100240 [Medicago truncatula] gi|124360403|gb|ABN08416.1| Protein kinase PKN/PRK1, effector [Medicago truncatula] gi|355486668|gb|AES67871.1| hypothetical protein MTR_2g100240 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356556722|ref|XP_003546672.1| PREDICTED: uncharacterized protein LOC100809038 [Glycine max] Back     alignment and taxonomy information
>gi|363806838|ref|NP_001242546.1| uncharacterized protein LOC100787621 [Glycine max] gi|255645257|gb|ACU23126.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388504176|gb|AFK40154.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|297847874|ref|XP_002891818.1| hypothetical protein ARALYDRAFT_474572 [Arabidopsis lyrata subsp. lyrata] gi|297337660|gb|EFH68077.1| hypothetical protein ARALYDRAFT_474572 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query276
TAIR|locus:2035751283 AT1G55170 "AT1G55170" [Arabido 0.992 0.968 0.537 1.2e-72
TAIR|locus:2089616331 AT3G14750 "AT3G14750" [Arabido 0.800 0.667 0.384 3.9e-37
TAIR|locus:2033681359 AT1G67170 "AT1G67170" [Arabido 0.786 0.604 0.409 1.9e-35
TAIR|locus:2060848288 AT2G30120 [Arabidopsis thalian 0.630 0.604 0.333 1.3e-22
TAIR|locus:2156146238 AT5G61920 "AT5G61920" [Arabido 0.619 0.718 0.292 5.7e-20
ZFIN|ZDB-GENE-060929-128 885 ccdc147 "coiled-coil domain co 0.554 0.172 0.246 1.6e-09
UNIPROTKB|E9PIK8155 PPFIBP2 "Liprin-beta-2" [Homo 0.518 0.922 0.268 1.1e-06
UNIPROTKB|Q6V4L4397 Q6V4L4 "M protein" [Streptococ 0.605 0.420 0.266 1.8e-06
UNIPROTKB|Q6V4L9391 Q6V4L9 "M protein" [Streptococ 0.605 0.427 0.255 2.9e-06
UNIPROTKB|K7EQ71 1115 PPL "Periplakin" [Homo sapiens 0.536 0.132 0.297 3.4e-06
TAIR|locus:2035751 AT1G55170 "AT1G55170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 734 (263.4 bits), Expect = 1.2e-72, P = 1.2e-72
 Identities = 152/283 (53%), Positives = 192/283 (67%)

Query:     1 MAGRNRIPREV---YSDRRGFPPERPFIRGXXXX-----XXXXXXXXXXXXXXIQHAEIQ 52
             M+GRNRI R++   Y D R  PPERPF+RG                        Q AEI+
Sbjct:     1 MSGRNRIHRDIRDSYHDHRDLPPERPFLRGPPLLQPPPPSLLEDLQIQEGEIRRQDAEIR 60

Query:    53 RLLGDNRRLVEDRMAMQRELAAAKEELHRMNLVIGEIRAEQEVHVRDLVEKGLKLEADLR 112
             RLL DN  L +DRM ++REL AAKEELHRMNL+I ++RAEQ++ +R+  EK  KLE D+R
Sbjct:    61 RLLSDNHGLADDRMVLERELVAAKEELHRMNLMISDLRAEQDLQLREFSEKRHKLEGDVR 120

Query:   113 ATEPLKKEAVQLRAEVQKLNNLRNELNGKVQTLQKDLAKLQADNQQIPLLRAEIDGLHQE 172
             A E  KKEA QLR EVQKL+ ++ EL+G VQ L+KDLAKLQ+DN+QIP +RAE+  L +E
Sbjct:   121 AMESYKKEASQLRGEVQKLDEIKRELSGNVQLLRKDLAKLQSDNKQIPGMRAEVKDLQKE 180

Query:   173 LMHARAAVDYEKKANIELMEQRQAMEKNLVSMAREVEKLRAELTNFDGRPWGVGGPYGMN 232
             LMHAR A++YEKK   ELMEQRQ MEKN+VSMAREVEKLRAEL   D RPWG GG YGMN
Sbjct:   181 LMHARDAIEYEKKEKFELMEQRQTMEKNMVSMAREVEKLRAELATVDSRPWGFGGSYGMN 240

Query:   233 FSGVDGSFPAPFGDGYGVHRGLADKGPMYGPRPASWDKPRMAR 275
             ++ +DG+F   +G+    + G +++   Y     S  KPR+ R
Sbjct:   241 YNNMDGTFRGSYGEN-DTYLGSSERSQYYSHGSGSQKKPRLDR 282




GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2089616 AT3G14750 "AT3G14750" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033681 AT1G67170 "AT1G67170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060848 AT2G30120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156146 AT5G61920 "AT5G61920" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060929-128 ccdc147 "coiled-coil domain containing 147" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E9PIK8 PPFIBP2 "Liprin-beta-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6V4L4 Q6V4L4 "M protein" [Streptococcus pyogenes (taxid:1314)] Back     alignment and assigned GO terms
UNIPROTKB|Q6V4L9 Q6V4L9 "M protein" [Streptococcus pyogenes (taxid:1314)] Back     alignment and assigned GO terms
UNIPROTKB|K7EQ71 PPL "Periplakin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00440082
hypothetical protein (271 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query276
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-08
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-08
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-07
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-07
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 7e-07
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 7e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-06
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-06
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-06
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 6e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 7e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 4e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 6e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-04
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 2e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-04
TIGR00606 1311 TIGR00606, rad50, rad50 2e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-04
pfam07106169 pfam07106, TBPIP, Tat binding protein 1(TBP-1)-int 5e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 6e-04
pfam08317321 pfam08317, Spc7, Spc7 kinetochore protein 7e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 8e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.001
pfam03961450 pfam03961, DUF342, Protein of unknown function (DU 0.001
smart00787312 smart00787, Spc7, Spc7 kinetochore protein 0.001
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.002
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.002
COG5185 622 COG5185, HEC1, Protein involved in chromosome segr 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.003
pfam05557 722 pfam05557, MAD, Mitotic checkpoint protein 0.003
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
 Score = 54.7 bits (132), Expect = 2e-08
 Identities = 44/182 (24%), Positives = 97/182 (53%), Gaps = 7/182 (3%)

Query: 42  EELEIQHAEIQRLLGDNRRLVEDRMAMQRELAAAKEELHRMNLVIGEIRAEQEVHVRDLV 101
           +ELE + AE++  L    +L E+  +++ EL + ++ L  +   + E+  + E   R+L 
Sbjct: 670 KELEEELAELEAQL---EKLEEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELA 726

Query: 102 EKGLKLEADLRATEPLKKEAVQLRAEVQKLNNLRNELNGKVQTLQKDLAKLQADNQQI-- 159
               +LE      E L++E  +L  E+++L     EL  ++++L++ LAKL+ + +++  
Sbjct: 727 ALEEELEQLQSRLEELEEELEELEEELEELQERLEELEEELESLEEALAKLKEEIEELEE 786

Query: 160 --PLLRAEIDGLHQELMHARAAVDYEKKANIELMEQRQAMEKNLVSMAREVEKLRAELTN 217
               L+ E++ L +EL  A   +D  ++    L ++R+ +E+ +  +  E+E+L  +L  
Sbjct: 787 KRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEIEELEEEIEELEEKLDE 846

Query: 218 FD 219
            +
Sbjct: 847 LE 848


Length = 1163

>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|129694 TIGR00606, rad50, rad50 Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|148614 pfam07106, TBPIP, Tat binding protein 1(TBP-1)-interacting protein (TBPIP) Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|219791 pfam08317, Spc7, Spc7 kinetochore protein Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|217817 pfam03961, DUF342, Protein of unknown function (DUF342) Back     alignment and domain information
>gnl|CDD|197874 smart00787, Spc7, Spc7 kinetochore protein Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|227512 COG5185, HEC1, Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|218636 pfam05557, MAD, Mitotic checkpoint protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 276
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 97.74
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 97.67
PF00038312 Filament: Intermediate filament protein; InterPro: 97.59
PRK09039343 hypothetical protein; Validated 97.58
PRK11637 428 AmiB activator; Provisional 97.58
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 97.35
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 97.19
PF05701522 WEMBL: Weak chloroplast movement under blue light; 97.16
PRK11637 428 AmiB activator; Provisional 97.09
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 97.09
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 97.05
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 97.03
PRK02224 880 chromosome segregation protein; Provisional 96.97
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 96.96
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 96.87
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 96.8
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 96.73
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 96.66
COG4372 499 Uncharacterized protein conserved in bacteria with 96.65
TIGR01000 457 bacteriocin_acc bacteriocin secretion accessory pr 96.6
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 96.58
PRK04863 1486 mukB cell division protein MukB; Provisional 96.58
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 96.56
PRK02224 880 chromosome segregation protein; Provisional 96.56
PF07111 739 HCR: Alpha helical coiled-coil rod protein (HCR); 96.56
PRK03918 880 chromosome segregation protein; Provisional 96.56
PF14662193 CCDC155: Coiled-coil region of CCDC155 96.53
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 96.49
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 96.48
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 96.41
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 96.4
PRK03918 880 chromosome segregation protein; Provisional 96.33
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 96.3
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 96.23
PF05701522 WEMBL: Weak chloroplast movement under blue light; 96.19
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 96.19
PF00038 312 Filament: Intermediate filament protein; InterPro: 96.14
KOG2129 552 consensus Uncharacterized conserved protein H4 [Fu 96.07
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 96.03
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 95.96
PRK04778569 septation ring formation regulator EzrA; Provision 95.95
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 95.85
PF13514 1111 AAA_27: AAA domain 95.81
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 95.81
PHA02562 562 46 endonuclease subunit; Provisional 95.75
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 95.72
PHA02562 562 46 endonuclease subunit; Provisional 95.71
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 95.62
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 95.6
COG4942420 Membrane-bound metallopeptidase [Cell division and 95.59
PRK09039343 hypothetical protein; Validated 95.51
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 95.51
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 95.39
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 95.33
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 95.3
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 95.29
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 95.25
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 95.2
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 95.19
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 95.11
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 95.06
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 95.04
KOG4807593 consensus F-actin binding protein, regulates actin 94.93
KOG0933 1174 consensus Structural maintenance of chromosome pro 94.89
KOG1853 333 consensus LIS1-interacting protein NUDE [Cytoskele 94.86
PF09787511 Golgin_A5: Golgin subfamily A member 5; InterPro: 94.84
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 94.74
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 94.68
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 94.67
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 94.5
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 94.46
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 94.42
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 94.39
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 94.36
PRK09841 726 cryptic autophosphorylating protein tyrosine kinas 94.33
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 94.3
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 94.26
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 94.14
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 93.99
KOG0964 1200 consensus Structural maintenance of chromosome pro 93.96
PRK04863 1486 mukB cell division protein MukB; Provisional 93.93
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 93.92
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 93.84
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 93.84
KOG0996 1293 consensus Structural maintenance of chromosome pro 93.82
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 93.8
KOG0996 1293 consensus Structural maintenance of chromosome pro 93.67
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 93.64
PRK10884206 SH3 domain-containing protein; Provisional 93.5
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 93.42
PF13851201 GAS: Growth-arrest specific micro-tubule binding 93.37
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 93.36
PF10186302 Atg14: UV radiation resistance protein and autopha 93.34
PF0864796 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 93.3
COG4372 499 Uncharacterized protein conserved in bacteria with 93.27
KOG4603201 consensus TBP-1 interacting protein [Signal transd 93.27
PF14662193 CCDC155: Coiled-coil region of CCDC155 93.17
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 93.15
PF13514 1111 AAA_27: AAA domain 93.15
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 93.08
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 93.07
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 92.94
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 92.88
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 92.86
cd07651236 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology 92.68
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 92.46
COG2433652 Uncharacterized conserved protein [Function unknow 92.31
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 92.27
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 92.25
PF13805271 Pil1: Eisosome component PIL1; PDB: 3PLT_B. 92.24
KOG4673961 consensus Transcription factor TMF, TATA element m 92.14
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 92.13
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 92.08
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 92.07
PF05557 722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 92.06
KOG0971 1243 consensus Microtubule-associated protein dynactin 92.0
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 91.97
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 91.95
PF09486158 HrpB7: Bacterial type III secretion protein (HrpB7 91.9
PRK01156 895 chromosome segregation protein; Provisional 91.74
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 91.72
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 91.72
COG5185 622 HEC1 Protein involved in chromosome segregation, i 91.58
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 91.51
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 91.5
KOG0933 1174 consensus Structural maintenance of chromosome pro 91.43
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 91.38
PF10186302 Atg14: UV radiation resistance protein and autopha 91.35
KOG0993542 consensus Rab5 GTPase effector Rabaptin-5 [Intrace 91.2
PF10234267 Cluap1: Clusterin-associated protein-1; InterPro: 91.16
KOG1962216 consensus B-cell receptor-associated protein and r 91.13
PRK11519 719 tyrosine kinase; Provisional 91.08
TIGR03007 498 pepcterm_ChnLen polysaccharide chain length determ 91.0
KOG0249 916 consensus LAR-interacting protein and related prot 91.0
PRK11546143 zraP zinc resistance protein; Provisional 90.94
PRK10361 475 DNA recombination protein RmuC; Provisional 90.87
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 90.68
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 90.53
PRK10246 1047 exonuclease subunit SbcC; Provisional 90.5
PF05667 594 DUF812: Protein of unknown function (DUF812); Inte 90.45
PLN03229762 acetyl-coenzyme A carboxylase carboxyl transferase 90.42
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 90.4
cd00890129 Prefoldin Prefoldin is a hexameric molecular chape 90.06
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 89.96
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 89.88
COG4942 420 Membrane-bound metallopeptidase [Cell division and 89.82
PF14362301 DUF4407: Domain of unknown function (DUF4407) 89.81
PRK12704 520 phosphodiesterase; Provisional 89.77
PRK01156 895 chromosome segregation protein; Provisional 89.44
PF09728 309 Taxilin: Myosin-like coiled-coil protein; InterPro 89.33
PF09787 511 Golgin_A5: Golgin subfamily A member 5; InterPro: 89.27
PF05557 722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 89.19
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 89.14
COG3206458 GumC Uncharacterized protein involved in exopolysa 89.07
KOG4673 961 consensus Transcription factor TMF, TATA element m 89.03
PF13851201 GAS: Growth-arrest specific micro-tubule binding 89.02
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 88.92
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 88.9
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 88.81
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 88.8
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 88.77
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 88.74
TIGR01010362 BexC_CtrB_KpsE polysaccharide export inner-membran 88.66
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 88.59
PF02050123 FliJ: Flagellar FliJ protein; InterPro: IPR012823 88.56
KOG09211282 consensus Dosage compensation complex, subunit MLE 88.47
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 88.46
PF05483 786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 88.41
PRK03947140 prefoldin subunit alpha; Reviewed 88.06
TIGR03794 421 NHPM_micro_HlyD NHPM bacteriocin system secretion 88.04
KOG3478120 consensus Prefoldin subunit 6, KE2 family [Posttra 87.93
PF0877640 VASP_tetra: VASP tetramerisation domain; InterPro: 87.91
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 87.79
PF07794790 DUF1633: Protein of unknown function (DUF1633); In 87.75
KOG0979 1072 consensus Structural maintenance of chromosome pro 87.69
KOG0288 459 consensus WD40 repeat protein TipD [General functi 87.63
COG3524372 KpsE Capsule polysaccharide export protein [Cell e 87.55
TIGR01000 457 bacteriocin_acc bacteriocin secretion accessory pr 87.33
KOG2391365 consensus Vacuolar sorting protein/ubiquitin recep 87.31
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 87.28
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 87.25
PRK10884206 SH3 domain-containing protein; Provisional 87.19
PF09731 582 Mitofilin: Mitochondrial inner membrane protein; I 86.93
KOG1937521 consensus Uncharacterized conserved protein [Funct 86.89
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 86.58
PRK10246 1047 exonuclease subunit SbcC; Provisional 86.55
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 86.52
PF05478 806 Prominin: Prominin; InterPro: IPR008795 The promin 86.48
TIGR02971327 heterocyst_DevB ABC exporter membrane fusion prote 86.43
COG2433652 Uncharacterized conserved protein [Function unknow 86.43
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 86.42
KOG0963 629 consensus Transcription factor/CCAAT displacement 86.4
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 86.32
PF06120301 Phage_HK97_TLTM: Tail length tape measure protein; 86.24
PF10481 307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 86.2
PRK04778569 septation ring formation regulator EzrA; Provision 85.93
PF14735238 HAUS4: HAUS augmin-like complex subunit 4 85.92
PF04912388 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit 85.85
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 85.84
PF1259257 DUF3763: Protein of unknown function (DUF3763); In 85.83
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 85.74
KOG2264 907 consensus Exostosin EXT1L [Signal transduction mec 85.49
PF15294278 Leu_zip: Leucine zipper 85.47
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 85.34
PRK00106 535 hypothetical protein; Provisional 85.23
KOG0249 916 consensus LAR-interacting protein and related prot 85.15
KOG3478120 consensus Prefoldin subunit 6, KE2 family [Posttra 85.12
PF05837106 CENP-H: Centromere protein H (CENP-H); InterPro: I 84.99
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 84.94
PF0472856 LPP: Lipoprotein leucine-zipper; InterPro: IPR0068 84.93
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 84.84
KOG4403575 consensus Cell surface glycoprotein STIM, contains 84.77
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 84.38
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 84.38
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 84.32
PF01920106 Prefoldin_2: Prefoldin subunit; InterPro: IPR00277 84.1
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 83.88
PF02050123 FliJ: Flagellar FliJ protein; InterPro: IPR012823 83.84
PRK12704 520 phosphodiesterase; Provisional 83.79
PRK10476346 multidrug resistance protein MdtN; Provisional 83.73
COG1382119 GimC Prefoldin, chaperonin cofactor [Posttranslati 83.55
TIGR02231 525 conserved hypothetical protein. This family consis 83.52
cd07653251 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and B 83.46
PRK06569155 F0F1 ATP synthase subunit B'; Validated 83.44
PRK09343121 prefoldin subunit beta; Provisional 83.37
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 83.37
PF10212518 TTKRSYEDQ: Predicted coiled-coil domain-containing 83.17
TIGR00634 563 recN DNA repair protein RecN. All proteins in this 83.09
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 83.01
PF0858179 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t 82.74
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 82.6
PF07889126 DUF1664: Protein of unknown function (DUF1664); In 82.53
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 82.49
PF06785401 UPF0242: Uncharacterised protein family (UPF0242); 82.48
PLN03229 762 acetyl-coenzyme A carboxylase carboxyl transferase 82.45
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 82.24
PF05911 769 DUF869: Plant protein of unknown function (DUF869) 82.17
PF0858179 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t 82.07
TIGR00634563 recN DNA repair protein RecN. All proteins in this 81.98
PRK13453173 F0F1 ATP synthase subunit B; Provisional 81.93
PRK10361 475 DNA recombination protein RmuC; Provisional 81.9
PF0891269 Rho_Binding: Rho Binding; InterPro: IPR015008 Rho 81.79
smart00806426 AIP3 Actin interacting protein 3. Aip3p/Bud6p is a 81.48
TIGR02231 525 conserved hypothetical protein. This family consis 81.27
PF13094160 CENP-Q: CENP-Q, a CENPA-CAD centromere complex sub 81.22
TIGR02473141 flagell_FliJ flagellar export protein FliJ. Member 81.19
TIGR00414 418 serS seryl-tRNA synthetase. This model represents 81.1
COG1842225 PspA Phage shock protein A (IM30), suppresses sigm 81.05
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 80.84
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 80.83
PF11180192 DUF2968: Protein of unknown function (DUF2968); In 80.6
KOG0971 1243 consensus Microtubule-associated protein dynactin 80.54
PF07139302 DUF1387: Protein of unknown function (DUF1387); In 80.37
KOG0018 1141 consensus Structural maintenance of chromosome pro 80.21
cd00584129 Prefoldin_alpha Prefoldin alpha subunit; Prefoldin 80.07
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
Probab=97.74  E-value=0.0064  Score=64.09  Aligned_cols=24  Identities=21%  Similarity=0.361  Sum_probs=10.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhh
Q 039268          194 RQAMEKNLVSMAREVEKLRAELTN  217 (276)
Q Consensus       194 ~qaMEknlisMarEvEKLRaElan  217 (276)
                      ...+.+++-.+..++.+++.++..
T Consensus       471 l~~~~~~l~~l~~~l~~l~~~~~~  494 (1164)
T TIGR02169       471 LYDLKEEYDRVEKELSKLQRELAE  494 (1164)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            333444444444444444444443



SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent.

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>KOG4603 consensus TBP-1 interacting protein [Signal transduction mechanisms] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07651 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13805 Pil1: Eisosome component PIL1; PDB: 3PLT_B Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>PF09486 HrpB7: Bacterial type III secretion protein (HrpB7); InterPro: IPR013392 This entry represents proteins encoded by genes which are found in type III secretion operons in a narrow range of species including Xanthomonas, Burkholderia and Ralstonia Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>KOG0993 consensus Rab5 GTPase effector Rabaptin-5 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] Back     alignment and domain information
>PRK11546 zraP zinc resistance protein; Provisional Back     alignment and domain information
>PRK10361 DNA recombination protein RmuC; Provisional Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>cd00890 Prefoldin Prefoldin is a hexameric molecular chaperone complex, found in both eukaryotes and archaea, that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF14362 DUF4407: Domain of unknown function (DUF4407) Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>PRK03947 prefoldin subunit alpha; Reviewed Back     alignment and domain information
>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein Back     alignment and domain information
>KOG3478 consensus Prefoldin subunit 6, KE2 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08776 VASP_tetra: VASP tetramerisation domain; InterPro: IPR014885 Vasodilator-stimulated phosphoprotein (VASP) is an actin cytoskeletal regulatory protein Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PF07794 DUF1633: Protein of unknown function (DUF1633); InterPro: IPR012436 This family contains sequences derived from a group of hypothetical proteins expressed by Arabidopsis thaliana (Mouse-ear cress) Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>COG3524 KpsE Capsule polysaccharide export protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology Back     alignment and domain information
>KOG1937 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF05478 Prominin: Prominin; InterPro: IPR008795 The prominins are an emerging family of proteins that, among the multispan membrane proteins, display a novel topology Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF06120 Phage_HK97_TLTM: Tail length tape measure protein; InterPro: IPR009302 This entry consists of the tail length tape measure protein from Bacteriophage HK97 and related sequences from Escherichia coli (strain K12) Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF14735 HAUS4: HAUS augmin-like complex subunit 4 Back     alignment and domain information
>PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [] Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>PF12592 DUF3763: Protein of unknown function (DUF3763); InterPro: IPR022547 This domain is found in bacterial regulartory ATPases 3 Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] Back     alignment and domain information
>KOG3478 consensus Prefoldin subunit 6, KE2 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05837 CENP-H: Centromere protein H (CENP-H); InterPro: IPR008426 Chromosome segregation in eukaryotes requires the kinetochore, a multi-protein structure that assembles on centromeric DNA, and which acts to link chromosomes to spindle microtubules Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>PF04728 LPP: Lipoprotein leucine-zipper; InterPro: IPR006817 This repeating sequence, NAKVDQLSNDV, is found in the enterobacterial outer membrane lipoprotein LPP Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF01920 Prefoldin_2: Prefoldin subunit; InterPro: IPR002777 Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>cd07653 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins Back     alignment and domain information
>PRK06569 F0F1 ATP synthase subunit B'; Validated Back     alignment and domain information
>PRK09343 prefoldin subunit beta; Provisional Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>PRK13453 F0F1 ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK10361 DNA recombination protein RmuC; Provisional Back     alignment and domain information
>PF08912 Rho_Binding: Rho Binding; InterPro: IPR015008 Rho is responsible for the recognition and binding of Rho binding domain-containing proteins (such as ROCK) to Rho, resulting in activation of the GTPase which in turn modulates the phosphorylation of various signalling proteins Back     alignment and domain information
>smart00806 AIP3 Actin interacting protein 3 Back     alignment and domain information
>TIGR02231 conserved hypothetical protein Back     alignment and domain information
>PF13094 CENP-Q: CENP-Q, a CENPA-CAD centromere complex subunit Back     alignment and domain information
>TIGR02473 flagell_FliJ flagellar export protein FliJ Back     alignment and domain information
>TIGR00414 serS seryl-tRNA synthetase Back     alignment and domain information
>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF07139 DUF1387: Protein of unknown function (DUF1387); InterPro: IPR009816 This family represents a conserved region approximately 300 residues long within a number of hypothetical proteins of unknown function that seem to be restricted to mammals Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd00584 Prefoldin_alpha Prefoldin alpha subunit; Prefoldin is a hexameric molecular chaperone complex, found in both eukaryotes and archaea, that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query276
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-11
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-10
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-10
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 8e-09
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-08
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-10
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 2e-04
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 3e-04
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 2e-04
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 4e-04
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
 Score = 62.5 bits (152), Expect = 3e-11
 Identities = 33/186 (17%), Positives = 73/186 (39%), Gaps = 17/186 (9%)

Query: 40   LEEELEIQHAEIQRLLGDNRRLVEDRMAMQRELAAAKEELHRMNLVIG---------EIR 90
            +E+++ I   +  +L  + + L E    +   LA  +E+   +  +           E+R
Sbjct: 988  MEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEEEEKAKNLTKLKNKHESMISELEVR 1047

Query: 91   AEQEVHVRDLVEKGL-KLEADLRATEP----LKKEAVQLRAEVQKLNNLRNELNGKVQTL 145
             ++E   R  +EK   KLE +          L+ +  +L+A++ K          +++  
Sbjct: 1048 LKKEEKSRQELEKIKRKLEGESSDLHEQIAELQAQIAELKAQLAKKEEELQAALARLEDE 1107

Query: 146  QKDLAKLQADNQQIPLLRAEIDGLHQELMHARAAVDYEKKANIELMEQRQAMEKNLVSMA 205
                       ++I  L + I  L ++L   +AA +  +K   +L E+ +A++  L    
Sbjct: 1108 TSQKNNAL---KKIRELESHISDLQEDLESEKAARNKAEKQKRDLSEELEALKTELEDTL 1164

Query: 206  REVEKL 211
                  
Sbjct: 1165 DTTATQ 1170


>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query276
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 97.01
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 96.98
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 96.93
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 96.69
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 96.32
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 95.84
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 95.67
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 95.65
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 95.58
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 95.57
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 95.42
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 94.56
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 94.55
2no2_A107 HIP-I, huntingtin-interacting protein 1; clathrin 94.55
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 94.24
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 92.82
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 92.54
1wt6_A81 Myotonin-protein kinase; coiled-coil, kinase activ 92.32
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 92.06
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 91.16
1x79_B112 RAB GTPase binding effector protein 1; rabaptin5, 91.14
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 91.09
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 91.09
2v4h_A110 NF-kappa-B essential modulator; transcription, met 90.8
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 90.28
3iox_A 497 AGI/II, PA; alpha helix, PPII helix, supersandwich 89.93
3plt_A234 Sphingolipid long chain base-responsive protein L; 89.38
1x79_B112 RAB GTPase binding effector protein 1; rabaptin5, 89.08
2w6b_A56 RHO guanine nucleotide exchange factor 7; X-RAY cr 88.88
2xnx_M146 M protein, M1-BC1; cell adhesion, virulence factor 88.32
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 88.31
1deq_A 390 Fibrinogen (alpha chain); coiled-coil, blood clott 88.3
1l8d_A112 DNA double-strand break repair RAD50 ATPase; zinc 88.2
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 88.0
1m1j_B 464 Fibrinogen beta chain; coiled coils, disulfide rin 87.61
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 87.6
2w83_C77 C-JUN-amino-terminal kinase-interacting protein 4; 87.4
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 86.92
2v4h_A110 NF-kappa-B essential modulator; transcription, met 86.53
4dzn_A33 Coiled-coil peptide CC-PIL; de novo protein; HET: 86.47
3jsv_C94 NF-kappa-B essential modulator; ubiquitin, coiled- 86.46
1jcd_A52 Major outer membrane lipoprotein; protein folding, 86.13
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 85.89
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 85.84
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 85.39
1deq_A 390 Fibrinogen (alpha chain); coiled-coil, blood clott 85.36
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 85.12
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 85.1
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 85.05
3lay_A175 Zinc resistance-associated protein; salmonella typ 84.68
1gk4_A84 Vimentin; intermediate filament, dimer, parallel c 84.64
3bas_A89 Myosin heavy chain, striated muscle/general contro 84.35
1use_A45 VAsp, vasodilator-stimulated phosphoprotein; signa 84.34
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 84.1
4dk0_A 369 Putative MACA; alpha-hairpin, lipoyl, beta-barrel, 83.65
2d1l_A253 Metastasis suppressor protein 1; IRSP53, actin bin 82.93
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 82.43
4e61_A106 Protein BIM1; EB1-like motif, coiled-coil, spindle 81.93
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 80.99
2efk_A301 CDC42-interacting protein 4; EFC domain, structura 80.63
3jsv_C94 NF-kappa-B essential modulator; ubiquitin, coiled- 80.51
3fpp_A 341 Macrolide-specific efflux protein MACA; hexameric 80.43
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
Probab=97.01  E-value=0.12  Score=46.05  Aligned_cols=118  Identities=14%  Similarity=0.155  Sum_probs=68.7

Q ss_pred             chhhHHHHHHHHHHHHHHHHHHHHHHHHhhhh---HHHHHHHHHHhhhhhhhhhhhchhhHHHHHHHHHHHHHHHHHHHH
Q 039268           61 LVEDRMAMQRELAAAKEELHRMNLVIGEIRAE---QEVHVRDLVEKGLKLEADLRATEPLKKEAVQLRAEVQKLNNLRNE  137 (276)
Q Consensus        61 LaatHvaLrqeLaaaq~Elqrl~~~~~~i~ae---~e~q~R~l~ek~~KmEAelra~e~lk~El~q~raE~q~L~~~Rqe  137 (276)
                      |...-..|..+++..+..+..+...+.+++.+   .+..+..+-.++.+.+..+-++-.-| |+..+..|+..+....+.
T Consensus        30 lp~el~~le~~~~~l~~~~~~~~~~l~d~~~~~~~~e~~i~~~~~ri~~~~~~l~~v~~~k-E~~aL~kEie~~~~~i~~  108 (256)
T 3na7_A           30 KRKDLDKALNDKEAKNKAILNLEEEKLALKLQVSKNEQTLQDTNAKIASIQKKMSEIKSER-ELRSLNIEEDIAKERSNQ  108 (256)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSSSS-HHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccCCHH-HHHHHHHHHHHHHHHHHH
Confidence            44555555555555555555555555555444   45777788888888888776665444 666666666666666666


Q ss_pred             HHHHHHHHHHHHHHHHhhhcchhHHHHHHHHHHHHHHHHHhhhhh
Q 039268          138 LNGKVQTLQKDLAKLQADNQQIPLLRAEIDGLHQELMHARAAVDY  182 (276)
Q Consensus       138 L~~qvq~l~~eL~r~~ad~qqipal~aEie~lrqElqr~Raa~Ey  182 (276)
                      |..++..++..+...+.++   ..+.++++.++.++...++.++-
T Consensus       109 lE~eile~~e~ie~~~~~l---~~~~~~l~~~~~~l~~~~~~~~~  150 (256)
T 3na7_A          109 ANREIENLQNEIKRKSEKQ---EDLKKEMLELEKLALELESLVEN  150 (256)
T ss_dssp             HHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHH
Confidence            6666666666655544432   23334445555555544444443



>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Back     alignment and structure
>3plt_A Sphingolipid long chain base-responsive protein L; eisosomes, LSP1, PIL1, BAR domain, plasma membrane, SELF-ASS phosphoprotein; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 Back     alignment and structure
>2w6b_A RHO guanine nucleotide exchange factor 7; X-RAY crystallography, phosphoprotein, guanine-nucleotide releasing factor, GIT, PAK, PIX, COOL; 2.80A {Rattus norvegicus} Back     alignment and structure
>2xnx_M M protein, M1-BC1; cell adhesion, virulence factor, streptococcal toxic shock S; 3.30A {Streptococcus pyogenes} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>4dzn_A Coiled-coil peptide CC-PIL; de novo protein; HET: PHI; 1.59A {Synthetic} PDB: 4dzm_A* 4dzl_A* 4dzk_A 1u0i_A 1u0i_B Back     alignment and structure
>3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B Back     alignment and structure
>1jcd_A Major outer membrane lipoprotein; protein folding, coiled coil, helix capping, alanine-zipper, membrane protein; 1.30A {Escherichia coli} SCOP: h.1.16.1 PDB: 1eq7_A 1t8z_A* 2guv_A 2gus_A 1jcc_A 1kfn_A 1kfm_A Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>3lay_A Zinc resistance-associated protein; salmonella typhimurium L structural genomics, center for structural genomics of INFE diseases; 2.70A {Salmonella enterica subsp} Back     alignment and structure
>1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>1use_A VAsp, vasodilator-stimulated phosphoprotein; signaling protein, null; 1.3A {Homo sapiens} SCOP: h.1.29.1 PDB: 1usd_A Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A Back     alignment and structure
>2d1l_A Metastasis suppressor protein 1; IRSP53, actin binding, IMD, protein binding; HET: MSE; 1.85A {Mus musculus} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>4e61_A Protein BIM1; EB1-like motif, coiled-coil, spindle orientation, mitosis, K phosphorylation, mitotic spindle, microtubules, cell cycle; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>2efk_A CDC42-interacting protein 4; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.30A {Homo sapiens} SCOP: a.238.1.4 Back     alignment and structure
>3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B Back     alignment and structure
>3fpp_A Macrolide-specific efflux protein MACA; hexameric assembly, membrane fusion protein, drug efflux pump, periplasmic protein; 2.99A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query276
d1fxka_107 Prefoldin beta subunit {Archaeon Methanobacterium 89.16
d2efla1288 Formin-binding protein 1, FNBP1 {Human (Homo sapie 84.71
>d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Prefoldin
family: Prefoldin
domain: Prefoldin beta subunit
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]
Probab=89.16  E-value=0.56  Score=34.71  Aligned_cols=66  Identities=17%  Similarity=0.244  Sum_probs=36.5

Q ss_pred             hhhhhhhhchhhHHHHHHHHHHH------------HHHHHHHHHHHHHHHHHHHHHHHHHhhhcchhHHHHHHHHHHHHH
Q 039268          106 KLEADLRATEPLKKEAVQLRAEV------------QKLNNLRNELNGKVQTLQKDLAKLQADNQQIPLLRAEIDGLHQEL  173 (276)
Q Consensus       106 KmEAelra~e~lk~El~q~raE~------------q~L~~~RqeL~~qvq~l~~eL~r~~ad~qqipal~aEie~lrqEl  173 (276)
                      .++++++-++-+-.||..+-.|.            +....+..+|..++..+..++.++.   +|+-.+..+++.++.+|
T Consensus        26 ~le~q~~E~~~vl~eL~~l~~d~~vyk~vG~vLv~~~~~e~~~~l~~~~e~l~~~i~~l~---~q~~~l~~~l~~~~~~l  102 (107)
T d1fxka_          26 TVEMQINETQKALEELSRAADDAEVYKSSGNILIRVAKDELTEELQEKLETLQLREKTIE---RQEERVMKKLQEMQVNI  102 (107)
T ss_dssp             HHHHHHHHHHHHHHHHHHSCTTCCEEEEETTEEEEECHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHcCCcccHHHHHhcchhhcCcHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHH
Confidence            55555555555555555443321            2345556666677777777766655   33455555566555555


Q ss_pred             H
Q 039268          174 M  174 (276)
Q Consensus       174 q  174 (276)
                      +
T Consensus       103 ~  103 (107)
T d1fxka_         103 Q  103 (107)
T ss_dssp             H
T ss_pred             H
Confidence            4



>d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure