Citrus Sinensis ID: 039394


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MEYLDLSDNQLSEEIPHCSRYWQSLKVLKSNHINGCVPIRLCYVRPVQVLDISYSSILGDIIIVSMIDLQMVQKKNSIAIINVVVVGELFKRPIPTKIDQLTMLHALDLSRNQPIGKIPEGISQLGLLGVLSLSNNKLSGKIPSGTKLQTLDASSYM
ccEEEcccccccccccHHHHccccccccccccccccccHHccccccccEEEcccccccccccccccccHHHHHccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHHcccccEEEccccccEEEcccccccccccccccc
ccEEEcccccccccccHHHHHHHHHHHHccccccccccHHHcccccccEEEcccccccccccHHHcccccHHHHccccccEEEEcccccccccccHHHHHcccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHcc
meyldlsdnqlseeiphcsRYWQSLKVLKSnhingcvpirlcyvrpvqvldisyssilgdIIIVSMIDLQMVQKKNSIAIINVVVVGelfkrpiptkidqLTMLHAldlsrnqpigkipegisqlGLLGVLSlsnnklsgkipsgtklqtldassym
meyldlsdnqlseeiPHCSRYWQSLKVLKSNHINGCVPIRLCYVRPVQVLDISYSSILGDIIIVSMIDLQMVQKKNSIAIINVVVVGELFKRPIPTKIDQLTMLHALDLSRNQPIGKIPEGISQLGLLGVLSLSnnklsgkipsgtklqtldassym
MEYLDLSDNQLSEEIPHCSRYWQSLKVLKSNHINGCVPIRLCYVRPVQVLDISYSSILGDIIIVSMIDLQMVQKKNSIAIINVVVVGELFKRPIPTKIDQLTMLHALDLSRNQPIGKIPEgisqlgllgvlslsnnklsgkiPSGTKLQTLDASSYM
**************IPHCSRYWQSLKVLKSNHINGCVPIRLCYVRPVQVLDISYSSILGDIIIVSMIDLQMVQKKNSIAIINVVVVGELFKRPIPTKIDQLTMLHALDLSRNQPIGKIPEGISQLGLLGVLSL************************
MEYLDLSDNQLSEEIPHCSRYWQSLKVLKSNHINGCVPIRLCYVRPVQVLDISYSSILGDIIIVSMIDLQMVQKKNSIAIINVVVVGELFKRPIPTKIDQLTMLHALDLSRNQPIGKIPEGISQLGLLGVLSLSNNKLSGKIPSGTKLQTLDASSYM
MEYLDLSDNQLSEEIPHCSRYWQSLKVLKSNHINGCVPIRLCYVRPVQVLDISYSSILGDIIIVSMIDLQMVQKKNSIAIINVVVVGELFKRPIPTKIDQLTMLHALDLSRNQPIGKIPEGISQLGLLGVLSLSNNKLSGKIPSGTKLQTLDASSYM
MEYLDLSDNQLSEEIPHCSRYWQSLKVLKSNHINGCVPIRLCYVRPVQVLDISYSSILGDIIIVSMIDLQMVQKKNSIAIINVVVVGELFKRPIPTKIDQLTMLHALDLSRNQPIGKIPEGISQLGLLGVLSLSNNKLSGKIPSGTKLQTLDASSYM
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEYLDLSDNQLSEEIPHCSRYWQSLKVLKSNHINGCVPIRLCYVRPVQVLDISYSSILGDIIIVSMIDLQMVQKKNSIAIINVVVVGELFKRPIPTKIDQLTMLHALDLSRNQPIGKIPEGISQLGLLGVLSLSNNKLSGKIPSGTKLQTLDASSYM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query157 2.2.26 [Sep-21-2011]
C0LGX3 993 LRR receptor-like serine/ yes no 0.834 0.131 0.287 4e-12
C0LGS2 1136 Probable LRR receptor-lik no no 0.917 0.126 0.347 2e-11
Q8LPB4 1021 Phytosulfokine receptor 1 N/A no 0.904 0.139 0.333 1e-10
Q8VZG8 1045 Probable LRR receptor-lik no no 0.929 0.139 0.322 4e-10
Q9ZWC8 1166 Serine/threonine-protein no no 0.910 0.122 0.298 6e-10
Q9LJF3 1164 Receptor-like protein kin no no 0.917 0.123 0.290 1e-09
Q9FL28 1173 LRR receptor-like serine/ no no 0.847 0.113 0.303 1e-09
P47735 999 Receptor-like protein kin no no 0.929 0.146 0.306 2e-09
C0LGW6 966 LRR receptor-like serine/ no no 0.859 0.139 0.296 3e-09
Q9FL51 872 Probably inactive leucine no no 0.840 0.151 0.296 4e-09
>sp|C0LGX3|HSL2_ARATH LRR receptor-like serine/threonine-protein kinase HSL2 OS=Arabidopsis thaliana GN=HSL2 PE=2 SV=1 Back     alignment and function desciption
 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 90/174 (51%), Gaps = 43/174 (24%)

Query: 1   MEYLDLSDNQLSEEIPHCSRYWQ----------------------------SLKVLKSNH 32
           + Y+ ++DN+LS E+P  +R+W+                            S   + +N+
Sbjct: 413 LNYIRMADNKLSGEVP--ARFWELPLTRLELANNNQLQGSIPPSISKARHLSQLEISANN 470

Query: 33  INGCVPIRLCYVRPVQVLDISYSSILGDI--IIVSMIDLQMVQKKNSIAIINVVVVGELF 90
            +G +P++LC +R ++V+D+S +S LG I   I  + +L+ V+ + ++      + GE  
Sbjct: 471 FSGVIPVKLCDLRDLRVIDLSRNSFLGSIPSCINKLKNLERVEMQENM------LDGE-- 522

Query: 91  KRPIPTKIDQLTMLHALDLSRNQPIGKIPEGISQLGLLGVLSLSNNKLSGKIPS 144
              IP+ +   T L  L+LS N+  G IP  +  L +L  L LSNN+L+G+IP+
Sbjct: 523 ---IPSSVSSCTELTELNLSNNRLRGGIPPELGDLPVLNYLDLSNNQLTGEIPA 573




Receptor-like serine/threonine-kinase acting on substrates that controls floral organ abscission. Regulated by the 'INFLORESCENCE DEFICIENT IN ABSCISSION' (IDA) family of ligands.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|P47735|RLK5_ARATH Receptor-like protein kinase 5 OS=Arabidopsis thaliana GN=RLK5 PE=1 SV=1 Back     alignment and function description
>sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL51|Y5694_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940 OS=Arabidopsis thaliana GN=At5g06940 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
147843620 722 hypothetical protein VITISV_031344 [Viti 0.993 0.216 0.347 2e-16
359490562 1412 PREDICTED: LRR receptor-like serine/thre 0.993 0.110 0.325 5e-16
357493295 1251 Receptor protein kinase-like protein [Me 0.949 0.119 0.322 8e-15
147839869 2041 hypothetical protein VITISV_037104 [Viti 1.0 0.076 0.293 1e-14
147834202 1270 hypothetical protein VITISV_011552 [Viti 0.968 0.119 0.315 3e-14
222630747 703 hypothetical protein OsJ_17682 [Oryza sa 0.955 0.213 0.333 3e-14
225462661 1485 PREDICTED: LRR receptor-like serine/thre 0.968 0.102 0.324 4e-14
147795695 1680 hypothetical protein VITISV_022720 [Viti 0.821 0.076 0.335 5e-14
359490576 972 PREDICTED: LRR receptor-like serine/thre 0.821 0.132 0.335 7e-14
357443741251 Receptor-like protein kinase [Medicago t 0.866 0.541 0.358 3e-13
>gi|147843620|emb|CAN79880.1| hypothetical protein VITISV_031344 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/170 (34%), Positives = 95/170 (55%), Gaps = 14/170 (8%)

Query: 1   MEYLDLSDNQLSEEIPHCSRYWQSLKVLK--SNHINGCVPIRLCYVRPVQVL-------D 51
           + +LDLS+N+LS E+P+C   W+ L VL   +N+ +G +      +  +Q L       +
Sbjct: 452 LSHLDLSNNRLSGELPNCWGQWKDLIVLNLANNNFSGKIKNSXGLLHQIQTLHLRNNRKE 511

Query: 52  ISYSSILGDIIIVSMIDLQMVQK-----KNSIAIINVVVVGELFKRPIPTKIDQLTMLHA 106
           + Y   LG I  +   + +++ +      + + ++++ +        IP+ I QL  L  
Sbjct: 512 LEYKKTLGLIRSIDFSNNKLIGEIPXEVTDLVELVSLNLSRNNLTGSIPSMIGQLKSLDF 571

Query: 107 LDLSRNQPIGKIPEGISQLGLLGVLSLSNNKLSGKIPSGTKLQTLDASSY 156
           LDLS+NQ  G+IP  +SQ+  L VL LSNN L GKIPSGT+LQ+  AS+Y
Sbjct: 572 LDLSQNQLHGRIPASLSQIADLSVLDLSNNNLLGKIPSGTQLQSFSASTY 621




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359490562|ref|XP_003634112.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357493295|ref|XP_003616936.1| Receptor protein kinase-like protein [Medicago truncatula] gi|355518271|gb|AES99894.1| Receptor protein kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|147839869|emb|CAN68235.1| hypothetical protein VITISV_037104 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147834202|emb|CAN64227.1| hypothetical protein VITISV_011552 [Vitis vinifera] Back     alignment and taxonomy information
>gi|222630747|gb|EEE62879.1| hypothetical protein OsJ_17682 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|225462661|ref|XP_002266475.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147795695|emb|CAN67736.1| hypothetical protein VITISV_022720 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490576|ref|XP_003634117.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357443741|ref|XP_003592148.1| Receptor-like protein kinase [Medicago truncatula] gi|355481196|gb|AES62399.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
TAIR|locus:2169975 993 HSL2 "HAESA-like 2" [Arabidops 0.732 0.115 0.296 6.3e-07
TAIR|locus:2154344 1135 AT5G48940 [Arabidopsis thalian 0.675 0.093 0.354 7.4e-07
TAIR|locus:2047525 980 AT2G24130 [Arabidopsis thalian 0.694 0.111 0.305 2.1e-06
TAIR|locus:2040075 935 RLP21 "AT2G25470" [Arabidopsis 0.515 0.086 0.294 2.2e-06
TAIR|locus:2046357 890 RLP23 "receptor like protein 2 0.363 0.064 0.327 2.9e-06
TAIR|locus:2206245 720 CLV2 "clavata 2" [Arabidopsis 0.681 0.148 0.313 5e-06
TAIR|locus:2007918 1088 PEPR2 "PEP1 receptor 2" [Arabi 0.681 0.098 0.313 5e-06
TAIR|locus:2094613 784 RLP38 "receptor like protein 3 0.363 0.072 0.349 5.2e-06
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.700 0.093 0.305 7e-06
TAIR|locus:2052367 462 RLP29 "receptor like protein 2 0.904 0.307 0.277 7.2e-06
TAIR|locus:2169975 HSL2 "HAESA-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 127 (49.8 bits), Expect = 6.3e-07, P = 6.3e-07
 Identities = 40/135 (29%), Positives = 76/135 (56%)

Query:     4 LDLSDN-QLSEEIPHC---SRYWQSLKVLKSNHINGCVPIRLCYVRPVQVLDISYSSILG 59
             L+L++N QL   IP     +R+   L++  +N+ +G +P++LC +R ++V+D+S +S LG
Sbjct:   439 LELANNNQLQGSIPPSISKARHLSQLEI-SANNFSGVIPVKLCDLRDLRVIDLSRNSFLG 497

Query:    60 DI--IIVSMIDLQMVQKKNSI-------AIINVVVVGEL------FKRPIPTKIDQLTML 104
              I   I  + +L+ V+ + ++       ++ +   + EL       +  IP ++  L +L
Sbjct:   498 SIPSCINKLKNLERVEMQENMLDGEIPSSVSSCTELTELNLSNNRLRGGIPPELGDLPVL 557

Query:   105 HALDLSRNQPIGKIP 119
             + LDLS NQ  G+IP
Sbjct:   558 NYLDLSNNQLTGEIP 572


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
TAIR|locus:2154344 AT5G48940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047525 AT2G24130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046357 RLP23 "receptor like protein 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206245 CLV2 "clavata 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2007918 PEPR2 "PEP1 receptor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094613 RLP38 "receptor like protein 38" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2052367 RLP29 "receptor like protein 29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00006450001
SubName- Full=Chromosome undetermined scaffold_171, whole genome shotgun sequence; (958 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-09
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-06
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-05
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 64.1 bits (156), Expect = 1e-12
 Identities = 48/147 (32%), Positives = 76/147 (51%), Gaps = 11/147 (7%)

Query: 1   MEYLDLSDNQLSEEIPHCSRYWQSLK--VLKSNHINGCVPIRLCYVRPVQVLDISYSSIL 58
           +E+L L+ NQL  +IP      +SLK   L  N+++G +P  +  +  +  LD+ Y+++ 
Sbjct: 190 LEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLT 249

Query: 59  GDIIIVSMIDLQMVQKKNSIAIINVVVVGELFKRPIPTKIDQLTMLHALDLSRNQPIGKI 118
           G I   S+ +L+ +Q         + +       PIP  I  L  L +LDLS N   G+I
Sbjct: 250 GPIP-SSLGNLKNLQY--------LFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEI 300

Query: 119 PEGISQLGLLGVLSLSNNKLSGKIPSG 145
           PE + QL  L +L L +N  +GKIP  
Sbjct: 301 PELVIQLQNLEILHLFSNNFTGKIPVA 327


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 157
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.78
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.76
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.57
KOG0617264 consensus Ras suppressor protein (contains leucine 99.56
KOG0617 264 consensus Ras suppressor protein (contains leucine 99.49
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.48
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.48
PLN03150623 hypothetical protein; Provisional 99.36
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.34
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.34
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.3
PLN03150 623 hypothetical protein; Provisional 99.25
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.18
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.14
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.05
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.03
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.03
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.01
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.0
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.0
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.98
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.96
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.96
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.95
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.9
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.89
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.88
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.88
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.68
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.51
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.46
KOG1259 490 consensus Nischarin, modulator of integrin alpha5 98.43
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.3
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.25
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.23
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 98.22
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.03
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.97
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.95
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.94
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.92
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.87
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.86
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.82
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.64
PRK15386 426 type III secretion protein GogB; Provisional 97.54
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.47
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 97.45
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.43
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.29
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.97
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.72
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.62
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.46
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.36
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.29
PRK15386 426 type III secretion protein GogB; Provisional 96.27
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.21
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.06
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.8
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.09
KOG2123 388 consensus Uncharacterized conserved protein [Funct 94.56
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 94.28
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.72
KOG2982 418 consensus Uncharacterized conserved protein [Funct 93.48
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 91.58
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.23
smart0037026 LRR Leucine-rich repeats, outliers. 91.23
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 91.02
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 90.63
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 90.36
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 87.33
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 84.7
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 83.71
KOG0473 326 consensus Leucine-rich repeat protein [Function un 81.22
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.78  E-value=7.3e-19  Score=145.52  Aligned_cols=155  Identities=28%  Similarity=0.415  Sum_probs=95.3

Q ss_pred             cEEECcCCccccccCcchhcccccccc--ccccceeecCccCcCC------------------------CCCCEEEccCC
Q 039394            2 EYLDLSDNQLSEEIPHCSRYWQSLKVL--KSNHINGCVPIRLCYV------------------------RPVQVLDISYS   55 (157)
Q Consensus         2 ~~L~L~~n~l~~~~p~~~~~l~~L~~L--~~n~~~~~~p~~~~~l------------------------~~L~~L~l~~n   55 (157)
                      +.+++++|.+.+.+|..+..+++|+.|  .+|.+.+..|..+..+                        ++|++|++++|
T Consensus       383 ~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n  462 (968)
T PLN00113        383 FKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARN  462 (968)
T ss_pred             CEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCc
Confidence            445555555555555555555555555  4444444444444444                        44455555555


Q ss_pred             cceeecc------eeeeeecccccccceE--EEceeeeeccc------cccccccccccccCCCEEecCCCccCCCCChh
Q 039394           56 SILGDII------IVSMIDLQMVQKKNSI--AIINVVVVGEL------FKRPIPTKIDQLTMLHALDLSRNQPIGKIPEG  121 (157)
Q Consensus        56 ~~~~~~~------~l~~l~l~~n~l~~~~--~~~~~~~l~~~------~~~~~p~~~~~l~~L~~L~l~~N~l~~~~p~~  121 (157)
                      .+.+.+|      +++.|++++|.+.+..  .+..+..+..+      +.+.+|..+..+++|++|++++|.+.+.+|..
T Consensus       463 ~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~  542 (968)
T PLN00113        463 KFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPAS  542 (968)
T ss_pred             eeeeecCcccccccceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChh
Confidence            4444433      4566666666665443  33333334333      55667777777888888888888888788888


Q ss_pred             hhcCCCCCeEEccCCcceecCCCC----CCcccccCCCC
Q 039394          122 ISQLGLLGVLSLSNNKLSGKIPSG----TKLQTLDASSY  156 (157)
Q Consensus       122 ~~~l~~L~~L~ls~N~l~~~~p~~----~~l~~l~~~~~  156 (157)
                      +..+++|+.|++++|.++|.+|..    +.++.++++.+
T Consensus       543 ~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N  581 (968)
T PLN00113        543 FSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHN  581 (968)
T ss_pred             HhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCC
Confidence            888888888888888888777765    55667776654



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-20
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-20
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-19
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-13
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-12
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-13
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-09
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-08
3jqh_A 167 C-type lectin domain family 4 member M; DC-signr, 2e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-06
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 7e-08
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 8e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-07
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-06
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 9e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-06
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 6e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 9e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-04
3m19_A 251 Variable lymphocyte receptor A diversity region; a 2e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2v70_A 220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-06
2v9t_B 220 SLIT homolog 2 protein N-product; structural prote 7e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-06
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-04
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 8e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-05
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-04
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-06
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-05
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-05
3rfs_A 272 Internalin B, repeat modules, variable lymphocyte 2e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-04
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-04
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 2e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-04
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 2e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 9e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-04
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 2e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-05
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score = 85.7 bits (213), Expect = 2e-20
 Identities = 33/159 (20%), Positives = 62/159 (38%), Gaps = 35/159 (22%)

Query: 1   MEYLDLSDNQLSEEIPHCSRYWQSLKVLK--SNHINGCVPIRLCYVRPVQVLDISYSSIL 58
               +++                S+  L    N ++G +P  +  +  + +L++ ++ I 
Sbjct: 610 RNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDIS 669

Query: 59  GDIIIVSMIDLQMVQKKNSIAIINVVVVGELFKRPIPTKIDQLTMLHALDLSRNQPIGKI 118
           G                                  IP ++  L  L+ LDLS N+  G+I
Sbjct: 670 G---------------------------------SIPDEVGDLRGLNILDLSSNKLDGRI 696

Query: 119 PEGISQLGLLGVLSLSNNKLSGKIPSGTKLQTLDASSYM 157
           P+ +S L +L  + LSNN LSG IP   + +T   + ++
Sbjct: 697 PQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFL 735


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.89
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.87
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.87
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.84
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.83
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.83
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.79
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.79
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.78
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.77
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.77
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.77
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.76
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.74
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.74
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.74
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.74
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.74
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.74
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.73
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.73
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.73
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.73
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.73
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.73
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.73
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.73
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 99.72
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.72
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.72
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.72
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.72
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.72
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.72
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.72
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.72
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.71
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.71
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.71
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.71
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.7
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.7
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.7
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.69
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.69
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.69
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.69
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.69
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.69
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.68
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.68
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.68
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.68
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.67
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.67
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.67
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.67
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.67
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.67
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.66
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.66
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.66
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.66
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.66
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.65
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.65
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.65
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.64
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.64
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.63
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.63
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.63
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.62
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.62
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.62
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.62
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 99.62
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.62
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.61
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.61
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.6
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.6
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.6
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.59
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.59
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.58
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.58
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.57
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.56
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.56
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.56
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.56
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.55
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.54
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.53
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.53
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.52
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.52
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.51
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.5
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.5
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.49
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.49
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.49
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.48
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.48
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.47
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.46
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.46
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.45
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.45
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.43
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.42
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.4
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.37
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.36
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.33
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.31
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.3
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.3
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.27
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.24
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.22
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.18
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.07
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.02
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.77
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.72
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.63
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.5
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.5
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.49
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.38
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.36
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.22
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.1
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.08
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.93
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.93
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.17
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.98
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.83
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.64
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.57
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.31
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.3
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.72
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.56
4gt6_A394 Cell surface protein; leucine rich repeats, putati 95.25
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.1
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 95.1
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=99.89  E-value=1e-22  Score=163.70  Aligned_cols=75  Identities=25%  Similarity=0.337  Sum_probs=41.9

Q ss_pred             CcEEECcCCccccccCcchhcccccccc--ccccceeecCccCcCCCCCCEEEccCCcceeecc-------eeeeeeccc
Q 039394            1 MEYLDLSDNQLSEEIPHCSRYWQSLKVL--KSNHINGCVPIRLCYVRPVQVLDISYSSILGDII-------IVSMIDLQM   71 (157)
Q Consensus         1 L~~L~L~~n~l~~~~p~~~~~l~~L~~L--~~n~~~~~~p~~~~~l~~L~~L~l~~n~~~~~~~-------~l~~l~l~~   71 (157)
                      |++|++++|.+++.+|..+..+++|++|  .+|.+.+.+|..++.+++|++|++++|.+.+.+|       +++.+++++
T Consensus       468 L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~  547 (768)
T 3rgz_A          468 LETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNT  547 (768)
T ss_dssp             CCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCS
T ss_pred             ceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCC
Confidence            3455666666665555555555555555  5555555555555555555555555555554443       445555555


Q ss_pred             cccc
Q 039394           72 VQKK   75 (157)
Q Consensus        72 n~l~   75 (157)
                      |.+.
T Consensus       548 N~l~  551 (768)
T 3rgz_A          548 NLFN  551 (768)
T ss_dssp             SEEE
T ss_pred             CccC
Confidence            5443



>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 157
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-05
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 59.0 bits (141), Expect = 1e-11
 Identities = 34/156 (21%), Positives = 59/156 (37%), Gaps = 8/156 (5%)

Query: 1   MEYLDLSDNQLSEEIPHCSRYWQSLKVLKSNHINGCVPIRLCYVRPVQVLDISYSSILGD 60
           +  +    N++S  IP     +  L    +   N            + +  +  S  + +
Sbjct: 151 LVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLE 210

Query: 61  IIIVSMIDLQMVQKKNSIAIINVVVVGELFKRPIPTKIDQLTMLHALDLSRNQPIGKIPE 120
                +       +K  +A                 K+     L+ LDL  N+  G +P+
Sbjct: 211 GDASVLFGSDKNTQKIHLAKN--------SLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQ 262

Query: 121 GISQLGLLGVLSLSNNKLSGKIPSGTKLQTLDASSY 156
           G++QL  L  L++S N L G+IP G  LQ  D S+Y
Sbjct: 263 GLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAY 298


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.81
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.75
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.71
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.67
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.66
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.65
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.62
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.61
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.59
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.59
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.5
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.48
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.46
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.44
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.43
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.42
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.34
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.33
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.32
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.31
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.28
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.24
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.23
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.16
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.13
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.11
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.03
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.02
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.87
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.72
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.61
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.58
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.54
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.39
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.22
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.21
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.83
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.38
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.93
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.07
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 93.89
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.81  E-value=3.7e-20  Score=132.79  Aligned_cols=60  Identities=33%  Similarity=0.565  Sum_probs=51.3

Q ss_pred             cccccccCCCEEecCCCccCCCCChhhhcCCCCCeEEccCCcceecCCCCC---CcccccCCC
Q 039394           96 TKIDQLTMLHALDLSRNQPIGKIPEGISQLGLLGVLSLSNNKLSGKIPSGT---KLQTLDASS  155 (157)
Q Consensus        96 ~~~~~l~~L~~L~l~~N~l~~~~p~~~~~l~~L~~L~ls~N~l~~~~p~~~---~l~~l~~~~  155 (157)
                      ..+..+++++.|++++|++.|.+|++++.+++|++|++++|.++|.+|+..   .++.++++.
T Consensus       238 ~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~  300 (313)
T d1ogqa_         238 GKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYAN  300 (313)
T ss_dssp             GGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCS
T ss_pred             cccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHhCC
Confidence            356778899999999999999999999999999999999999999999874   444455543



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure