Citrus Sinensis ID: 039402


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------
MLLGADFLLKPIFLRWFSCSLHLVLLVGLLVSWVWNKIKTGEGDHNRGSREMFKNKKALWYKLTLACCFGVSLFNIVFSLLSYFYWYENGWSDYQLVTLLDFGVKTLGWSAICVCLHTVFLNSRQPKLPILLKLWWAFYVFISCYCLIVDIVLCEKQVSLQIQYLISDVASAMTGLFLCFVGILSKIEGEDALLLREPLLKADSNETDGTVPSIKSEGADKLTPYSRAGVLSVITYSWINSLIALGNKKTLDLEDVPQLDSGDSVSGAFANFKNKLETEGGVGSGLTTVKLIKAMFCSVWKDVLVTGFLTVLYTLASYVGPYLIDTFVQYLNGRRDFENEGYVLVSAFCVAKLVECLCQRFRVFRLQQLGIRMRAALIAMIYNKGLTLSSQAKQGQSSGEIINFMTVDAERVADFSWYIHDPWLVLFEVALSILILYKNLGIASLAALFGTVIVMLVNIPLGRVQENFQDKLMKSKDERMKATSEILRNMRILKLQGWEMKFLSKIINLRKRETGWLKKYVYTSAISSFVFWGAPTFVSVATFGTCILLNVPLESGKMLSAIATFRLLQVPIYNLPDVISMIIQTKVSLQRIASFFCLDDLQPDLVEKQPSGSSETALDIVDGNFSWDISSHNPTLKDINLKVFHGMRVAVCGTVGSGKSSLLSCILGEVPKISGTLKLCGTKAYVAQSPWIQSGKIEDNILFGKEMNRERYNAVLDACSLKKDLEILSFGDQTVIGERGINLSGGQKQRIQIARALYQDSDIYLFDDPFSAVDAHTGSHLFQEVLLGLLSSKTVIYVTHQVEFLPAADLILVMKDGKITQAGKYNDLINSGTDFMELVGAHEQALLALGSIEGRPASERASGENGGTVIANRIVKEVENNKGQNDKADEVAVSKGQLVQEEEREKGKVGFSVYWKYITTAFGGALVPFILLAQTLFQILQIASNYWIVWATPGTKDVKPVVTGSTLLIVYVALAVGSSFCVLARSTLLATAGYKTATLLFNEMHYCIFRAPMSFFDATPSGRIINRASTDQSAADLGIPSLVGAYAFSIIRILGTIAVMSQVAWQVFIVFVPAVGSCIWYQQYYISSARELSRLVGVCKAPVIQHFAETVSGSTTIRSFDQESRFRDRNMKLMDEYSRPTFHIAAAMEWLGLRLDMLSSITFAFTLVFLISIPKGFIDPAIAGLAVTYGLTLNTLLATLIWFACDLENKIISVERIFQYTCIPSEPPLAIEESRPNDSWPSHGKIDLLDLQVRYAPQMPLVLQGISCTFPGGEKTGIVGRTGSGKSTLIQTLFRIVEPAAGQILIDGIDISLIGLHDLRSRLSIIPQDPVMFEGTVRSNLDPLEESTDEQIWEALDKCQLGDEVRKKEGKLDSKVTENGENWSMGQRQLVCLGRVLLKRSKILMLDEATASVDTATDNLIQQTLRQHFSDCTVLTIAHRITSVIDSDLVLLLNHGLIEEFDNPANLLENKSSSFSQLVAEYTLRSSSSFENLAGN
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEEEEEcccccccccccEEEEEEcccEEEEEccccccHHHHHHHHHcccccccEEEEEccEEEEEccccccccccccccccccccccHHHHHHHHHHcccHHHHHHcccccccccccccccccHHHHHHHHHHHHHcccccEEEcccccHHHcHHHHHHHHHHHHHHHcccccEEEEcccccccccccEEEEEEccEEEEEccHHHHHHcccHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHccccccccHHHHHHccccccHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccccccccccccccccccccccccEEEEEEEEEEEcccccccccccEEEEccccEEEEEccccccHHHHHHHHHHccccccccEEEcccccccccHHHHcccccccccccccccccccccccccccccHHHHHHHHHHccccHHHHccccccccccccccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHcccccEEEEEEccccccccccEEEEEEccEEEEcccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcc
cccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHcccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEEEccccccccEEccEEEEEccccEEEEEEcccccHHHHHHHHHHHccccccEEEEEcEEEEEccccEEEcccHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHcccHHHccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHccccEEEEEEEEEccccccEEEEEEccEEEEcccHHHHHHcccHHHHHHHHHHHHHHHccHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEEEEccccccccEEEEEEEEccccEEEEEccccccHHHHHHHHcccccccEEEEEEccEEHHHEcHHHHHHHEEEEcccccccccEHHHHHcccccccHHHHHHHHHHHcHHHHHHHcccccccEEccccccccHHHHHHHHHHHHHHHcccEEEEcccHHcccHHHHHHHHHHHHHHHcccEEEEEEEEccccccccEEEEEcccEEEEcccHHHHHHcccHHHHHHHHHHccccHHHHHHHccc
mllgadfllkpifLRWFSCSLHLVLLVGLLVSWVWNkiktgegdhnrgsremfkNKKALWYKLTLACCFGVSLFNIVFSLLSYFYWyengwsdyQLVTLLDFGVKTLGWSAICVCLHTVflnsrqpklpILLKLWWAFYVFISCYCLIVDIVLCEKQVSLQIQYLISDVASAMTGLFLCFVGILSKIEGEDALllrepllkadsnetdgtvpsiksegadkltpysragVLSVITYSWINSLIAlgnkktldledvpqldsgdsvsGAFANFKNkleteggvgsglTTVKLIKAMFCSVWKDVLVTGFLTVLYTLASYVGPYLIDTFVQYLNGrrdfenegYVLVSAFCVAKLVECLCQRFRVFRLQQLGIRMRAALIAMIYNkgltlssqakqgqssgeIINFMTVdaervadfswyihdpWLVLFEVALSILILYKNLGIASLAALFGTVIVMLVNiplgrvqeNFQDKLMKSKDERMKATSEILRNMRILKLQGWEMKFLSKIINLRKRETGWLKKYVYTSAISSFvfwgaptfvsVATFGTCIllnvplesgkMLSAIATFRLlqvpiynlpDVISMIIQTKVSLQRIASffclddlqpdlvekqpsgssetaldivdgnfswdisshnptlkdinlkvfHGMRVAVCgtvgsgksSLLSCILgevpkisgtlklcgtkayvaqspwiqsgkiednilfGKEMNRERYNAVLDACSLkkdleilsfgdqtvigerginlsggQKQRIQIARALyqdsdiylfddpfsavdahtgshLFQEVLLGLLSSKTVIYVTHQVEFLPAADLILVMKdgkitqagkyndlinSGTDFMELVGAHEQALLALGsiegrpaserasgenggtVIANRIVKEvennkgqndkadevAVSKGQLvqeeerekgkvGFSVYWKYITTAFGGALVPFILLAQTLFQILQIASNYWivwatpgtkdvkpvvtGSTLLIVYVALAVGSSFCVLARSTLLATAGYKTATLLFNEMHYCifrapmsffdatpsgriinrastdqsaadlgipslVGAYAFSIIRILGTIAVMSQVAWQVFIVFVPAVGSCIWYQQYYISSARELSRLVGVCKAPVIQHFAetvsgsttirsfdqesrfrdrnmklmdeysrpTFHIAAAMEWLGLRLDMLSSITFAFTLVFLIsipkgfidpaIAGLAVTYGLTLNTLLATLIWFACDLENKIISVERIFqytcipsepplaieesrpndswpshgkidlldlqvryapqmplvlqgisctfpggektgivgrtgsgksTLIQTLFRIVepaagqilidgidisliglhdlrsrlsiipqdpvmfegtvrsnldpleestDEQIWEALDkcqlgdevrkkegkldskvtengenwsmGQRQLVCLGRVLLKRSKILMLDEATASVDTATDNLIQQTLRQHFSDCTVLTIAHRITSVIDSDLVLLLNHglieefdnpanllenkssSFSQLVAEYTLrssssfenlagn
MLLGADFLLKPIFLRWFSCSLHLVLLVGLLVSWVWNKIKtgegdhnrgsremFKNKKALWYKLTLACCFGVSLFNIVFSLLSYFYWYENGWSDYQLVTLLDFGVKTLGWSAICVCLHTVFLNSRQPKLPILLKLWWAFYVFISCYCLIVDIVLCEKQVSLQIQYLISDVASAMTGLFLCFVGILSKIEGEDALLLREpllkadsnetdgtvpsiksegadkltpySRAGVLSVITYSWINSLIALGNKKTLDLEDVPQLDSGDSVSGAFANFKNkleteggvgsGLTTVKLIKAMFCSVWKDVLVTGFLTVLYTLASYVGPYLIDTFVQYLNGRRDFENEGYVLVSAFCVAKLVECLCQRFRVFRLQQLGIRMRAALIAMIYNKGLTLSSQAKQGQSSGEIINFMTVDAERVADFSWYIHDPWLVLFEVALSILILYKNLGIASLAALFGTVIVMLVNIPLGRVQENFQDKLMKSKDERMKATSEILRNMRILKLQGWEMKFLSKIINLRKRETGWLKKYVYTSAISSFVFWGAPTFVSVATFGTCILLNVPLESGKMLSAIATFRLLQVPIYNLPDVISMIIQTKVSLQRIASFFCLDDLQPDLVEKQPSGSSETALDIVDGNFSWDISSHNPTLKDINLKVFHGMRVAVCGTVGSGKSSLLSCILGEVPKISGTLKLCGTKAYvaqspwiqsgkiEDNILFGKEMNRERYNAVLDACSLKKDLEILSFGDQTVIGErginlsggqKQRIQIARALYQDSDIYLFDDPFSAVDAHTGSHLFQEVLLGLLSSKTVIYVTHQVEFLPAADLILVMKDGKITQAGKYNDLINSGTDFMELVGAHEQALLALGSIEGRPaserasgenggtviANRIVKevennkgqndkadevavskgqlvqeeerekgkvgfSVYWKYITTAFGGALVPFILLAQTLFQILQIASNYWIVWATPGTKDVKPVVTGSTLLIVYVALAVGSSFCVLARSTLLATAGYKTATLLFNEMHYCIFRAPMSFFDATPSGRIINRASTDQSAADLGIPSLVGAYAFSIIRILGTIAVMSQVAWQVFIVFVPAVGSCIWYQQYYISSARELSRLVGVCKAPVIQHfaetvsgsttirsfdqesrfrDRNMKLMDEYSRPTFHIAAAMEWLGLRLDMLSSITFAFTLVFLISIPKGFIDPAIAGLAVTYGLTLNTLLATLIWFACDLENKIISVERIFQYTCIPSEPPLAIEESRPNDSWPSHGKIDLLDLQVRYAPQMPLVLQGISCTFPGGEKTGIVGRTGSGKSTLIQTLFRIVEPAAGQILIDGIDISLIGLHDLRSRLSIIPQDPVMFEGTVRSNLDPLEESTDEQIWEAldkcqlgdevrkkegkldskvtengenwsmgqrqLVCLGRVLLKRSKILMLDEATASVDTATDNLIQQTLRQHFSDCTVLTIAHRITSVIDSDLVLLLNHGLIEEFDNPANLLENKSSSFSQLVAEytlrssssfenlagn
MLLGADFLLKPIFLRWFSCSlhlvllvgllvSWVWNKIKTGEGDHNRGSREMFKNKKALWYKLTLACCFGVSLFNIVFSLLSYFYWYENGWSDYQLVTLLDFGVKTLGWSAICVCLHTVFLNSRQPKLPILLKLWWAFYVFISCYCLIVDIVLCEKQVSLQIQYLISDVASAMTGLFLCFVGILSKIEGEDALLLREPLLKADSNETDGTVPSIKSEGADKLTPYSRAGVLSVITYSWINSLIALGNKKTLDLEDVPQLDSGDSVSGAFANFKNKLETEGGVGSGLTTVKLIKAMFCSVWKDVLVTGFLTVLYTLASYVGPYLIDTFVQYLNGRRDFENEGYVLVSAFCVAKLVECLCQRFRVFRLQQLGIRMRAALIAMIYNKGLTLSSQAKQGQSSGEIINFMTVDAERVADFSWYIHDPWLVLFEVALSILILYKNLGIASLAALFGTVIVMLVNIPLGRVQENFQDKLMKSKDERMKATSEILRNMRILKLQGWEMKFLSKIINLRKRETGWLKKYVYTSAISSFVFWGAPTFVSVATFGTCILLNVPLESGKMLSAIATFRLLQVPIYNLPDVISMIIQTKVSLQRIASFFCLDDLQPDLVEKQPSGSSETALDIVDGNFSWDISSHNPTLKDINLKVFHGMRVAVCGTVGSGKSSLLSCILGEVPKISGTLKLCGTKAYVAQSPWIQSGKIEDNILFGKEMNRERYNAVLDACSLKKDLEILSFGDQTVIGERGINLSGGQKQRIQIARALYQDSDIYLFDDPFSAVDAHTGSHLFQEVLLGLLSSKTVIYVTHQVEFLPAADLILVMKDGKITQAGKYNDLINSGTDFMELVGAHEQALLALGSIEGRPASERASGENGGTVIANRIVKEVENNKGQNDKADEVAVSKGQLVQEEEREKGKVGFSVYWKYITTAFGGALVPFILLAQTLFQILQIASNYWIVWATPGTKDVKPVVTGSTLLIVYVALAVGSSFCVLARSTLLATAGYKTATLLFNEMHYCIFRAPMSFFDATPSGRIINRASTDQSAADLGIPSLVGAYAFSIIRILGTIAVMSQVAWQVFIVFVPAVGSCIWYQQYYISSARELSRLVGVCKAPVIQHFAETVSGSTTIRSFDQESRFRDRNMKLMDEYSRPTFHIAAAMEWLGLRLDMLSSITFAFTLVFLISIPKGFIDPAIAGLAVTYGLTLNTLLATLIWFACDLENKIISVERIFQYTCIPSEPPLAIEESRPNDSWPSHGKIDLLDLQVRYAPQMPLVLQGISCTFPGGEKTGIVGRTGSGKSTLIQTLFRIVEPAAgqilidgidisliglhdlRSRLSIIPQDPVMFEGTVRSNLDPLEESTDEQIWEALDKCQLGDEVRKKEGKLDSKVTENGENWSMGQRQLVCLGRVLLKRSKILMLDEATASVDTATDNLIQQTLRQHFSDCTVLTIAHRITSVIDSDLVLLLNHGLIEEFDNPANLLENKSSSFSQLVAEYTLRSSSSFENLAGN
**LGADFLLKPIFLRWFSCSLHLVLLVGLLVSWVWNKIKTGE*********MFKNKKALWYKLTLACCFGVSLFNIVFSLLSYFYWYENGWSDYQLVTLLDFGVKTLGWSAICVCLHTVFLNSRQPKLPILLKLWWAFYVFISCYCLIVDIVLCEKQVSLQIQYLISDVASAMTGLFLCFVGILSKIEGEDALLLREPL***********************TPYSRAGVLSVITYSWINSLIALGNKKTLDLEDV**********GAFANFKNKLETEGGVGSGLTTVKLIKAMFCSVWKDVLVTGFLTVLYTLASYVGPYLIDTFVQYLNGRRDFENEGYVLVSAFCVAKLVECLCQRFRVFRLQQLGIRMRAALIAMIYNKGLTL**********GEIINFMTVDAERVADFSWYIHDPWLVLFEVALSILILYKNLGIASLAALFGTVIVMLVNIPLGRVQENF****************EILRNMRILKLQGWEMKFLSKIINLRKRETGWLKKYVYTSAISSFVFWGAPTFVSVATFGTCILLNVPLESGKMLSAIATFRLLQVPIYNLPDVISMIIQTKVSLQRIASFFCLDDLQPD************ALDIVDGNFSWDISSHNPTLKDINLKVFHGMRVAVCGTVGSGKSSLLSCILGEVPKISGTLKLCGTKAYVAQSPWIQSGKIEDNILFGKEMNRERYNAVLDACSLKKDLEILSFGDQTVIGERGINLSGGQKQRIQIARALYQDSDIYLFDDPFSAVDAHTGSHLFQEVLLGLLSSKTVIYVTHQVEFLPAADLILVMKDGKITQAGKYNDLINSGTDFMELVGAHEQALLALGS********************************************************KVGFSVYWKYITTAFGGALVPFILLAQTLFQILQIASNYWIVWATPGTKDVKPVVTGSTLLIVYVALAVGSSFCVLARSTLLATAGYKTATLLFNEMHYCIFRAPMSFFDATPSGRIINRASTDQSAADLGIPSLVGAYAFSIIRILGTIAVMSQVAWQVFIVFVPAVGSCIWYQQYYISSARELSRLVGVCKAPVIQHFAETVSGSTTIR**************LMDEYSRPTFHIAAAMEWLGLRLDMLSSITFAFTLVFLISIPKGFIDPAIAGLAVTYGLTLNTLLATLIWFACDLENKIISVERIFQYTCIPS*****************HGKIDLLDLQVRYAPQMPLVLQGISCTFPGGEKTGIVGRTGSGKSTLIQTLFRIVEPAAGQILIDGIDISLIGLHDLRSRLSIIPQDPVMFEGTV**************IWEALDKCQL*********************WSMGQRQLVCLGRVLLKRSKILMLDEATASVDTATDNLIQQTLRQHFSDCTVLTIAHRITSVIDSDLVLLLNHGLIEEFDNPAN******************************
*LLGADFLLKPIFLRWFSCSLHLVLLVGLLVSWVWNKIKT*************KNKKALWYKLTLACCFGVSLFNIVFSLLSYFYWYENGWSDYQLVTLLDFGVKTLGWSAICVCLHTVFLNSRQPKLPILLKLWWAFYVFISCYCLIVDIVLCEKQVSLQIQYLISDVASAMTGLFLCFVGILSKIEGEDALLLREPLLKADS********************YSRAGVLSVITYSWINSLIALGNKKTLDLEDVPQLDSGDSVSGAFANFKNKLETEG******TTVKLIKAMFCSVWKDVLVTGFLTVLYTLASYVGPYLIDTFVQYLNGRRDFENEGYVLVSAFCVAKLVECLCQRFRVFRLQQLGIRMRAALIAMIYNKGL***************INFMTVDAERVADFSWYIHDPWLVLFEVALSILILYKNLGIASLAALFGTVIVMLVNIPLGRVQENFQDKLMKSKDERMKATSEILRNMRILKLQGWEMKFLSKIINLRKRETGWLKKYVYTSAISSFVFWGAPTFVSVATFGTCILLNVPLESGKMLSAIATFRLLQVPIYNLPDVISMIIQTKVSLQRIASFFCLDDL***************ALDIVDGNFSWDISSHNPTLKDINLKVFHGMRVAVCGTVGSGKSSLLSCILGEVPKISGTLKLCGTKAYVAQSPWIQSGKIEDNILFGKEMNRERYNAVLDACSLKKDLEILSFGDQTVIGERGINLSGGQKQRIQIARALYQDSDIYLFDDPFSAVDAHTGSHLFQEVLLGLLSSKTVIYVTHQVEFLPAADLILVMKDGKITQAGKYNDLINSGTDFMEL*********************************************************************KVGFSVYWKYITTAFGGALVPFILLAQTLFQILQIASNYWIVWATPGTK*VKPVVTGSTLLIVYVALAVGSSFCVLARSTLLATAGYKTATLLFNEMHYCIFRAPMSFFDATPSGRIINRASTDQSAADLGIPSLVGAYAFSIIRILGTIAVMSQVAWQVFIVFVPAVGSCIWYQQYYISSARELSRLVGVCKAPVIQHFAETVSGSTTIRSFDQESRFRDRNMKLMDEYSRPTFHIAAAMEWLGLRLDMLSSITFAFTLVFLISIPKGFIDPAIAGLAVTYGLTLNTLLATLIWFACDLENKIISVERIFQYTCIPSEP************WPSHGKIDLLDLQVRYAPQMPLVLQGISCTFPGGEKTGIVGRTGSGKSTLIQTLFRIVEPAAGQILIDGIDISLIGLHDLRSRLSIIPQDPVMFEGTVRSNLDPLEESTDEQIWEALDKCQLGDEVRKKEGKLDSKVTENGENWSMGQRQLVCLGRVLLKRSKILMLDEATASVDTATDNLIQQTLRQHFSDCTVLTIAHRITSVIDSDLVLLLNHGLIEEFDNPANLLENKSSSFSQLVAEYT*************
MLLGADFLLKPIFLRWFSCSLHLVLLVGLLVSWVWNKIKTGEGDHNRGSREMFKNKKALWYKLTLACCFGVSLFNIVFSLLSYFYWYENGWSDYQLVTLLDFGVKTLGWSAICVCLHTVFLNSRQPKLPILLKLWWAFYVFISCYCLIVDIVLCEKQVSLQIQYLISDVASAMTGLFLCFVGILSKIEGEDALLLREPLLKADSNETDGTVPSIKSEGADKLTPYSRAGVLSVITYSWINSLIALGNKKTLDLEDVPQLDSGDSVSGAFANFKNKLETEGGVGSGLTTVKLIKAMFCSVWKDVLVTGFLTVLYTLASYVGPYLIDTFVQYLNGRRDFENEGYVLVSAFCVAKLVECLCQRFRVFRLQQLGIRMRAALIAMIYNKGLTL*********SGEIINFMTVDAERVADFSWYIHDPWLVLFEVALSILILYKNLGIASLAALFGTVIVMLVNIPLGRVQENFQDKLMKSKDERMKATSEILRNMRILKLQGWEMKFLSKIINLRKRETGWLKKYVYTSAISSFVFWGAPTFVSVATFGTCILLNVPLESGKMLSAIATFRLLQVPIYNLPDVISMIIQTKVSLQRIASFFCLDDLQPDLVE********TALDIVDGNFSWDISSHNPTLKDINLKVFHGMRVAVCGTVGSGKSSLLSCILGEVPKISGTLKLCGTKAYVAQSPWIQSGKIEDNILFGKEMNRERYNAVLDACSLKKDLEILSFGDQTVIGERGINLSGGQKQRIQIARALYQDSDIYLFDDPFSAVDAHTGSHLFQEVLLGLLSSKTVIYVTHQVEFLPAADLILVMKDGKITQAGKYNDLINSGTDFMELVGAHEQALLALGSIEGR*********NGGTVIANRIVKEVENNKGQNDKADEVA**************GKVGFSVYWKYITTAFGGALVPFILLAQTLFQILQIASNYWIVWATPGTKDVKPVVTGSTLLIVYVALAVGSSFCVLARSTLLATAGYKTATLLFNEMHYCIFRAPMSFFDATPSGRIINRASTDQSAADLGIPSLVGAYAFSIIRILGTIAVMSQVAWQVFIVFVPAVGSCIWYQQYYISSARELSRLVGVCKAPVIQHFAETVSGSTTIRSFDQESRFRDRNMKLMDEYSRPTFHIAAAMEWLGLRLDMLSSITFAFTLVFLISIPKGFIDPAIAGLAVTYGLTLNTLLATLIWFACDLENKIISVERIFQYTCIPSEPPLAIE********PSHGKIDLLDLQVRYAPQMPLVLQGISCTFPGGEKTGIVGRTGSGKSTLIQTLFRIVEPAAGQILIDGIDISLIGLHDLRSRLSIIPQDPVMFEGTVRSNLDPLEESTDEQIWEALDKCQLGDEVRKKEGKLDSKVTENGENWSMGQRQLVCLGRVLLKRSKILMLDEATASVDTATDNLIQQTLRQHFSDCTVLTIAHRITSVIDSDLVLLLNHGLIEEFDNPANLLENKSSSFSQLVAEYTLRS**********
*LLGADFLLKPIFLRWFSCSLHLVLLVGLLVSWVWNKIKTGE*********MFKNKKALWYKLTLACCFGVSLFNIVFSLLSYFYWYENGWSDYQLVTLLDFGVKTLGWSAICVCLHTVFLNSRQPKLPILLKLWWAFYVFISCYCLIVDIVLCEKQVSLQIQYLISDVASAMTGLFLCFVGILSKIEGEDALLLREPLLKADSNETDGTVPSIKSEGADKLTPYSRAGVLSVITYSWINSLIALGNKKTLDLEDVPQLDSGDSVSGAFANFKNKLETEGGVGSGLTTVKLIKAMFCSVWKDVLVTGFLTVLYTLASYVGPYLIDTFVQYLNGRRDFENEGYVLVSAFCVAKLVECLCQRFRVFRLQQLGIRMRAALIAMIYNKGLTLSSQAKQGQSSGEIINFMTVDAERVADFSWYIHDPWLVLFEVALSILILYKNLGIASLAALFGTVIVMLVNIPLGRVQENFQDKLMKSKDERMKATSEILRNMRILKLQGWEMKFLSKIINLRKRETGWLKKYVYTSAISSFVFWGAPTFVSVATFGTCILLNVPLESGKMLSAIATFRLLQVPIYNLPDVISMIIQTKVSLQRIASFFCLDD******EKQPSGSSETALDIVDGNFSWDISSHNPTLKDINLKVFHGMRVAVCGTVGSGKSSLLSCILGEVPKISGTLKLCGTKAYVAQSPWIQSGKIEDNILFGKEMNRERYNAVLDACSLKKDLEILSFGDQTVIGERGINLSGGQKQRIQIARALYQDSDIYLFDDPFSAVDAHTGSHLFQEVLLGLLSSKTVIYVTHQVEFLPAADLILVMKDGKITQAGKYNDLINSGTDFMELVGAHEQALL***********************************************************GKVGFSVYWKYITTAFGGALVPFILLAQTLFQILQIASNYWIVWATPGTKDVKPVVTGSTLLIVYVALAVGSSFCVLARSTLLATAGYKTATLLFNEMHYCIFRAPMSFFDATPSGRIINRASTDQSAADLGIPSLVGAYAFSIIRILGTIAVMSQVAWQVFIVFVPAVGSCIWYQQYYISSARELSRLVGVCKAPVIQHFAETVSGSTTIRSFDQESRFRDRNMKLMDEYSRPTFHIAAAMEWLGLRLDMLSSITFAFTLVFLISIPKGFIDPAIAGLAVTYGLTLNTLLATLIWFACDLENKIISVERIFQYTCIPSEPPLAIEESRPNDSWPSHGKIDLLDLQVRYAPQMPLVLQGISCTFPGGEKTGIVGRTGSGKSTLIQTLFRIVEPAAGQILIDGIDISLIGLHDLRSRLSIIPQDPVMFEGTVRSNLDPLEESTDEQIWEALDKCQLGDEVRKKEGKLDSKVTENGENWSMGQRQLVCLGRVLLKRSKILMLDEATASVDTATDNLIQQTLRQHFSDCTVLTIAHRITSVIDSDLVLLLNHGLIEEFDNPANLLENKSSSFSQLVAEYTLR***********
ooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLGADFLLKPIFLRWFSCSLHLVLLVGLLVSWVWNKIKTGEGDHNRGSREMFKNKKALWYKLTLACCFGVSLFNIVFSLLSYFYWYENGWSDYQLVTLLDFGVKTLGWSAICVCLHTVFLNSRQPKLPILLKLWWAFYVFISCYCLIVDIVLCEKQVSLQIQYLISDVASAMTGLFLCFVGILSKIEGEDALLLREPLLKADSNETDGTVPSIKSEGADKLTPYSRAGVLSVITYSWINSLIALGNKKTLDLEDVPQLDSGDSVSGAFANFKNKLETEGGVGSGLTTVKLIKAMFCSVWKDVLVTGFLTVLYTLASYVGPYLIDTFVQYLNGRRDFENEGYVLVSAFCVAKLVECLCQRFRVFRLQQLGIRMRAALIAMIYNKGLTLSSQAKQGQSSGEIINFMTVDAERVADFSWYIHDPWLVLFEVALSILILYKNLGIASLAALFGTVIVMLVNIPLGRVQENFQDKLMKSKDERMKATSEILRNMRILKLQGWEMKFLSKIINLRKRETGWLKKYVYTSAISSFVFWGAPTFVSVATFGTCILLNVPLESGKMLSAIATFRLLQVPIYNLPDVISMIIQTKVSLQRIASFFCLDDLQPDLVEKQPSGSSETALDIVDGNFSWDISSHNPTLKDINLKVFHGMRVAVCGTVGSGKSSLLSCILGEVPKISGTLKLCGTKAYVAQSPWIQSGKIEDNILFGKEMNRERYNAVLDACSLKKDLEILSFGDQTVIGERGINLSGGQKQRIQIARALYQDSDIYLFDDPFSAVDAHTGSHLFQEVLLGLLSSKTVIYVTHQVEFLPAADLILVMKDGKITQAGKYNDLINSGTDFMELVGAHEQALLALGSIEGRPASERASGENGGTVIANRIVKEVENNKGQNDKADEVAVSKGQLVQEEEREKGKVGFSVYWKYITTAFGGALVPFILLAQTLFQILQIASNYWIVWATPGTKDVKPVVTGSTLLIVYVALAVGSSFCVLARSTLLATAGYKTATLLFNEMHYCIFRAPMSFFDATPSGRIINRASTDQSAADLGIPSLVGAYAFSIIRILGTIAVMSQVAWQVFIVFVPAVGSCIWYQQYYISSARELSRLVGVCKAPVIQHFAETVSGSTTIRSFDQESRFRDRNMKLMDEYSRPTFHIAAAMEWLGLRLDMLSSITFAFTLVFLISIPKGFIDPAIAGLAVTYGLTLNTLLATLIWFACDLENKIISVERIFQYTCIPSEPPLAIEESRPNDSWPSHGKIDLLDLQVRYAPQMPLVLQGISCTFPGGEKTGIVGRTGSGKSTLIQTLFRIVEPAAGQILIDGIDISLIGLHDLRSRLSIIPQDPVMFEGTVRSNLDPLEESTDEQIWEALDKCQLGDEVRKKEGKLDSKVTENGENWSMGQRQLVCLGRVLLKRSKILMLDEATASVDTATDNLIQQTLRQHFSDCTVLTIAHRITSVIDSDLVLLLNHGLIEEFDNPANLLENKSSSFSQLVAEYTLRSSSSFENLAGN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1496 2.2.26 [Sep-21-2011]
Q9LK641514 ABC transporter C family yes no 0.987 0.976 0.676 0.0
Q9LK621493 ABC transporter C family no no 0.984 0.986 0.619 0.0
Q8VZZ41466 ABC transporter C family no no 0.971 0.991 0.622 0.0
Q7GB251514 ABC transporter C family no no 0.909 0.898 0.527 0.0
Q9M1C71506 ABC transporter C family no no 0.951 0.944 0.505 0.0
Q7FB561053 Putative ABC transporter no no 0.697 0.990 0.558 0.0
Q7DM581516 ABC transporter C family no no 0.945 0.933 0.414 0.0
Q9LYS21453 ABC transporter C family no no 0.844 0.869 0.439 0.0
Q9LZJ51539 ABC transporter C family no no 0.901 0.875 0.418 0.0
Q8LGU11464 ABC transporter C family no no 0.834 0.853 0.447 0.0
>sp|Q9LK64|AB3C_ARATH ABC transporter C family member 3 OS=Arabidopsis thaliana GN=ABCC3 PE=1 SV=1 Back     alignment and function desciption
 Score = 2053 bits (5320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1008/1491 (67%), Positives = 1221/1491 (81%), Gaps = 13/1491 (0%)

Query: 7    FLLKPIFLRWFSCSLHLVLLVGLLVSWVWNKIKTGEGDHNRGSREMFKNKKALWYKLTLA 66
            FLLKP+FLRW S  LH VLL+ L  SWV  KI+   GD   G  E  K+++   +K  L 
Sbjct: 31   FLLKPLFLRWLSGFLHSVLLLVLFFSWVRKKIR---GDS--GVTESLKDRRDFGFKSALF 85

Query: 67   CCFGVSLFNIVFSLLSYFYWYENGWSD-YQLVTLLDFGVKTLGWSAICVCLHTVFLNSRQ 125
            C   +SL N+V   LS FYWYE+GW D  QLV+ L F +  + W  + +CLH    +   
Sbjct: 86   CSLALSLLNLVLMSLSGFYWYESGWLDNEQLVSSLGFLLGMVSWGVLSICLHRC-RDCEH 144

Query: 126  PKLPILLKLWWAFYVFISCYCLIVDIVLCEKQVSLQIQYLISDVASAMTGLFLCFVGILS 185
             K P LL+LW  FY+ +SCY L+VD V+ E++ ++ +  L+ D+ + +  +FL +V +L 
Sbjct: 145  KKAPFLLRLWLVFYLVVSCYSLVVDFVMYERRETVPVHLLVFDIVAFIAAVFLGYVAVLK 204

Query: 186  KIEGEDALLLREPLLKADSNET--DGTVPSIKSEGADKLTPYSRAGVLSVITYSWINSLI 243
            K       +L EPLL    +    D +V   K+ G+ + TPYSRAG+LS++T+SW++ LI
Sbjct: 205  KDRSNSNGVLEEPLLNGGDSRVGGDDSVELNKTNGSGEATPYSRAGILSLLTFSWMSPLI 264

Query: 244  ALGNKKTLDLEDVPQLDSGDSVSGAFANFKNKLET-EGGVGSGLTTVKLIKAMFCSVWKD 302
             +GNKKTLDLEDVPQL   DSV G    F++ LE+ +GG  SG+TT KLIKA++ +   +
Sbjct: 265  DIGNKKTLDLEDVPQLHDTDSVVGLAPKFRSMLESPDGGERSGVTTFKLIKALYFTAQWE 324

Query: 303  VLVTGFLTVLYTLASYVGPYLIDTFVQYLNGRRDFENEGYVLVSAFCVAKLVECLCQRFR 362
            +LVT F   +YT+ASYVGP LIDTFVQYLNGRR + +EGYVLV  F  AK+VECL QR  
Sbjct: 325  ILVTAFFAFIYTVASYVGPALIDTFVQYLNGRRQYNHEGYVLVITFFAAKIVECLSQRHW 384

Query: 363  VFRLQQLGIRMRAALIAMIYNKGLTLSSQAKQGQSSGEIINFMTVDAERVADFSWYIHDP 422
             FRLQ++GIRMR+AL+AMIY KGLTLS Q+KQG++SGEIINFMTVDAER+ +FSWY+HDP
Sbjct: 385  FFRLQKVGIRMRSALVAMIYEKGLTLSCQSKQGRTSGEIINFMTVDAERIGNFSWYMHDP 444

Query: 423  WLVLFEVALSILILYKNLGIASLAALFGTVIVMLVNIPLGRVQENFQDKLMKSKDERMKA 482
            W+VL +V L++ ILY+NLG+AS+AAL  T+IVML+N P GR+QE FQ+KLM++KD RMK+
Sbjct: 445  WMVLLQVGLALWILYRNLGLASIAALVATIIVMLINFPFGRMQERFQEKLMEAKDSRMKS 504

Query: 483  TSEILRNMRILKLQGWEMKFLSKIINLRKRETGWLKKYVYTSAISSFVFWGAPTFVSVAT 542
            TSEILRNMRILKLQGWEMKFLSKI +LRK E GWLKKYVY SA+ SFVFWGAPT VSV+T
Sbjct: 505  TSEILRNMRILKLQGWEMKFLSKIFDLRKSEEGWLKKYVYNSAVISFVFWGAPTLVSVST 564

Query: 543  FGTCILLNVPLESGKMLSAIATFRLLQVPIYNLPDVISMIIQTKVSLQRIASFFCLDDLQ 602
            FG CILL +PLESGK+LSA+ATFR+LQ PIYNLPD ISMI+QTKVSL R+AS+ CLD+LQ
Sbjct: 565  FGACILLGIPLESGKILSALATFRILQEPIYNLPDTISMIVQTKVSLDRLASYLCLDNLQ 624

Query: 603  PDLVEKQPSGSSETALDIVDGNFSWDISSHNPTLKDINLKVFHGMRVAVCGTVGSGKSSL 662
            PD+VE+ P GSS+ A+++++   SWD+SS NPTLKDIN KVF GM+VAVCGTVGSGKSSL
Sbjct: 625  PDIVERLPKGSSDVAVEVINSTLSWDVSSSNPTLKDINFKVFPGMKVAVCGTVGSGKSSL 684

Query: 663  LSCILGEVPKISGTLKLCGTKAYVAQSPWIQSGKIEDNILFGKEMNRERYNAVLDACSLK 722
            LS +LGEVPK+SG+LK+CGTKAYVAQSPWIQSGKIEDNILFGK M RERY+ VL+ACSL 
Sbjct: 685  LSSLLGEVPKVSGSLKVCGTKAYVAQSPWIQSGKIEDNILFGKPMERERYDKVLEACSLS 744

Query: 723  KDLEILSFGDQTVIGERGINLSGGQKQRIQIARALYQDSDIYLFDDPFSAVDAHTGSHLF 782
            KDLEILSFGDQTVIGERGINLSGGQKQRIQIARALYQD+DIYLFDDPFSAVDAHTGSHLF
Sbjct: 745  KDLEILSFGDQTVIGERGINLSGGQKQRIQIARALYQDADIYLFDDPFSAVDAHTGSHLF 804

Query: 783  QEVLLGLLSSKTVIYVTHQVEFLPAADLILVMKDGKITQAGKYNDLINSGTDFMELVGAH 842
            +EVLLGLL SK+VIYVTHQVEFLPAADLILVMKDG+I+QAGKYND++NSGTDFMEL+GAH
Sbjct: 805  KEVLLGLLCSKSVIYVTHQVEFLPAADLILVMKDGRISQAGKYNDILNSGTDFMELIGAH 864

Query: 843  EQALLALGSIEGRPASERASGENGGTVIANRIV--KEVENNKGQNDKADEVAVSKGQLVQ 900
            ++AL  + S++    SE+++      ++ + I   +++E+   +NDK + V   + Q++Q
Sbjct: 865  QEALAVVDSVDANSVSEKSALGQENVIVKDAIAVDEKLESQDLKNDKLESVEPQR-QIIQ 923

Query: 901  EEEREKGKVGFSVYWKYITTAFGGALVPFILLAQTLFQILQIASNYWIVWATPGTKDVKP 960
            EEEREKG V   VYWKYIT A+GGALVPFILL Q LFQ+LQI SNYW+ WATP ++DV+ 
Sbjct: 924  EEEREKGSVALDVYWKYITLAYGGALVPFILLGQVLFQLLQIGSNYWMAWATPVSEDVQA 983

Query: 961  VVTGSTLLIVYVALAVGSSFCVLARSTLLATAGYKTATLLFNEMHYCIFRAPMSFFDATP 1020
             V  STL+IVYVALA GSS C+L R+TLL TAGYKTAT LF++MH+CIFR+PMSFFD+TP
Sbjct: 984  PVKLSTLMIVYVALAFGSSLCILLRATLLVTAGYKTATELFHKMHHCIFRSPMSFFDSTP 1043

Query: 1021 SGRIINRASTDQSAADLGIPSLVGAYAFSIIRILGTIAVMSQVAWQVFIVFVPAVGSCIW 1080
            SGRI++RASTDQSA DL +P   G+ A ++I+++G I VMSQV+W VF+VF+P V + IW
Sbjct: 1044 SGRIMSRASTDQSAVDLELPYQFGSVAITVIQLIGIIGVMSQVSWLVFLVFIPVVAASIW 1103

Query: 1081 YQQYYISSARELSRLVGVCKAPVIQHFAETVSGSTTIRSFDQESRFRDRNMKLMDEYSRP 1140
            YQ+YYI++ARELSRLVGVCKAP+IQHF+ET+SG+TTIRSF QE RFR  NM+L D YSRP
Sbjct: 1104 YQRYYIAAARELSRLVGVCKAPLIQHFSETISGATTIRSFSQEFRFRSDNMRLSDGYSRP 1163

Query: 1141 TFHIAAAMEWLGLRLDMLSSITFAFTLVFLISIPKGFIDPAIAGLAVTYGLTLNTLLATL 1200
             F+ A AMEWL  RLDMLSS+TF F+LVFL+SIP G IDP++AGLAVTYGL+LNTL A L
Sbjct: 1164 KFYTAGAMEWLCFRLDMLSSLTFVFSLVFLVSIPTGVIDPSLAGLAVTYGLSLNTLQAWL 1223

Query: 1201 IWFACDLENKIISVERIFQYTCIPSEPPLAIEESRPNDSWPSHGKIDLLDLQVRYAPQMP 1260
            IW  C+LENKIISVERI QY  +PSEPPL IE +RP  SWPS G++++ DLQVRYAP MP
Sbjct: 1224 IWTLCNLENKIISVERILQYASVPSEPPLVIESNRPEQSWPSRGEVEIRDLQVRYAPHMP 1283

Query: 1261 LVLQGISCTFPGGEKTGIVGRTGSGKSTLIQTLFRIVEPAAGQILIDGIDISLIGLHDLR 1320
            LVL+GI+CTF GG +TGIVGRTGSGKSTLIQTLFRIVEP+AG+I IDG++I  IGLHDLR
Sbjct: 1284 LVLRGITCTFKGGLRTGIVGRTGSGKSTLIQTLFRIVEPSAGEIRIDGVNILTIGLHDLR 1343

Query: 1321 SRLSIIPQDPVMFEGTVRSNLDPLEESTDEQIWEALDKCQLGDEVRKKEGKLDSKVTENG 1380
             RLSIIPQDP MFEGT+RSNLDPLEE TD+QIWEALDKCQLGDEVRKKE KLDS V+ENG
Sbjct: 1344 LRLSIIPQDPTMFEGTMRSNLDPLEEYTDDQIWEALDKCQLGDEVRKKEQKLDSSVSENG 1403

Query: 1381 ENWSMGQRQLVCLGRVLLKRSKILMLDEATASVDTATDNLIQQTLRQHFSDCTVLTIAHR 1440
            +NWSMGQRQLVCLGRVLLKRSKIL+LDEATASVDTATDNLIQ+TLR+HFSDCTV+TIAHR
Sbjct: 1404 DNWSMGQRQLVCLGRVLLKRSKILVLDEATASVDTATDNLIQKTLREHFSDCTVITIAHR 1463

Query: 1441 ITSVIDSDLVLLLNHGLIEEFDNPANLLENKSSSFSQLVAEYTLRSSSSFE 1491
            I+SVIDSD+VLLL++G+IEE+D P  LLE+KSSSFS+LVAEYT RSSSSF+
Sbjct: 1464 ISSVIDSDMVLLLSNGIIEEYDTPVRLLEDKSSSFSKLVAEYTSRSSSSFD 1514




Pump for glutathione S-conjugates. Mediates the transport of glutathione conjugates such as chlorodinitrobenzene-GS (DNB-GS), and of chlorophyll catabolites such as Bn-NCC-1. Transports also heavy metals such as cadmium (Cd).
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 3EC: .EC: 4EC: 4
>sp|Q9LK62|AB7C_ARATH ABC transporter C family member 7 OS=Arabidopsis thaliana GN=ABCC7 PE=2 SV=1 Back     alignment and function description
>sp|Q8VZZ4|AB6C_ARATH ABC transporter C family member 6 OS=Arabidopsis thaliana GN=ABCC6 PE=2 SV=3 Back     alignment and function description
>sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 Back     alignment and function description
>sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 Back     alignment and function description
>sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 Back     alignment and function description
>sp|Q7DM58|AB4C_ARATH ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=1 SV=2 Back     alignment and function description
>sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 Back     alignment and function description
>sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 Back     alignment and function description
>sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1496
2240611721488 multidrug resistance protein ABC transpo 0.987 0.993 0.728 0.0
3594942931488 PREDICTED: ABC transporter C family memb 0.985 0.990 0.728 0.0
3594942891488 PREDICTED: ABC transporter C family memb 0.986 0.991 0.717 0.0
3594941681485 PREDICTED: ABC transporter C family memb 0.983 0.991 0.715 0.0
3565535191494 PREDICTED: ABC transporter C family memb 0.987 0.989 0.699 0.0
356499431 2054 PREDICTED: ABC transporter C family memb 0.987 0.719 0.701 0.0
3565016201493 PREDICTED: ABC transporter C family memb 0.987 0.989 0.697 0.0
3565662461490 PREDICTED: ABC transporter C family memb 0.980 0.984 0.693 0.0
1478000771458 hypothetical protein VITISV_007527 [Viti 0.969 0.995 0.698 0.0
4494655131504 PREDICTED: ABC transporter C family memb 0.986 0.981 0.683 0.0
>gi|224061172|ref|XP_002300362.1| multidrug resistance protein ABC transporter family [Populus trichocarpa] gi|222847620|gb|EEE85167.1| multidrug resistance protein ABC transporter family [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 2225 bits (5766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1085/1490 (72%), Positives = 1268/1490 (85%), Gaps = 12/1490 (0%)

Query: 7    FLLKPIFLRWFSCSLHLVLLVGLLVSWVWNKIKTGEGDHNRGSREMF-KNKKALWYKLTL 65
            FLLKPIFLR F+ SLHLVLL+ L VS+V  K++ G+G   +GS+E F  NK+  +YK TL
Sbjct: 7    FLLKPIFLRGFTASLHLVLLLALFVSFVLKKLRVGDG--VQGSKERFSNNKRFFFYKQTL 64

Query: 66   ACCFGVSLFNIVFSLLSYFYWYENGWSDYQLVTLLDFGVKTLGWSAICVCLHTVFLNSRQ 125
             C  GVS  N+V SL+SYFYWY NGWSD +LVTLLDF +  L W+A+ V LHT   NS +
Sbjct: 65   FCSLGVSSLNLVLSLVSYFYWYTNGWSDDKLVTLLDFVLTALSWAALSVYLHTQLFNSGE 124

Query: 126  PKLPILLKLWWAFYVFISCYCLIVDIVLCEKQVSLQIQYLISDVASAMTGLFLCFVGILS 185
             K P LL++WWA +  ISCYCL+VD ++  K  S +IQYL+SD+ S  T  FLC+VG L 
Sbjct: 125  TKFPFLLRVWWALFFSISCYCLVVDFLVFHKHGSFEIQYLVSDLVSVFTAFFLCYVGFL- 183

Query: 186  KIEGEDALLLREPLLKADSNETDGTVPSIKSEGADKLTPYSRAGVLSVITYSWINSLIAL 245
            + E +D LL  +PLL  DS+  +G + S KS G D LTPY+ AG+ S++T+SW+ SLIA 
Sbjct: 184  RNECQDTLL-EQPLLNGDSSSING-LESSKSRGGDSLTPYANAGLFSILTFSWMGSLIAF 241

Query: 246  GNKKTLDLEDVPQLDSGDSVSGAFANFKNKLETEGGVGSGLTTVKLIKAMFCSVWKDVLV 305
            GNKKTLDLEDVPQL S DSV GAF+ FKNKLE++ G  S +T  KL+KA+  S WK++L+
Sbjct: 242  GNKKTLDLEDVPQLHSVDSVVGAFSVFKNKLESDSGAASRVTAFKLLKALLLSAWKEILL 301

Query: 306  TGFLTVLYTLASYVGPYLIDTFVQYLNGRRDFENEGYVLVSAFCVAKLVECLCQRFRVFR 365
            T  L ++YT ASYVGPYLID+FVQ L+GR +++N+GY+L S F VAK+VECL QR   FR
Sbjct: 302  TALLAIIYTSASYVGPYLIDSFVQCLDGRGEYKNQGYILASTFFVAKVVECLSQRHWFFR 361

Query: 366  LQQLGIRMRAALIAMIYNKGLTLSSQAKQGQSSGEIINFMTVDAERVADFSWYIHDPWLV 425
            LQQ+GIR+RA    MIYNK LTLSSQ+KQGQ+SGEIIN MTVDAER++DFSWY+HDPWLV
Sbjct: 362  LQQIGIRLRAVATTMIYNKALTLSSQSKQGQTSGEIINIMTVDAERISDFSWYMHDPWLV 421

Query: 426  LFEVALSILILYKNLGIASLAALFGTVIVMLVNIPLGRVQENFQDKLMKSKDERMKATSE 485
            + +V L++LILYKNLG+A+++    T++VML+N PLGR+QE+FQDKLM+SKD+RMKAT+E
Sbjct: 422  ILQVGLALLILYKNLGLATVSTFVATIVVMLLNYPLGRLQEHFQDKLMESKDKRMKATTE 481

Query: 486  ILRNMRILKLQGWEMKFLSKIINLRKRETGWLKKYVYTSAISSFVFWGAPTFVSVATFGT 545
            ILRNMRILKLQGWEMKFLSKI++LR+ ETGWLKKYVY SA+ SFVFWGAP+ V+VATFGT
Sbjct: 482  ILRNMRILKLQGWEMKFLSKILDLRQVETGWLKKYVYNSAMISFVFWGAPSLVAVATFGT 541

Query: 546  CILLNVPLESGKMLSAIATFRLLQVPIYNLPDVISMIIQTKVSLQRIASFFCLDDLQPDL 605
            C+L+  PLESGK+LSA+ATFR+LQ PIYNLPD +SMI+QTKVSL RIASF  LDDL+ D+
Sbjct: 542  CMLIGTPLESGKILSALATFRILQEPIYNLPDTVSMIVQTKVSLDRIASFISLDDLKNDV 601

Query: 606  VEKQPSGSSETALDIVDGNFSWDISSHNPTLKDINLKVFHGMRVAVCGTVGSGKSSLLSC 665
            +EK P GSS+TA++IVDGNFSWD+SS + TLK+I+ +VFHGMRVAVCGTVGSGKSSLLSC
Sbjct: 602  LEKLPIGSSDTAVEIVDGNFSWDVSSPSATLKNIDFQVFHGMRVAVCGTVGSGKSSLLSC 661

Query: 666  ILGEVPKISGTLKLCGTKAYVAQSPWIQSGKIEDNILFGKEMNRERYNAVLDACSLKKDL 725
            ILGEVP+ISGTLK+CGTKAYVAQSPWIQSGKIE+NILFGK+M+RERY  VL+ACSLKKDL
Sbjct: 662  ILGEVPQISGTLKICGTKAYVAQSPWIQSGKIEENILFGKDMDRERYERVLEACSLKKDL 721

Query: 726  EILSFGDQTVIGERGINLSGGQKQRIQIARALYQDSDIYLFDDPFSAVDAHTGSHLFQEV 785
            EILSFGDQTVIGERGINLSGGQKQRIQIARALYQD+DIYLFDDPFSAVDAHTGSHLF+E 
Sbjct: 722  EILSFGDQTVIGERGINLSGGQKQRIQIARALYQDADIYLFDDPFSAVDAHTGSHLFKEA 781

Query: 786  LLGLLSSKTVIYVTHQVEFLPAADLILVMKDGKITQAGKYNDLINSGTDFMELVGAHEQA 845
            LLGLL+SKTVIYVTHQVEFLPAADLILVMKDG+ITQAGKY+D++NSG+DFMELVGAH+ A
Sbjct: 782  LLGLLNSKTVIYVTHQVEFLPAADLILVMKDGRITQAGKYDDILNSGSDFMELVGAHKAA 841

Query: 846  LLALGSIEGRPASERASG--ENGGTVIANRIVKEVENNKGQNDKADEVAVSKGQLVQEEE 903
            L A  S +   ASE  S   EN      +RI+++  N   QN K D VA  K QL+QEEE
Sbjct: 842  LSAFDSKQAESASENESAGKENSS---GDRILQKEGNKDSQNGKEDVVAGPKAQLIQEEE 898

Query: 904  REKGKVGFSVYWKYITTAFGGALVPFILLAQTLFQILQIASNYWIVWATPGTKDVKPVVT 963
            REKG VGF +YWK+ITTA+GGALVPFILLAQ LFQILQI SNYW+ WATP +KD+KPVV+
Sbjct: 899  REKGSVGFPIYWKFITTAYGGALVPFILLAQILFQILQIGSNYWMAWATPVSKDMKPVVS 958

Query: 964  GSTLLIVYVALAVGSSFCVLARSTLLATAGYKTATLLFNEMHYCIFRAPMSFFDATPSGR 1023
            G TL++VYV LA+GSSFC+LAR+TLL TAGYKTATLLFN+MH CIFRAPMSFFD+TPSGR
Sbjct: 959  GYTLIMVYVCLAIGSSFCILARATLLVTAGYKTATLLFNKMHLCIFRAPMSFFDSTPSGR 1018

Query: 1024 IINRASTDQSAADLGIPSLVGAYAFSIIRILGTIAVMSQVAWQVFIVFVPAVGSCIWYQQ 1083
            I+NRASTDQSA +  IP  VGA AFS I++LG IAVMSQVAWQVFIVF+P + +CIWYQ+
Sbjct: 1019 ILNRASTDQSAVETQIPYQVGALAFSSIQLLGIIAVMSQVAWQVFIVFIPVIAACIWYQR 1078

Query: 1084 YYISSARELSRLVGVCKAPVIQHFAETVSGSTTIRSFDQESRFRDRNMKLMDEYSRPTFH 1143
            YYI SARELSRLVGVCKAPVIQHF+ET+SG+ TIRSFDQ+SRF++ NM + D YSRP FH
Sbjct: 1079 YYIPSARELSRLVGVCKAPVIQHFSETISGAATIRSFDQQSRFQETNMIVTDAYSRPKFH 1138

Query: 1144 IAAAMEWLGLRLDMLSSITFAFTLVFLISIPKGFIDPAIAGLAVTYGLTLNTLLATLIWF 1203
             AAAMEWL  RLDM SSITFAF+LVFL+S PKG IDPAIAGLAVTYGL LN L A +IW 
Sbjct: 1139 AAAAMEWLCFRLDMFSSITFAFSLVFLVSFPKG-IDPAIAGLAVTYGLNLNMLQAWVIWN 1197

Query: 1204 ACDLENKIISVERIFQYTCIPSEPPLAIEESRPNDSWPSHGKIDLLDLQVRYAPQMPLVL 1263
             C+ ENKIISVERI QY  IPSEPPL IE SRPN SWPSHG++++ +LQVRYAP MPLVL
Sbjct: 1198 LCNCENKIISVERILQYMSIPSEPPLIIEASRPNRSWPSHGEVEINNLQVRYAPHMPLVL 1257

Query: 1264 QGISCTFPGGEKTGIVGRTGSGKSTLIQTLFRIVEPAAGQILIDGIDISLIGLHDLRSRL 1323
            +G++CTFPGG KTGIVGRTGSGKSTLIQTLFRIVEPAAG+I+ID IDISLIGLHDLRSRL
Sbjct: 1258 RGLTCTFPGGMKTGIVGRTGSGKSTLIQTLFRIVEPAAGRIMIDDIDISLIGLHDLRSRL 1317

Query: 1324 SIIPQDPVMFEGTVRSNLDPLEESTDEQIWEALDKCQLGDEVRKKEGKLDSKVTENGENW 1383
            SIIPQDP MFEGTVRSNLDPLEE TDEQIWEALDKCQLGDEVRKKE KLDS V ENGENW
Sbjct: 1318 SIIPQDPTMFEGTVRSNLDPLEEYTDEQIWEALDKCQLGDEVRKKERKLDSTVIENGENW 1377

Query: 1384 SMGQRQLVCLGRVLLKRSKILMLDEATASVDTATDNLIQQTLRQHFSDCTVLTIAHRITS 1443
            SMGQRQLVCLGRVLLK+SK+L+LDEATASVDT+TDNLIQQTLRQHFSDCTV+TIAHRITS
Sbjct: 1378 SMGQRQLVCLGRVLLKKSKVLVLDEATASVDTSTDNLIQQTLRQHFSDCTVITIAHRITS 1437

Query: 1444 VIDSDLVLLLNHGLIEEFDNPANLLENKSSSFSQLVAEYTLRSSSSFENL 1493
            V+DSD+VLLL++GLIEE+D+PA LLENKSSSF+QLVAEY +RS + FE  
Sbjct: 1438 VLDSDMVLLLSNGLIEEYDSPARLLENKSSSFAQLVAEYRVRSDTGFEKF 1487




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359494293|ref|XP_003634755.1| PREDICTED: ABC transporter C family member 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359494289|ref|XP_003634753.1| PREDICTED: ABC transporter C family member 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359494168|ref|XP_002265605.2| PREDICTED: ABC transporter C family member 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356553519|ref|XP_003545103.1| PREDICTED: ABC transporter C family member 3-like [Glycine max] Back     alignment and taxonomy information
>gi|356499431|ref|XP_003518544.1| PREDICTED: ABC transporter C family member 3-like [Glycine max] Back     alignment and taxonomy information
>gi|356501620|ref|XP_003519622.1| PREDICTED: ABC transporter C family member 3-like [Glycine max] Back     alignment and taxonomy information
>gi|356566246|ref|XP_003551345.1| PREDICTED: ABC transporter C family member 3-like [Glycine max] Back     alignment and taxonomy information
>gi|147800077|emb|CAN75340.1| hypothetical protein VITISV_007527 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449465513|ref|XP_004150472.1| PREDICTED: ABC transporter C family member 3-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1496
TAIR|locus:20900291514 ABCC3 "ATP-binding cassette C3 0.987 0.976 0.663 0.0
TAIR|locus:20900491493 ABCC7 "ATP-binding cassette C7 0.983 0.985 0.611 0.0
TAIR|locus:20900391466 ABCC6 "ATP-binding cassette C6 0.845 0.862 0.652 0.0
TAIR|locus:20202351514 ABCC5 "ATP-binding cassette C5 0.520 0.514 0.476 0.0
TAIR|locus:20432681516 ABCC4 "ATP-binding cassette C4 0.945 0.933 0.405 9.4e-288
TAIR|locus:20817551539 ABCC14 "ATP-binding cassette C 0.495 0.482 0.394 6.4e-287
TAIR|locus:20777501453 ABCC10 "ATP-binding cassette C 0.590 0.608 0.374 1.6e-286
DICTYBASE|DDB_G02848671593 abcC8 "ABC transporter C famil 0.393 0.369 0.380 7.5e-223
UNIPROTKB|E1C6S51552 ABCC2 "Uncharacterized protein 0.387 0.373 0.384 2.5e-211
ZFIN|ZDB-GENE-040426-15231567 abcc2 "ATP-binding cassette, s 0.410 0.391 0.376 5.3e-209
TAIR|locus:2090029 ABCC3 "ATP-binding cassette C3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 5147 (1816.9 bits), Expect = 0., P = 0.
 Identities = 990/1491 (66%), Positives = 1199/1491 (80%)

Query:     7 FLLKPIFLRWFSCSXXXXXXXXXXXSWVWNKIKTGEGDHNRGSREMFKNKKALWYKLTLA 66
             FLLKP+FLRW S             SWV  KI+   GD   G  E  K+++   +K  L 
Sbjct:    31 FLLKPLFLRWLSGFLHSVLLLVLFFSWVRKKIR---GDS--GVTESLKDRRDFGFKSALF 85

Query:    67 CCFGVSLFNIVFSLLSYFYWYENGWSDY-QLVTLLDFGVKTLGWSAICVCLHTVFLNSRQ 125
             C   +SL N+V   LS FYWYE+GW D  QLV+ L F +  + W  + +CLH    +   
Sbjct:    86 CSLALSLLNLVLMSLSGFYWYESGWLDNEQLVSSLGFLLGMVSWGVLSICLHRC-RDCEH 144

Query:   126 PKLPILLKLWWAFYVFISCYCLIVDIVLCEKQVSLQIQYLISDVASAMTGLFLCFVGILS 185
              K P LL+LW  FY+ +SCY L+VD V+ E++ ++ +  L+ D+ + +  +FL +V +L 
Sbjct:   145 KKAPFLLRLWLVFYLVVSCYSLVVDFVMYERRETVPVHLLVFDIVAFIAAVFLGYVAVLK 204

Query:   186 KIEGEDALLLREPLLKADSNETDG--TVPSIKSEGADKLTPYSRAGVLSVITYSWINSLI 243
             K       +L EPLL    +   G  +V   K+ G+ + TPYSRAG+LS++T+SW++ LI
Sbjct:   205 KDRSNSNGVLEEPLLNGGDSRVGGDDSVELNKTNGSGEATPYSRAGILSLLTFSWMSPLI 264

Query:   244 ALGNKKTLDLEDVPQLDSGDSVSGAFANFKNKLET-EGGVGSGLTTVKLIKAMFCSVWKD 302
              +GNKKTLDLEDVPQL   DSV G    F++ LE+ +GG  SG+TT KLIKA++ +   +
Sbjct:   265 DIGNKKTLDLEDVPQLHDTDSVVGLAPKFRSMLESPDGGERSGVTTFKLIKALYFTAQWE 324

Query:   303 VLVTGFLTVLYTLASYVGPYLIDTFVQYLNGRRDFENEGYVLVSAFCVAKLVECLCQRFR 362
             +LVT F   +YT+ASYVGP LIDTFVQYLNGRR + +EGYVLV  F  AK+VECL QR  
Sbjct:   325 ILVTAFFAFIYTVASYVGPALIDTFVQYLNGRRQYNHEGYVLVITFFAAKIVECLSQRHW 384

Query:   363 VFRLQQLGIRMRAALIAMIYNKGLTLSSQAKQGQSSGEIINFMTVDAERVADFSWYIHDP 422
              FRLQ++GIRMR+AL+AMIY KGLTLS Q+KQG++SGEIINFMTVDAER+ +FSWY+HDP
Sbjct:   385 FFRLQKVGIRMRSALVAMIYEKGLTLSCQSKQGRTSGEIINFMTVDAERIGNFSWYMHDP 444

Query:   423 WLVLFEVALSILILYKNLGIASLAALFGTVIVMLVNIPLGRVQENFQDKLMKSKDERMKA 482
             W+VL +V L++ ILY+NLG+AS+AAL  T+IVML+N P GR+QE FQ+KLM++KD RMK+
Sbjct:   445 WMVLLQVGLALWILYRNLGLASIAALVATIIVMLINFPFGRMQERFQEKLMEAKDSRMKS 504

Query:   483 TSEILRNMRILKLQGWEMKFLSKIINLRKRETGWLKKYVYTSAISSFVFWGAPTFVSVAT 542
             TSEILRNMRILKLQGWEMKFLSKI +LRK E GWLKKYVY SA+ SFVFWGAPT VSV+T
Sbjct:   505 TSEILRNMRILKLQGWEMKFLSKIFDLRKSEEGWLKKYVYNSAVISFVFWGAPTLVSVST 564

Query:   543 FGTCILLNVPLESGKMLSAIATFRLLQVPIYNLPDVISMIIQTKVSLQRIASFFCLDDLQ 602
             FG CILL +PLESGK+LSA+ATFR+LQ PIYNLPD ISMI+QTKVSL R+AS+ CLD+LQ
Sbjct:   565 FGACILLGIPLESGKILSALATFRILQEPIYNLPDTISMIVQTKVSLDRLASYLCLDNLQ 624

Query:   603 PDLVEKQPSGSSETALDIVDGNFSWDISSHNPTLKDINLKVFHGMRVAVCGTVGSGKSSL 662
             PD+VE+ P GSS+ A+++++   SWD+SS NPTLKDIN KVF GM+VAVCGTVGSGKSSL
Sbjct:   625 PDIVERLPKGSSDVAVEVINSTLSWDVSSSNPTLKDINFKVFPGMKVAVCGTVGSGKSSL 684

Query:   663 LSCILGEVPKISGTLKLCGTKAYVAQSPWIQSGKIEDNILFGKEMNRERYNAVLDACSLK 722
             LS +LGEVPK+SG+LK+CGTKAYVAQSPWIQSGKIEDNILFGK M RERY+ VL+ACSL 
Sbjct:   685 LSSLLGEVPKVSGSLKVCGTKAYVAQSPWIQSGKIEDNILFGKPMERERYDKVLEACSLS 744

Query:   723 KDLEILSFGDQTVIGERGINLSGGQKQRIQIARALYQDSDIYLFDDPFSAVDAHTGSHLF 782
             KDLEILSFGDQTVIGERGINLSGGQKQRIQIARALYQD+DIYLFDDPFSAVDAHTGSHLF
Sbjct:   745 KDLEILSFGDQTVIGERGINLSGGQKQRIQIARALYQDADIYLFDDPFSAVDAHTGSHLF 804

Query:   783 QEVLLGLLSSKTVIYVTHQVEFLPAADLILVMKDGKITQAGKYNDLINSGTDFMELVGAH 842
             +EVLLGLL SK+VIYVTHQVEFLPAADLILVMKDG+I+QAGKYND++NSGTDFMEL+GAH
Sbjct:   805 KEVLLGLLCSKSVIYVTHQVEFLPAADLILVMKDGRISQAGKYNDILNSGTDFMELIGAH 864

Query:   843 EQALLALGSIEGRPASERASGENGGTVIANRIV--KEVENNKGQNDKADEVAVSKGQLVQ 900
             ++AL  + S++    SE+++      ++ + I   +++E+   +NDK + V   + Q++Q
Sbjct:   865 QEALAVVDSVDANSVSEKSALGQENVIVKDAIAVDEKLESQDLKNDKLESVEPQR-QIIQ 923

Query:   901 EEEREKGKVGFSVYWKYITTAFGGALVPFILLAQTLFQILQIASNYWIVWATPGTKDVKP 960
             EEEREKG V   VYWKYIT A+GGALVPFILL Q LFQ+LQI SNYW+ WATP ++DV+ 
Sbjct:   924 EEEREKGSVALDVYWKYITLAYGGALVPFILLGQVLFQLLQIGSNYWMAWATPVSEDVQA 983

Query:   961 VVTGSTLLIVYVALAVGSSFCVLARSTLLATAGYKTATLLFNEMHYCIFRAPMSFFDATP 1020
              V  STL+IVYVALA GSS C+L R+TLL TAGYKTAT LF++MH+CIFR+PMSFFD+TP
Sbjct:   984 PVKLSTLMIVYVALAFGSSLCILLRATLLVTAGYKTATELFHKMHHCIFRSPMSFFDSTP 1043

Query:  1021 SGRIINRASTDQSAADLGIPSLVGAYAFSIIRILGTIAVMSQVAWQVFIVFVPAVGSCIW 1080
             SGRI++RASTDQSA DL +P   G+ A ++I+++G I VMSQV+W VF+VF+P V + IW
Sbjct:  1044 SGRIMSRASTDQSAVDLELPYQFGSVAITVIQLIGIIGVMSQVSWLVFLVFIPVVAASIW 1103

Query:  1081 YQQYYISSARELSRLVGVCKAPVIQHFAETVSGSTTIRSFDQESRFRDRNMKLMDEYSRP 1140
             YQ+YYI++ARELSRLVGVCKAP+IQHF+ET+SG+TTIRSF QE RFR  NM+L D YSRP
Sbjct:  1104 YQRYYIAAARELSRLVGVCKAPLIQHFSETISGATTIRSFSQEFRFRSDNMRLSDGYSRP 1163

Query:  1141 TFHIAAAMEWLGLRLDMLSSITFAFTLVFLISIPKGFIDPAIAGLAVTYGLTLNTLLATL 1200
              F+ A AMEWL  RLDMLSS+TF F+LVFL+SIP G IDP++AGLAVTYGL+LNTL A L
Sbjct:  1164 KFYTAGAMEWLCFRLDMLSSLTFVFSLVFLVSIPTGVIDPSLAGLAVTYGLSLNTLQAWL 1223

Query:  1201 IWFACDLENKIISVERIFQYTCIPSEPPLAIEESRPNDSWPSHGKIDLLDLQVRYAPQMP 1260
             IW  C+LENKIISVERI QY  +PSEPPL IE +RP  SWPS G++++ DLQVRYAP MP
Sbjct:  1224 IWTLCNLENKIISVERILQYASVPSEPPLVIESNRPEQSWPSRGEVEIRDLQVRYAPHMP 1283

Query:  1261 LVLQGISCTFPGGEKTGIVGRTGSGKSTLIQTLFRIVEPAAXXXXXXXXXXXXXXXXXXR 1320
             LVL+GI+CTF GG +TGIVGRTGSGKSTLIQTLFRIVEP+A                  R
Sbjct:  1284 LVLRGITCTFKGGLRTGIVGRTGSGKSTLIQTLFRIVEPSAGEIRIDGVNILTIGLHDLR 1343

Query:  1321 SRLSIIPQDPVMFEGTVRSNLDPLEESTDEQIWEALDKCQLGDEVRKKEGKLDSKVTENG 1380
              RLSIIPQDP MFEGT+RSNLDPLEE TD+QIWEALDKCQLGDEVRKKE KLDS V+ENG
Sbjct:  1344 LRLSIIPQDPTMFEGTMRSNLDPLEEYTDDQIWEALDKCQLGDEVRKKEQKLDSSVSENG 1403

Query:  1381 ENWSMGQRQLVCLGRVLLKRSKILMLDEATASVDTATDNLIQQTLRQHFSDCTVLTIAHR 1440
             +NWSMGQRQLVCLGRVLLKRSKIL+LDEATASVDTATDNLIQ+TLR+HFSDCTV+TIAHR
Sbjct:  1404 DNWSMGQRQLVCLGRVLLKRSKILVLDEATASVDTATDNLIQKTLREHFSDCTVITIAHR 1463

Query:  1441 ITSVIDSDLVLLLNHGLIEEFDNPANLLENKSSSFSQLVAEYTLRSSSSFE 1491
             I+SVIDSD+VLLL++G+IEE+D P  LLE+KSSSFS+LVAEYT RSSSSF+
Sbjct:  1464 ISSVIDSDMVLLLSNGIIEEYDTPVRLLEDKSSSFSKLVAEYTSRSSSSFD 1514




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0006810 "transport" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0016887 "ATPase activity" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0042626 "ATPase activity, coupled to transmembrane movement of substances" evidence=IEA;ISS;IDA
GO:0055085 "transmembrane transport" evidence=IEA
GO:0000325 "plant-type vacuole" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0005773 "vacuole" evidence=IDA
GO:0010290 "chlorophyll catabolite transmembrane transporter activity" evidence=IDA
GO:0015431 "glutathione S-conjugate-exporting ATPase activity" evidence=IDA
TAIR|locus:2090049 ABCC7 "ATP-binding cassette C7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090039 ABCC6 "ATP-binding cassette C6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020235 ABCC5 "ATP-binding cassette C5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043268 ABCC4 "ATP-binding cassette C4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081755 ABCC14 "ATP-binding cassette C14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077750 ABCC10 "ATP-binding cassette C10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0284867 abcC8 "ABC transporter C family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|E1C6S5 ABCC2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1523 abcc2 "ATP-binding cassette, sub-family C (CFTR/MRP), member 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6UR05MRP1_CANFANo assigned EC number0.35450.83280.8138yesno
Q5F364MRP1_CHICKNo assigned EC number0.35740.83420.8183yesno
P39109YCFI_YEASTNo assigned EC number0.33980.82950.8191yesno
Q10185ABC2_SCHPO3, ., 6, ., 3, ., -0.35780.83280.8430yesno
Q9LK64AB3C_ARATH3, ., 6, ., 3, ., 4, 40.67600.98790.9762yesno
O35379MRP1_MOUSENo assigned EC number0.35060.82620.8089yesno
Q54JR2ABCC3_DICDINo assigned EC number0.34200.83080.8803yesno
Q63120MRP2_RATNo assigned EC number0.35850.86490.8397yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.30.976
3rd Layer3.6.3.440.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pm.C_LG_I001151
multidrug resistance protein ABC transporter family (1488 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1496
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family membe 0.0
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-as 0.0
PLN032321495 PLN03232, PLN03232, ABC transporter C family membe 0.0
PTZ002431560 PTZ00243, PTZ00243, ABC transporter; Provisional 1e-162
cd03244221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 1e-121
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 1e-104
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 9e-95
cd03369207 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 4e-90
cd03288257 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 3e-77
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 4e-76
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 1e-75
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 8e-68
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 1e-63
cd03290218 cd03290, ABCC_SUR1_N, ATP-binding cassette domain 5e-63
COG1132567 COG1132, MdlB, ABC-type multidrug transport system 5e-60
COG4988559 COG4988, CydD, ABC-type transport system involved 2e-58
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 6e-57
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 1e-56
PRK10790592 PRK10790, PRK10790, putative multidrug transporter 5e-56
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 1e-53
cd03291282 cd03291, ABCC_CFTR1, ATP-binding cassette domain o 2e-52
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 4e-52
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 9e-50
COG4987573 COG4987, CydC, ABC-type transport system involved 4e-49
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 2e-48
cd03289275 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 6e-48
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 5e-47
COG5265497 COG5265, ATM1, ABC-type transport system involved 1e-44
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 3e-44
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 1e-43
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 2e-43
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 5e-43
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 7e-42
COG4988559 COG4988, CydD, ABC-type transport system involved 2e-41
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 2e-41
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 2e-41
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 2e-40
cd03228171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 4e-40
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 1e-39
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 4e-39
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 1e-37
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 3e-37
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 2e-36
cd03254229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 2e-36
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 2e-36
cd03251234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 1e-35
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 3e-35
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding prote 3e-34
cd03245220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 2e-33
cd03253236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 3e-33
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 4e-33
COG4987573 COG4987, CydC, ABC-type transport system involved 4e-33
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC trans 4e-33
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/ 6e-33
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 1e-32
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 2e-32
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 2e-31
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 4e-31
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 5e-31
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 1e-30
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion syste 2e-29
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 2e-29
PRK10789569 PRK10789, PRK10789, putative multidrug transporter 2e-29
cd03244221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 3e-29
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 8e-29
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 1e-28
cd03252237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 2e-28
TIGR02868530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 2e-28
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 2e-28
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 2e-28
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 3e-28
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 1e-27
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 1e-27
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 2e-27
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 4e-27
cd00267157 cd00267, ABC_ATPase, ATP-binding cassette transpor 5e-27
PRK10789569 PRK10789, PRK10789, putative multidrug transporter 6e-27
cd03235213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 6e-27
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 6e-27
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 4e-26
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 5e-26
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 8e-26
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 9e-26
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 1e-25
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 1e-25
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 1e-25
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 2e-25
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 4e-25
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, A 5e-25
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) 1e-24
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 1e-24
COG3842352 COG3842, PotA, ABC-type spermidine/putrescine tran 1e-24
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC trans 2e-24
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion syste 2e-24
TIGR03797686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 3e-24
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport 3e-24
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 6e-24
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 8e-24
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 1e-23
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 2e-23
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 3e-23
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 4e-23
pfam00005119 pfam00005, ABC_tran, ABC transporter 4e-23
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 5e-23
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein ( 5e-23
pfam00664274 pfam00664, ABC_membrane, ABC transporter transmemb 8e-23
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion syste 9e-23
cd03248226 cd03248, ABCC_TAP, ATP-binding cassette domain of 9e-23
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 1e-22
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 1e-22
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 1e-22
cd03229178 cd03229, ABC_Class3, ATP-binding cassette domain o 2e-22
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 2e-22
pfam00664274 pfam00664, ABC_membrane, ABC transporter transmemb 3e-22
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 3e-22
COG1123539 COG1123, COG1123, ATPase components of various ABC 3e-22
cd03250204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 5e-22
cd03256241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 5e-22
cd03247178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 6e-22
cd03246173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 8e-22
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 8e-22
cd03259213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 9e-22
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 9e-22
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transpor 1e-21
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/ 2e-21
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 2e-21
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding su 2e-21
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding sub 2e-21
cd03230173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 4e-21
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 4e-21
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 5e-21
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding sub 7e-21
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding prote 1e-20
PRK10790592 PRK10790, PRK10790, putative multidrug transporter 2e-20
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 2e-20
TIGR03258362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 3e-20
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 3e-20
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 3e-20
COG4525259 COG4525, TauB, ABC-type taurine transport system, 4e-20
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 4e-20
COG4175386 COG4175, ProV, ABC-type proline/glycine betaine tr 4e-20
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 4e-20
COG5265497 COG5265, ATM1, ABC-type transport system involved 1e-19
COG1117253 COG1117, PstB, ABC-type phosphate transport system 1e-19
COG3839338 COG3839, MalK, ABC-type sugar transport systems, A 2e-19
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 2e-19
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine t 3e-19
cd03255218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 4e-19
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 4e-19
cd03262213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 5e-19
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 5e-19
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP- 5e-19
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporte 6e-19
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate t 7e-19
TIGR03796710 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste 9e-19
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide tran 9e-19
cd03260227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 1e-18
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 1e-18
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 1e-18
TIGR03265353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 1e-18
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 2e-18
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 2e-18
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding sub 2e-18
cd03288257 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 3e-18
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 3e-18
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 3e-18
cd03257228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 4e-18
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 4e-18
cd03299235 cd03299, ABC_ModC_like, ATP-binding cassette domai 5e-18
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas 5e-18
cd03263220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 5e-18
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 7e-18
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 7e-18
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 7e-18
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 8e-18
TIGR03415382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter 8e-18
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport 1e-17
COG4178604 COG4178, COG4178, ABC-type uncharacterized transpo 1e-17
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 1e-17
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 2e-17
COG1127263 COG1127, Ttg2A, ABC-type transport system involved 2e-17
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP- 2e-17
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 2e-17
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 3e-17
COG4619223 COG4619, COG4619, ABC-type uncharacterized transpo 3e-17
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, 4e-17
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding sub 4e-17
TIGR01187325 TIGR01187, potA, spermidine/putrescine ABC transpo 4e-17
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 6e-17
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transpo 6e-17
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 6e-17
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 6e-17
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 6e-17
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 8e-17
COG1129 500 COG1129, MglA, ABC-type sugar transport system, AT 9e-17
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 9e-17
COG1123 539 COG1123, COG1123, ATPase components of various ABC 1e-16
TIGR01187 325 TIGR01187, potA, spermidine/putrescine ABC transpo 1e-16
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 1e-16
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 1e-16
PRK11000369 PRK11000, PRK11000, maltose/maltodextrin transport 2e-16
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding sub 2e-16
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 2e-16
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 2e-16
PRK09536 402 PRK09536, btuD, corrinoid ABC transporter ATPase; 2e-16
COG1123539 COG1123, COG1123, ATPase components of various ABC 3e-16
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 3e-16
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 3e-16
cd03369207 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 4e-16
COG1123539 COG1123, COG1123, ATPase components of various ABC 4e-16
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-bind 4e-16
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 4e-16
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 4e-16
COG1135339 COG1135, AbcC, ABC-type metal ion transport system 6e-16
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 6e-16
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding sub 6e-16
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 8e-16
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport 8e-16
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transpor 1e-15
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 1e-15
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 1e-15
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 1e-15
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 2e-15
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 2e-15
cd03258233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 2e-15
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 2e-15
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 2e-15
PRK10535648 PRK10535, PRK10535, macrolide transporter ATP-bind 2e-15
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding 2e-15
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding sub 2e-15
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 2e-15
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 3e-15
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP- 3e-15
PRK09452375 PRK09452, potA, putrescine/spermidine ABC transpor 3e-15
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 3e-15
COG4133209 COG4133, CcmA, ABC-type transport system involved 6e-15
cd03234226 cd03234, ABCG_White, White pigment protein homolog 6e-15
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 7e-15
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 7e-15
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPa 1e-14
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 1e-14
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 1e-14
TIGR02142 354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 1e-14
COG3842 352 COG3842, PotA, ABC-type spermidine/putrescine tran 2e-14
cd03296239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 2e-14
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding sub 2e-14
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 2e-14
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP- 2e-14
cd03215182 cd03215, ABC_Carb_Monos_II, Second domain of the A 2e-14
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP- 3e-14
COG1117253 COG1117, PstB, ABC-type phosphate transport system 3e-14
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding sub 3e-14
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 3e-14
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding 3e-14
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide tran 3e-14
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 3e-14
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-bind 4e-14
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 4e-14
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 5e-14
pfam00005119 pfam00005, ABC_tran, ABC transporter 6e-14
COG4608268 COG4608, AppF, ABC-type oligopeptide transport sys 6e-14
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 7e-14
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 9e-14
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP- 9e-14
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 1e-13
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 1e-13
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 1e-13
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP- 1e-13
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 1e-13
cd03290218 cd03290, ABCC_SUR1_N, ATP-binding cassette domain 2e-13
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP- 2e-13
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding sub 2e-13
cd03300232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 2e-13
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 2e-13
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP- 2e-13
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transpo 2e-13
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 2e-13
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP 2e-13
COG4161242 COG4161, ArtP, ABC-type arginine transport system, 2e-13
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP- 2e-13
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding sub 2e-13
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 2e-13
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-bind 2e-13
cd03294269 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette 3e-13
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP- 3e-13
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 3e-13
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP- 3e-13
TIGR01186 363 TIGR01186, proV, glycine betaine/L-proline transpo 4e-13
COG4178604 COG4178, COG4178, ABC-type uncharacterized transpo 5e-13
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 5e-13
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 5e-13
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 5e-13
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP- 5e-13
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 5e-13
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP- 6e-13
PRK10070 400 PRK10070, PRK10070, glycine betaine transporter AT 6e-13
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 6e-13
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP 7e-13
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 7e-13
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-bind 1e-12
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 1e-12
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP- 1e-12
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 1e-12
PRK11153343 PRK11153, metN, DL-methionine transporter ATP-bind 1e-12
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding s 1e-12
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 1e-12
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 1e-12
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/orni 1e-12
COG0488 530 COG0488, Uup, ATPase components of ABC transporter 1e-12
TIGR03258 362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 2e-12
cd03234226 cd03234, ABCG_White, White pigment protein homolog 2e-12
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 2e-12
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP- 2e-12
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP- 2e-12
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 2e-12
COG0488530 COG0488, Uup, ATPase components of ABC transporter 2e-12
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATP 2e-12
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 2e-12
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding sub 2e-12
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 2e-12
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-bind 2e-12
COG4604252 COG4604, CeuD, ABC-type enterochelin transport sys 2e-12
COG4604252 COG4604, CeuD, ABC-type enterochelin transport sys 3e-12
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP- 3e-12
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP- 3e-12
COG4598256 COG4598, HisP, ABC-type histidine transport system 4e-12
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding sub 4e-12
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 4e-12
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 4e-12
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 5e-12
TIGR02142354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 5e-12
COG0488530 COG0488, Uup, ATPase components of ABC transporter 5e-12
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/orni 6e-12
cd03291282 cd03291, ABCC_CFTR1, ATP-binding cassette domain o 7e-12
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 7e-12
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 7e-12
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein ( 8e-12
cd03218232 cd03218, ABC_YhbG, ATP-binding cassette component 8e-12
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 8e-12
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter A 8e-12
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multid 9e-12
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-bind 9e-12
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 9e-12
cd03289275 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 1e-11
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 1e-11
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 1e-11
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-bind 1e-11
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 1e-11
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP- 1e-11
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP- 1e-11
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC syst 1e-11
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 1e-11
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter 1e-11
PRK10522547 PRK10522, PRK10522, multidrug transporter membrane 1e-11
COG4175 386 COG4175, ProV, ABC-type proline/glycine betaine tr 2e-11
cd03216163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 2e-11
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport s 2e-11
cd03220224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 2e-11
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 2e-11
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding sub 2e-11
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding 2e-11
TIGR00955617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 2e-11
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 2e-11
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 3e-11
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding su 3e-11
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP- 3e-11
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 3e-11
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-bi 3e-11
COG4148352 COG4148, ModC, ABC-type molybdate transport system 3e-11
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-bind 4e-11
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP- 4e-11
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding sub 4e-11
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 4e-11
PRK10070400 PRK10070, PRK10070, glycine betaine transporter AT 5e-11
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP- 5e-11
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Pr 5e-11
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP- 5e-11
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 5e-11
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding sub 6e-11
COG4615546 COG4615, PvdE, ABC-type siderophore export system, 6e-11
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP- 6e-11
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 7e-11
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding sub 7e-11
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 7e-11
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding sub 9e-11
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP- 1e-10
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 1e-10
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP- 1e-10
PRK11607 377 PRK11607, potG, putrescine transporter ATP-binding 1e-10
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding pro 1e-10
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding sub 1e-10
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmemb 2e-10
COG4525259 COG4525, TauB, ABC-type taurine transport system, 2e-10
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP- 2e-10
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding sub 2e-10
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP- 2e-10
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-bind 2e-10
PRK11124242 PRK11124, artP, arginine transporter ATP-binding s 2e-10
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP- 2e-10
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter Nod 3e-10
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding sub 3e-10
COG4615546 COG4615, PvdE, ABC-type siderophore export system, 3e-10
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP- 3e-10
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding sub 3e-10
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 3e-10
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 3e-10
cd03223166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 3e-10
TIGR03269 520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 3e-10
PRK09536402 PRK09536, btuD, corrinoid ABC transporter ATPase; 4e-10
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protei 4e-10
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 4e-10
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 4e-10
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP 4e-10
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 5e-10
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys 5e-10
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-bind 5e-10
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid 6e-10
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phos 7e-10
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-bind 8e-10
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP- 8e-10
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding sub 9e-10
PRK15439 510 PRK15439, PRK15439, autoinducer 2 ABC transporter 9e-10
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-bind 1e-09
cd03215182 cd03215, ABC_Carb_Monos_II, Second domain of the A 1e-09
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP 1e-09
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP- 1e-09
PRK11607377 PRK11607, potG, putrescine transporter ATP-binding 1e-09
COG4181228 COG4181, COG4181, Predicted ABC-type transport sys 1e-09
PRK14263261 PRK14263, PRK14263, phosphate ABC transporter ATP- 1e-09
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP- 1e-09
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transpo 1e-09
COG4559259 COG4559, COG4559, ABC-type hemin transport system, 2e-09
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP- 2e-09
COG0488530 COG0488, Uup, ATPase components of ABC transporter 2e-09
PRK13536340 PRK13536, PRK13536, nodulation factor exporter sub 2e-09
COG4148 352 COG4148, ModC, ABC-type molybdate transport system 2e-09
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding sub 2e-09
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 2e-09
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-bindi 2e-09
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-bind 2e-09
PRK11308327 PRK11308, dppF, dipeptide transporter ATP-binding 2e-09
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 2e-09
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 2e-09
cd03224222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 3e-09
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 3e-09
PRK11650356 PRK11650, ugpC, glycerol-3-phosphate transporter A 3e-09
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit 4e-09
cd03269210 cd03269, ABC_putative_ATPase, ATP-binding cassette 4e-09
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP- 4e-09
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP- 4e-09
PRK14263261 PRK14263, PRK14263, phosphate ABC transporter ATP- 4e-09
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding sub 4e-09
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter 4e-09
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding sub 5e-09
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transp 5e-09
COG4598256 COG4598, HisP, ABC-type histidine transport system 5e-09
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 6e-09
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-b 6e-09
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP- 6e-09
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC 6e-09
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, 7e-09
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 7e-09
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP- 1e-08
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell d 1e-08
COG4172 534 COG4172, COG4172, ABC-type uncharacterized transpo 1e-08
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP 1e-08
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-bind 1e-08
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 1e-08
PRK11144352 PRK11144, modC, molybdate transporter ATP-binding 1e-08
TIGR03265 353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 2e-08
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP- 2e-08
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP- 2e-08
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP- 2e-08
COG4136213 COG4136, COG4136, ABC-type uncharacterized transpo 2e-08
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 2e-08
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding 2e-08
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-b 2e-08
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 2e-08
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-bind 2e-08
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding sub 3e-08
cd03219236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 3e-08
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP- 3e-08
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding s 3e-08
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-bind 3e-08
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding 3e-08
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-bind 3e-08
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate es 3e-08
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP- 3e-08
TIGR00954659 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Tra 3e-08
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 4e-08
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 4e-08
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding sub 4e-08
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protei 4e-08
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding 4e-08
PRK10851353 PRK10851, PRK10851, sulfate/thiosulfate transporte 5e-08
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding 5e-08
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP- 5e-08
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP- 5e-08
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP- 5e-08
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 5e-08
TIGR02633 500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 5e-08
PRK15079331 PRK15079, PRK15079, oligopeptide ABC transporter A 5e-08
PRK10982491 PRK10982, PRK10982, galactose/methyl galaxtoside t 6e-08
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter famil 7e-08
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 7e-08
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 7e-08
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein 8e-08
COG4778235 COG4778, PhnL, ABC-type phosphonate transport syst 8e-08
COG1119257 COG1119, ModF, ABC-type molybdenum transport syste 1e-07
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC trans 1e-07
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP- 1e-07
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transpo 1e-07
PRK10982491 PRK10982, PRK10982, galactose/methyl galaxtoside t 1e-07
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC t 1e-07
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 1e-07
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 1e-07
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-bindin 1e-07
COG4107258 COG4107, PhnK, ABC-type phosphonate transport syst 1e-07
cd03292214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 2e-07
PRK10535 648 PRK10535, PRK10535, macrolide transporter ATP-bind 2e-07
PRK11153343 PRK11153, metN, DL-methionine transporter ATP-bind 2e-07
cd03265220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 2e-07
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP- 2e-07
PRK11288 501 PRK11288, araG, L-arabinose transporter ATP-bindin 2e-07
cd03238176 cd03238, ABC_UvrA, ATP-binding cassette domain of 2e-07
PRK13549 506 PRK13549, PRK13549, xylose transporter ATP-binding 2e-07
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin 2e-07
PRK10418254 PRK10418, nikD, nickel transporter ATP-binding pro 2e-07
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding 3e-07
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 3e-07
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantib 3e-07
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP- 3e-07
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 3e-07
COG1129500 COG1129, MglA, ABC-type sugar transport system, AT 4e-07
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport 4e-07
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide tran 4e-07
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 4e-07
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP- 4e-07
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding sub 4e-07
cd03266218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 6e-07
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP bindi 6e-07
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding sub 7e-07
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP- 8e-07
PRK11432351 PRK11432, fbpC, ferric transporter ATP-binding sub 9e-07
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 9e-07
TIGR03719 552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 9e-07
smart00382148 smart00382, AAA, ATPases associated with a variety 9e-07
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding su 1e-06
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 1e-06
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid 1e-06
PRK10261 623 PRK10261, PRK10261, glutathione transporter ATP-bi 1e-06
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-bindin 1e-06
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding sub 2e-06
COG4133209 COG4133, CcmA, ABC-type transport system involved 2e-06
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding sub 2e-06
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transpo 2e-06
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 2e-06
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 2e-06
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding 3e-06
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding pr 3e-06
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 3e-06
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding sub 4e-06
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 4e-06
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding sub 4e-06
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding 4e-06
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding 5e-06
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase 5e-06
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-bi 6e-06
PLN03211659 PLN03211, PLN03211, ABC transporter G-25; Provisio 6e-06
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transpo 7e-06
cd03222177 cd03222, ABC_RNaseL_inhibitor, ATP-binding cassett 7e-06
PRK10522547 PRK10522, PRK10522, multidrug transporter membrane 8e-06
PRK09700 510 PRK09700, PRK09700, D-allose transporter ATP-bindi 8e-06
COG4778235 COG4778, PhnL, ABC-type phosphonate transport syst 8e-06
PRK10418254 PRK10418, nikD, nickel transporter ATP-binding pro 8e-06
PRK09473330 PRK09473, oppD, oligopeptide transporter ATP-bindi 9e-06
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 9e-06
PRK10636638 PRK10636, PRK10636, putative ABC transporter ATP-b 9e-06
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-b 1e-05
PRK10762 501 PRK10762, PRK10762, D-ribose transporter ATP bindi 1e-05
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 1e-05
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transpor 1e-05
cd03271261 cd03271, ABC_UvrA_II, ATP-binding cassette domain 1e-05
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein ( 2e-05
PRK09452 375 PRK09452, potA, putrescine/spermidine ABC transpor 2e-05
COG4172534 COG4172, COG4172, ABC-type uncharacterized transpo 2e-05
cd03231201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 2e-05
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 2e-05
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP- 2e-05
PRK15134 529 PRK15134, PRK15134, microcin C ABC transporter ATP 2e-05
COG0396251 COG0396, sufC, Cysteine desulfurase activator ATPa 2e-05
TIGR00954659 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Tra 2e-05
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 2e-05
COG4161242 COG4161, ArtP, ABC-type arginine transport system, 3e-05
COG4152300 COG4152, COG4152, ABC-type uncharacterized transpo 3e-05
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-bindin 4e-05
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding sub 4e-05
cd03236255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-bin 4e-05
PLN03073718 PLN03073, PLN03073, ABC transporter F family; Prov 4e-05
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transpor 4e-05
PRK11308327 PRK11308, dppF, dipeptide transporter ATP-binding 5e-05
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 5e-05
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-b 5e-05
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predi 5e-05
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system prote 6e-05
PRK11147635 PRK11147, PRK11147, ABC transporter ATPase compone 6e-05
cd03227162 cd03227, ABC_Class2, ATP-binding cassette domain o 6e-05
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit 7e-05
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 8e-05
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter 8e-05
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-bindin 9e-05
PRK13541195 PRK13541, PRK13541, cytochrome c biogenesis protei 9e-05
PRK006351809 PRK00635, PRK00635, excinuclease ABC subunit A; Pr 9e-05
PRK11819556 PRK11819, PRK11819, putative ABC transporter ATP-b 9e-05
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding 1e-04
cd03267236 cd03267, ABC_NatA_like, ATP-binding cassette domai 1e-04
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system prote 1e-04
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system 1e-04
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding pro 2e-04
PRK11124242 PRK11124, artP, arginine transporter ATP-binding s 2e-04
PRK15079331 PRK15079, PRK15079, oligopeptide ABC transporter A 2e-04
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 2e-04
PRK11819 556 PRK11819, PRK11819, putative ABC transporter ATP-b 2e-04
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protei 2e-04
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC syst 3e-04
PLN03073718 PLN03073, PLN03073, ABC transporter F family; Prov 3e-04
COG4586325 COG4586, COG4586, ABC-type uncharacterized transpo 5e-04
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provision 5e-04
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter A 6e-04
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 6e-04
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP bindi 6e-04
COG3845501 COG3845, COG3845, ABC-type uncharacterized transpo 7e-04
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter 7e-04
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 7e-04
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 8e-04
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-bindin 8e-04
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provision 8e-04
smart00382148 smart00382, AAA, ATPases associated with a variety 9e-04
PRK11022326 PRK11022, dppD, dipeptide transporter ATP-binding 9e-04
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter 0.001
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin 0.001
PLN03211 659 PLN03211, PLN03211, ABC transporter G-25; Provisio 0.001
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-b 0.001
PRK11147 635 PRK11147, PRK11147, ABC transporter ATPase compone 0.001
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein ( 0.002
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys 0.002
PRK10982 491 PRK10982, PRK10982, galactose/methyl galaxtoside t 0.002
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 0.002
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 0.002
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predi 0.002
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit 0.002
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provision 0.002
TIGR00630925 TIGR00630, uvra, excinuclease ABC, A subunit 0.002
PLN031401470 PLN03140, PLN03140, ABC transporter G family membe 0.002
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; 0.002
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate es 0.003
PRK10982491 PRK10982, PRK10982, galactose/methyl galaxtoside t 0.003
COG0178935 COG0178, UvrA, Excinuclease ATPase subunit [DNA re 0.003
>gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
 Score =  889 bits (2299), Expect = 0.0
 Identities = 524/1517 (34%), Positives = 804/1517 (52%), Gaps = 121/1517 (7%)

Query: 19   CSLHLVLLVGLLVSWVWNKIKTGEGDHNRGSREMFKNKKALWYKLTLAC-CFGVSLFNIV 77
               HLVLL GL +  +W   K    DH +  R   ++K   ++   LA  C    LF +V
Sbjct: 40   NISHLVLL-GLCLYRIWLIKK----DH-KVQRFCLRSKWYNYFLALLAAYCTAEPLFRLV 93

Query: 78   FSLLSYFYWYENGWSDYQLVTLLDFGVKTLGWSAICVCLHTVFLNSRQPKLPILLKLWWA 137
              +       +     +++V+L+   V+ L W ++ V +          +  I ++ +  
Sbjct: 94   MGISVLNLDGQTSLPPFEIVSLI---VEALTWCSMLVMIGV--------ETKIYIREFRW 142

Query: 138  FYVFISCYCLIVDIVLCEKQVSLQIQYLISDVASAMTGLFLCFV--GILSKIEGEDALLL 195
            +  F   Y L+ D V+    +S++ +Y  S V           V  GIL        LL+
Sbjct: 143  YVRFAVIYVLVGDAVMLNLVLSVK-EYYSSFVLYLYISEVAAQVLFGIL--------LLV 193

Query: 196  REPLLKADSNETDGTVPSIKSE-----------GADKLTPYSRAGVLSVITYSWINSLIA 244
              P L    +   G  P I SE           G +++ P   A + S I + W+  L+ 
Sbjct: 194  YFPNL----DPYPGYTP-IGSESVDDYEYEELPGGEQICPERHANIFSRIFFGWMTPLMQ 248

Query: 245  LGNKKTLDLEDVPQLDSGDSVSGAFANFKNKLETEGGVGSGLTTVK--LIKAMFCSVWKD 302
            LG K+ L  +DV +LD+ D     + +F+   + E      L   K  L++A+  S+   
Sbjct: 249  LGYKRPLTEKDVWKLDTWDQTETLYRSFQKCWDEE------LKKPKPWLLRALNNSLGGR 302

Query: 303  VLVTGFLTVLYTLASYVGPYLIDTFVQYLNGRRDFENEGYVLVSAFCVAKLVECLC--QR 360
              + GF  +   L+ +VGP L++  ++ +    +    GY+   +  V  ++  LC  Q 
Sbjct: 303  FWLGGFFKIGNDLSQFVGPLLLNLLLESMQ-NGEPAWIGYIYAFSIFVGVVLGVLCEAQY 361

Query: 361  FR-VFRLQQLGIRMRAALIAMIYNKGLTLSSQAKQGQSSGEIINFMTVDAERVADFSWYI 419
            F+ V R+   G R+R+ L+A ++ K L L+ + ++  +SG+I N MT DAE +      +
Sbjct: 362  FQNVMRV---GFRLRSTLVAAVFRKSLRLTHEGRKKFTSGKITNLMTTDAEALQQICQQL 418

Query: 420  HDPWLVLFEVALSILILYKNLGIASLAALFGTVIVMLVNIPLGRVQENFQDKLMKS---- 475
            H  W   F + +++++LY+ LG+ASL    G+++++L+  P+     +   KL K     
Sbjct: 419  HTLWSAPFRIIIAMVLLYQQLGVASL---IGSLMLVLM-FPIQTFIISKMQKLTKEGLQR 474

Query: 476  KDERMKATSEILRNMRILKLQGWEMKFLSKIINLRKRETGWLKKYVYTSAISSFVFWGAP 535
             D+R+   +E+L  M  +K   WE  F SK+  +R  E  W +K    SA +SF+    P
Sbjct: 475  TDKRIGLMNEVLAAMDTVKCYAWENSFQSKVQTVRDDELSWFRKAQLLSAFNSFILNSIP 534

Query: 536  TFVSVATFGTCILLNVPLESGKMLSAIATFRLLQVPIYNLPDVISMIIQTKVSLQRIASF 595
              V+V +FG   LL   L   +  ++++ F +L+ P++ LP++I+  +   VSL+R+   
Sbjct: 535  VLVTVVSFGVFTLLGGDLTPARAFTSLSLFAVLRFPLFMLPNLITQAVNANVSLKRLEEL 594

Query: 596  FCLDD--LQPDLVEKQPSGSSETALDIVDGNFSWDISSHNPTLKDINLKVFHGMRVAVCG 653
               ++  L P+     P      A+ I +G FSWD  +  PTL +INL V  G  VA+ G
Sbjct: 595  LLAEERVLLPNP----PLEPGLPAISIKNGYFSWDSKAERPTLSNINLDVPVGSLVAIVG 650

Query: 654  TVGSGKSSLLSCILGEVPKIS-GTLKLCGTKAYVAQSPWIQSGKIEDNILFGKEMNRERY 712
            + G GK+SL+S +LGE+P  S  ++ + GT AYV Q  WI +  + DNILFG   + ERY
Sbjct: 651  STGEGKTSLISAMLGELPPRSDASVVIRGTVAYVPQVSWIFNATVRDNILFGSPFDPERY 710

Query: 713  NAVLDACSLKKDLEILSFGDQTVIGERGINLSGGQKQRIQIARALYQDSDIYLFDDPFSA 772
               +D  +L+ DL++L  GD T IGERG+N+SGGQKQR+ +ARA+Y +SD+Y+FDDP SA
Sbjct: 711  ERAIDVTALQHDLDLLPGGDLTEIGERGVNISGGQKQRVSMARAVYSNSDVYIFDDPLSA 770

Query: 773  VDAHTGSHLFQEVLLGLLSSKTVIYVTHQVEFLPAADLILVMKDGKITQAGKYNDLINSG 832
            +DAH G  +F + +   L  KT + VT+Q+ FL   D I+++ +G I + G Y +L N+G
Sbjct: 771  LDAHVGRQVFDKCIKDELRGKTRVLVTNQLHFLSQVDRIILVHEGMIKEEGTYEELSNNG 830

Query: 833  TDFMELVGAHEQALLALGSIEG---RPASERASGENGGTVIANRIVKEVENNKGQNDKAD 889
              F +L+   E A    G +E        E     +   V AN     ++ +     K+ 
Sbjct: 831  PLFQKLM---ENA----GKMEEYVEENGEEEDDQTSSKPV-ANGNANNLKKDSSSKKKSK 882

Query: 890  EVAVSKGQLVQEEEREKGKVGFSVYWKYITTAFGGALVPFIL-LAQTLFQILQIASNYWI 948
            E    K  L+++EERE G V + V  +Y   A GGA V  IL L   L ++ +++S+ W+
Sbjct: 883  E---GKSVLIKQEERETGVVSWKVLERY-KNALGGAWVVMILFLCYVLTEVFRVSSSTWL 938

Query: 949  -VWATPGT-KDVKPVVTGSTLLIVYVALAVGSSFCVLARSTLLATAGYKTATLLFNEMHY 1006
              W   GT K   P+       ++Y  L+ G     L  S  L  +    A  L + M  
Sbjct: 939  SEWTDQGTPKTHGPLF----YNLIYALLSFGQVLVTLLNSYWLIMSSLYAAKRLHDAMLG 994

Query: 1007 CIFRAPMSFFDATPSGRIINRASTDQSAADLGIPSLVGAYAFSIIRILGTIAVMSQVA-- 1064
             I RAPMSFF   P GRIINR + D    D  +   V  +   I ++L T  ++  V+  
Sbjct: 995  SILRAPMSFFHTNPLGRIINRFAKDLGDIDRNVAVFVNMFLGQIFQLLSTFVLIGIVSTI 1054

Query: 1065 --WQVFIVFVPAVGSCIWYQQYYISSARELSRLVGVCKAPVIQHFAETVSGSTTIRSFDQ 1122
              W +  + V   G+ ++YQ    S+ARE+ RL  + ++PV   F E ++G +TIR++  
Sbjct: 1055 SLWAIMPLLVLFYGAYLYYQ----STAREVKRLDSITRSPVYAQFGEALNGLSTIRAYKA 1110

Query: 1123 ESRFRDRNMKLMDEYSRPTFHIAAAMEWLGLRLDMLSSITFAFTLVFLI------SIPKG 1176
              R  + N + MD   R T    ++  WL +RL+ L  +    T  F +           
Sbjct: 1111 YDRMAEINGRSMDNNIRFTLVNMSSNRWLAIRLETLGGLMIWLTASFAVMQNGRAENQAA 1170

Query: 1177 FIDPAIAGLAVTYGLTLNTLLATLIWFACDLENKIISVERIFQYTCIPSEPPLAIEESRP 1236
            F   +  GL ++Y L + +LL  ++  A   EN + +VER+  Y  +PSE PL IE +RP
Sbjct: 1171 F--ASTMGLLLSYALNITSLLTAVLRLASLAENSLNAVERVGTYIDLPSEAPLVIENNRP 1228

Query: 1237 NDSWPSHGKIDLLDLQVRYAPQMPLVLQGISCTFPGGEKTGIVGRTGSGKSTLIQTLFRI 1296
               WPS G I   D+ +RY P++P VL G+S      EK GIVGRTG+GKS+++  LFRI
Sbjct: 1229 PPGWPSSGSIKFEDVVLRYRPELPPVLHGLSFEISPSEKVGIVGRTGAGKSSMLNALFRI 1288

Query: 1297 VEPAAGQILIDGIDISLIGLHDLRSRLSIIPQDPVMFEGTVRSNLDPLEESTDEQIWEAL 1356
            VE   G+ILIDG DIS  GL DLR  L IIPQ PV+F GTVR NLDP  E  D  +WE+L
Sbjct: 1289 VELERGRILIDGCDISKFGLMDLRKVLGIIPQAPVLFSGTVRFNLDPFNEHNDADLWESL 1348

Query: 1357 DKCQLGDEVRKKEGKLDSKVTENGENWSMGQRQLVCLGRVLLKRSKILMLDEATASVDTA 1416
            ++  L D +R+    LD++V+E GEN+S+GQRQL+ L R LL+RSKIL+LDEATA+VD  
Sbjct: 1349 ERAHLKDVIRRNSLGLDAEVSEAGENFSVGQRQLLSLARALLRRSKILVLDEATAAVDVR 1408

Query: 1417 TDNLIQQTLRQHFSDCTVLTIAHRITSVIDSDLVLLLNHGLIEEFDNPANLLENKSSSFS 1476
            TD LIQ+T+R+ F  CT+L IAHR+ ++ID D +L+L+ G + EFD P NLL N+ S+FS
Sbjct: 1409 TDALIQKTIREEFKSCTMLIIAHRLNTIIDCDRILVLDAGRVVEFDTPENLLSNEGSAFS 1468

Query: 1477 QLV-------AEYTLRS 1486
            ++V       A+Y LRS
Sbjct: 1469 KMVQSTGAANAQY-LRS 1484


Length = 1622

>gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C Back     alignment and domain information
>gnl|CDD|213255 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 of the sulfonylurea receptor SUR Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|213258 cd03291, ABCC_CFTR1, ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213256 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 of CFTR,subfamily C Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|216049 pfam00664, ABC_membrane, ABC transporter transmembrane region Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|216049 pfam00664, ABC_membrane, ABC transporter transmembrane region Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213255 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 of the sulfonylurea receptor SUR Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter Back     alignment and domain information
>gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|188317 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter Back     alignment and domain information
>gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system Back     alignment and domain information
>gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|213258 cd03291, ABCC_CFTR1, ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|213256 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 of CFTR,subfamily C Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237650 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|236707 PRK10522, PRK10522, multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226968 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226968 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|172751 PRK14263, PRK14263, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130262 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|236947 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172751 PRK14263, PRK14263, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|237650 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236997 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|233206 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|185037 PRK15079, PRK15079, oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130262 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213205 cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|236688 PRK10418, nikD, nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213189 cd03222, ABC_RNaseL_inhibitor, ATP-binding cassette domain of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|236707 PRK10522, PRK10522, multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|236688 PRK10418, nikD, nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>gnl|CDD|181888 PRK09473, oppD, oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|236729 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236997 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213238 cd03271, ABC_UvrA_II, ATP-binding cassette domain II of the excision repair protein UvrA Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233206 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213203 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-binding cassette domain 1 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|215558 PLN03073, PLN03073, ABC transporter F family; Provisional Back     alignment and domain information
>gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|225265 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184128 PRK13541, PRK13541, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|234806 PRK00635, PRK00635, excinuclease ABC subunit A; Provisional Back     alignment and domain information
>gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|185037 PRK15079, PRK15079, oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|184127 PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>gnl|CDD|215558 PLN03073, PLN03073, ABC transporter F family; Provisional Back     alignment and domain information
>gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|182906 PRK11022, dppD, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|225265 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|233062 TIGR00630, uvra, excinuclease ABC, A subunit Back     alignment and domain information
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
>gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated Back     alignment and domain information
>gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223256 COG0178, UvrA, Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1496
KOG00541381 consensus Multidrug resistance-associated protein/ 100.0
PLN03130 1622 ABC transporter C family member; Provisional 100.0
PLN032321495 ABC transporter C family member; Provisional 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
PTZ002431560 ABC transporter; Provisional 100.0
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 100.0
PTZ002651466 multidrug resistance protein (mdr1); Provisional 100.0
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 100.0
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
PRK10790592 putative multidrug transporter membrane\ATP-bindin 100.0
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 100.0
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 100.0
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 100.0
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 100.0
COG4987573 CydC ABC-type transport system involved in cytochr 100.0
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 100.0
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 100.0
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 100.0
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 100.0
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 100.0
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 100.0
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 100.0
PRK10789569 putative multidrug transporter membrane\ATP-bindin 100.0
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 100.0
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 100.0
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 100.0
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 100.0
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 100.0
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 100.0
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 100.0
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 100.0
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 100.0
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 100.0
COG1123539 ATPase components of various ABC-type transport sy 100.0
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 100.0
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 100.0
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 100.0
PRK10261623 glutathione transporter ATP-binding protein; Provi 100.0
PRK10790592 putative multidrug transporter membrane\ATP-bindin 100.0
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 100.0
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 100.0
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 100.0
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 100.0
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 100.0
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 100.0
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 100.0
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 100.0
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 100.0
PRK09700510 D-allose transporter ATP-binding protein; Provisio 100.0
PRK10789569 putative multidrug transporter membrane\ATP-bindin 100.0
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 100.0
COG4988559 CydD ABC-type transport system involved in cytochr 100.0
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 100.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 100.0
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 100.0
PRK10762501 D-ribose transporter ATP binding protein; Provisio 100.0
PRK15064530 ABC transporter ATP-binding protein; Provisional 100.0
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 100.0
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
PRK11288501 araG L-arabinose transporter ATP-binding protein; 100.0
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 100.0
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
PRK10938490 putative molybdenum transport ATP-binding protein 100.0
PLN03232 1495 ABC transporter C family member; Provisional 100.0
PRK10522547 multidrug transporter membrane component/ATP-bindi 100.0
PLN03130 1622 ABC transporter C family member; Provisional 100.0
PRK11819556 putative ABC transporter ATP-binding protein; Revi 100.0
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 100.0
COG4172534 ABC-type uncharacterized transport system, duplica 100.0
COG4987573 CydC ABC-type transport system involved in cytochr 100.0
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 100.0
PRK10636638 putative ABC transporter ATP-binding protein; Prov 100.0
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 100.0
PRK11147635 ABC transporter ATPase component; Reviewed 100.0
PLN03140 1470 ABC transporter G family member; Provisional 100.0
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 100.0
COG4618580 ArpD ABC-type protease/lipase transport system, AT 100.0
PTZ002431560 ABC transporter; Provisional 100.0
PLN03073718 ABC transporter F family; Provisional 100.0
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 100.0
COG4618580 ArpD ABC-type protease/lipase transport system, AT 100.0
COG0488530 Uup ATPase components of ABC transporters with dup 100.0
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 100.0
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 100.0
PRK13409590 putative ATPase RIL; Provisional 100.0
PRK10522547 multidrug transporter membrane component/ATP-bindi 100.0
KOG0054 1381 consensus Multidrug resistance-associated protein/ 100.0
COG1129500 MglA ABC-type sugar transport system, ATPase compo 100.0
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 100.0
COG3845501 ABC-type uncharacterized transport systems, ATPase 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
KOG0927614 consensus Predicted transporter (ABC superfamily) 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 100.0
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
KOG0062582 consensus ATPase component of ABC transporters wit 100.0
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 100.0
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 100.0
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 100.0
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 100.0
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 100.0
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 100.0
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 100.0
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
COG1127263 Ttg2A ABC-type transport system involved in resist 100.0
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 100.0
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
COG4178604 ABC-type uncharacterized transport system, permeas 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 100.0
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 100.0
COG1117253 PstB ABC-type phosphate transport system, ATPase c 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 100.0
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
COG4615546 PvdE ABC-type siderophore export system, fused ATP 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14236272 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 100.0
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 100.0
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 100.0
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
PRK14238271 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
COG3842352 PotA ABC-type spermidine/putrescine transport syst 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 100.0
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
PRK14243264 phosphate transporter ATP-binding protein; Provisi 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
PRK09473330 oppD oligopeptide transporter ATP-binding componen 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
cd03246173 ABCC_Protease_Secretion This family represents the 100.0
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
PRK14241258 phosphate transporter ATP-binding protein; Provisi 100.0
COG1136226 SalX ABC-type antimicrobial peptide transport syst 100.0
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
cd03299235 ABC_ModC_like Archeal protein closely related to M 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 100.0
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 100.0
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 100.0
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 100.0
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 100.0
COG3842352 PotA ABC-type spermidine/putrescine transport syst 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 100.0
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 100.0
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 100.0
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
PRK10908222 cell division protein FtsE; Provisional 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 100.0
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
COG3638258 ABC-type phosphate/phosphonate transport system, A 100.0
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 100.0
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 100.0
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 100.0
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 100.0
COG4615546 PvdE ABC-type siderophore export system, fused ATP 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 100.0
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 100.0
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 100.0
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 100.0
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK00349943 uvrA excinuclease ABC subunit A; Reviewed 100.0
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 100.0
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 100.0
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 100.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 100.0
PRK09984262 phosphonate/organophosphate ester transporter subu 100.0
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
COG4178604 ABC-type uncharacterized transport system, permeas 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 100.0
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 100.0
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 100.0
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 100.0
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 100.0
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 100.0
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 100.0
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 100.0
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 100.0
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 100.0
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 100.0
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 100.0
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 100.0
COG2884223 FtsE Predicted ATPase involved in cell division [C 100.0
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 100.0
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 100.0
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 100.0
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 100.0
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 100.0
cd03234226 ABCG_White The White subfamily represents ABC tran 100.0
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 100.0
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 100.0
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 100.0
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 100.0
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 100.0
cd03215182 ABC_Carb_Monos_II This family represents domain II 100.0
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 100.0
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 100.0
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 100.0
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 100.0
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 100.0
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 100.0
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 100.0
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 100.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 100.0
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 100.0
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 100.0
PRK13537306 nodulation ABC transporter NodI; Provisional 100.0
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 100.0
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 100.0
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 100.0
PRK14242253 phosphate transporter ATP-binding protein; Provisi 100.0
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 100.0
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 100.0
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 100.0
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 100.0
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 100.0
PRK11153343 metN DL-methionine transporter ATP-binding subunit 100.0
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 100.0
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 100.0
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 100.0
PRK11607377 potG putrescine transporter ATP-binding subunit; P 100.0
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 100.0
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 100.0
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 100.0
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 100.0
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 100.0
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 100.0
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 100.0
PRK03695248 vitamin B12-transporter ATPase; Provisional 100.0
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 100.0
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 100.0
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 100.0
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 100.0
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 100.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 100.0
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 100.0
PRK13536340 nodulation factor exporter subunit NodI; Provision 100.0
PRK14235267 phosphate transporter ATP-binding protein; Provisi 100.0
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 100.0
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 100.0
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 100.0
COG1123 539 ATPase components of various ABC-type transport sy 100.0
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 100.0
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 100.0
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 100.0
PRK09580248 sufC cysteine desulfurase ATPase component; Review 100.0
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03269210 ABC_putative_ATPase This subfamily is involved in 100.0
PRK10619257 histidine/lysine/arginine/ornithine transporter su 100.0
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 100.0
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 100.0
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 100.0
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 100.0
TIGR00630924 uvra excinuclease ABC, A subunit. This family is b 100.0
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 100.0
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 100.0
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 100.0
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 100.0
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 100.0
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14237267 phosphate transporter ATP-binding protein; Provisi 100.0
cd03216163 ABC_Carb_Monos_I This family represents the domain 100.0
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 100.0
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 100.0
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 100.0
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14239252 phosphate transporter ATP-binding protein; Provisi 100.0
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 100.0
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 100.0
COG0411250 LivG ABC-type branched-chain amino acid transport 100.0
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 100.0
PRK10070400 glycine betaine transporter ATP-binding subunit; P 100.0
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 100.0
PRK00635 1809 excinuclease ABC subunit A; Provisional 100.0
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 100.0
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 100.0
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 100.0
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 100.0
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 100.0
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 100.0
PRK14240250 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 100.0
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 100.0
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 100.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 100.0
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 100.0
COG4175386 ProV ABC-type proline/glycine betaine transport sy 100.0
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 100.0
PRK10253265 iron-enterobactin transporter ATP-binding protein; 100.0
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 100.0
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 100.0
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 100.0
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 100.0
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 100.0
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 100.0
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 100.0
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 100.0
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
PRK14243264 phosphate transporter ATP-binding protein; Provisi 100.0
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 100.0
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 100.0
COG4619223 ABC-type uncharacterized transport system, ATPase 100.0
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 100.0
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 100.0
PRK14238271 phosphate transporter ATP-binding protein; Provisi 100.0
PRK10261 623 glutathione transporter ATP-binding protein; Provi 100.0
COG0410237 LivF ABC-type branched-chain amino acid transport 100.0
PRK14236272 phosphate transporter ATP-binding protein; Provisi 100.0
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 100.0
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 100.0
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
Probab=100.00  E-value=1.8e-274  Score=2614.14  Aligned_cols=1255  Identities=47%  Similarity=0.777  Sum_probs=1166.9

Q ss_pred             CCCcccCch--hHHHHHHhHHHHHHccccCCCCCCCCCCCCCCCcHhHHHHHHHHHHhhccCCCCCCchhhHHHHHHHHh
Q 039402          222 LTPYSRAGV--LSVITYSWINSLIALGNKKTLDLEDVPQLDSGDSVSGAFANFKNKLETEGGVGSGLTTVKLIKAMFCSV  299 (1496)
Q Consensus       222 ~~p~~~a~~--~s~~~f~W~~pl~~~g~~~~L~~~Dl~~l~~~~~~~~~~~~f~~~w~~~~~~~~~~~~~~l~~al~~~~  299 (1496)
                      ++|.+.++.  +|++||||++|++++|||++|+.+|+|+++++|+++.+.++|++.|+++.++  +.++|+++++++++|
T Consensus       122 ~~~~~~~~~~~~S~~~f~W~~~l~~~g~k~~L~~~Dl~~l~~~d~s~~l~~~~~~~w~~~~~~--~~~~psl~~al~~~f  199 (1381)
T KOG0054|consen  122 PNPLPEASAGFLSRLTFSWMTPLLRKGYKKPLELKDLWSLSPEDSSETLVKRLESLWEKELGR--SGKKPSLLRALLRTF  199 (1381)
T ss_pred             CCcccccchhHHHHHHHHHHHHHHHhhccCCCChhhcccCChhhhhhHHHHHHHHHHHHHhcc--ccCCcHHHHHHHHHH
Confidence            344555555  9999999999999999999999999999999999999999999999998622  225689999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCcchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 039402          300 WKDVLVTGFLTVLYTLASYVGPYLIDTFVQYLNGRRDFENEGYVLVSAFCVAKLVECLCQRFRVFRLQQLGIRMRAALIA  379 (1496)
Q Consensus       300 ~~~~~~~~~~~l~~~~~~~~~P~ll~~~i~~~~~~~~~~~~g~~l~~~l~~~~~~~~l~~~~~~~~~~~~~~~ir~~L~~  379 (1496)
                      |+++++.+++..+.+.+.+++|.+++.+++|+++++...+.||+++++++++.++++++.++|+|..+++|+|+|++|.+
T Consensus       200 ~~~~~~~~~~~~~~~~~~~~~P~lL~~li~~~~~~~~~~~~g~~~a~~lf~~~~l~~l~~~~~~~~~~~~g~r~R~al~~  279 (1381)
T KOG0054|consen  200 GRTFLLSGIFLFLRDLAGFVGPLLLKKLILFFSEKRLPLNNGYLLAVLLFLASLLQSLLLHQYFFVSFRVGMRLRSALIS  279 (1381)
T ss_pred             HHHHHHHHHHHHHHHHHccccHHHHHHHHHHhcCCCcccchhHHHHHHHHHHHHHHHHHHhHHHHHHHhhhhhHHHHHHH
Confidence            99999999999999999999999999999999987555678999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcCCcchhcCCCHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHH
Q 039402          380 MIYNKGLTLSSQAKQGQSSGEIINFMTVDAERVADFSWYIHDPWLVLFEVALSILILYKNLGIASLAALFGTVIVMLVNI  459 (1496)
Q Consensus       380 ~iy~K~L~ls~~~~~~~~~G~i~nl~s~D~~~i~~~~~~~~~~~~~pl~i~~~~~lL~~~lg~~~l~~l~~~~~~~~~~~  459 (1496)
                      +||+|+|++++.+++++++|+|+|+|++|++|+.++++++|.+|.+|+|+++++++||..+|+++++|++++++++|+|.
T Consensus       280 ~IY~K~L~ls~~~~~~~t~G~ivNlms~D~~ri~~~~~~~h~~w~~Plqi~~~l~lLy~~LG~sa~~G~~~~il~~p~n~  359 (1381)
T KOG0054|consen  280 AIYRKALRLSNSARGETTVGEIVNLMSVDAQRLSDAACFLHLLWSAPLQIILALYLLYGLLGPSALAGVAVMVLLIPLNS  359 (1381)
T ss_pred             HHHHhhhcCchhhccCCCcchhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhChHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHhCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 039402          460 PLGRVQENFQDKLMKSKDERMKATSEILRNMRILKLQGWEMKFLSKIINLRKRETGWLKKYVYTSAISSFVFWGAPTFVS  539 (1496)
Q Consensus       460 ~~~~~~~~~~~~~~~~~d~R~~~~~E~L~~ir~IK~~~wE~~~~~~i~~~R~~E~~~l~~~~~~~~~~~~~~~~~p~~v~  539 (1496)
                      +++++++++|++.|+.+|+|++.|+|+|+|||+||+||||+.|.++|++.|++|+++++|..+..+++.++++++|++++
T Consensus       360 ~~a~~~~~~q~~~m~~~D~Rik~~nEiL~~IkviK~yaWE~~F~~~I~~~R~~El~~lrk~~~~~~~~~~~~~~~p~lv~  439 (1381)
T KOG0054|consen  360 FLAKKIAKFQKRLMKRKDERIKLMNEILNGIKVIKLYAWEKPFLKKIEDLRQKELKLLRKSAYLSALNSFLNFFSPVLVS  439 (1381)
T ss_pred             HHHHHHHHHHHHHhhhhhHHHHHHHHHHhhhHhhhhHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHH-HhcCCcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCCccccCCCCCCCCccE
Q 039402          540 VATFGTCI-LLNVPLESGKMLSAIATFRLLQVPIYNLPDVISMIIQTKVSLQRIASFFCLDDLQPDLVEKQPSGSSETAL  618 (1496)
Q Consensus       540 ~~~f~~~~-~~~~~L~~~~vft~l~l~~~l~~pl~~lp~~i~~~~~a~vs~~Ri~~fL~~~e~~~~~~~~~~~~~~~~~i  618 (1496)
                      +++|++|+ ..++.+++.++|+++++|++|+.|+..+|..++.+.|++||++|+++||..+|.+++.....+.+..+..+
T Consensus       440 ~~tF~~~v~~~~~~lt~~~aF~slalfniLr~pl~~~P~~i~~~vqa~VS~~Ri~~fl~~~e~~~~~~~~~~~~~~~~~i  519 (1381)
T KOG0054|consen  440 VVTFVVFVLLLGNLLTASTAFTSLALFNILRFPLFMLPSVISQLVQAKVSLKRLKEFLLSEELDPDSVERSPDEAGENAI  519 (1381)
T ss_pred             HHHHHHHhhccCccccHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcccCccccccCCCCCCCceE
Confidence            99999999 77889999999999999999999999999999999999999999999999999888766543444556789


Q ss_pred             EEEeeEEEecCCCCCCceeeeeEEEeCCcEEEEEecCCCcHHHHHHHHhcCCCCCccEEEEcCeeEEEccCCccCCCcHH
Q 039402          619 DIVDGNFSWDISSHNPTLKDINLKVFHGMRVAVCGTVGSGKSSLLSCILGEVPKISGTLKLCGTKAYVAQSPWIQSGKIE  698 (1496)
Q Consensus       619 ~~~~~~~~~~~~~~~~~L~~i~l~i~~G~~~~ivG~~GsGKSTLl~~ilG~~~~~~G~i~~~g~~~yv~Q~~~i~~~ti~  698 (1496)
                      +++|++|+|+.++..++|+||||+|++|+++||||++||||||||++|+||+++.+|+|.++|.+|||||+|||||||||
T Consensus       520 ~i~~~sfsW~~~~~~~tL~dIn~~i~~G~lvaVvG~vGsGKSSLL~AiLGEm~~~sG~v~v~gsiaYv~Q~pWI~ngTvr  599 (1381)
T KOG0054|consen  520 EIKNGSFSWDSESPEPTLKDINFEIKKGQLVAVVGPVGSGKSSLLSAILGEMPKLSGSVAVNGSVAYVPQQPWIQNGTVR  599 (1381)
T ss_pred             EEeeeeEecCCCCCcccccceeEEecCCCEEEEECCCCCCHHHHHHHHhcCcccccceEEEcCeEEEeccccHhhCCcHH
Confidence            99999999997666679999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhccCCCCCHHHHHHHHHHhchhhHHHhccCCCcccccCCCCCCChHHHHHHHHHHHHccCCCEEEEecCCCCCCHHHH
Q 039402          699 DNILFGKEMNRERYNAVLDACSLKKDLEILSFGDQTVIGERGINLSGGQKQRIQIARALYQDSDIYLFDDPFSAVDAHTG  778 (1496)
Q Consensus       699 eNI~~g~~~~~~~~~~v~~~~~l~~d~~~l~~g~~t~ig~~g~~LSGGQkqRv~LARAl~~~~~illLDep~saLD~~~~  778 (1496)
                      |||+||.++|++||++|+++|+|++|++.||.||+|+|||||.||||||||||+||||+|+|+||||||||+||||+|++
T Consensus       600 eNILFG~~~d~~rY~~Vi~aC~L~~Dle~Lp~GD~TeIGErGinLSGGQKqRIsLARAVY~~adIYLLDDplSAVDahvg  679 (1381)
T KOG0054|consen  600 ENILFGSPYDEERYDKVIKACALKKDLEILPFGDLTEIGERGINLSGGQKQRISLARAVYQDADIYLLDDPLSAVDAHVG  679 (1381)
T ss_pred             HhhhcCccccHHHHHHHHHHccCHhHHhhcCCCCcceecCCccCCcHhHHHHHHHHHHHhccCCEEEEcCcchhhhHhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhCCcEEEEEccCcCccccCCEEEEEeCCeEEEecChHHHHhcCcchHHHHHHhHHHHhhhCCCCCCCCc
Q 039402          779 SHLFQEVLLGLLSSKTVIYVTHQVEFLPAADLILVMKDGKITQAGKYNDLINSGTDFMELVGAHEQALLALGSIEGRPAS  858 (1496)
Q Consensus       779 ~~i~~~~~~~~~~~~tvilvtH~~~~l~~~d~i~~l~~G~i~~~G~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  858 (1496)
                      +|||++|+++.+++||+|+|||+++++++||+|++|+||+|.++|+|+|+++.+..+.++....  ..+..+..+ .+..
T Consensus       680 ~~if~~ci~~~L~~KT~ILVTHql~~L~~ad~Iivl~~G~I~~~Gty~el~~~~~~~~~l~~~~--~~~~~~~~~-~~~~  756 (1381)
T KOG0054|consen  680 KHIFEECIRGLLRGKTVILVTHQLQFLPHADQIIVLKDGKIVESGTYEELLKSGGDFAELAHEE--ESEQEEEAS-EKDL  756 (1381)
T ss_pred             HHHHHHHHHhhhcCCEEEEEeCchhhhhhCCEEEEecCCeEecccCHHHHHhcchhHHHHhhcc--chhhccccc-cccc
Confidence            9999999999999999999999999999999999999999999999999999988888873221  111111000 0000


Q ss_pred             cCCCCCCCCccccccchhhhccccCCCCchhhhhhhccchhHHHHHhhccchHHHHHHHHHHhhhhhHHHHHHHHHHHHH
Q 039402          859 ERASGENGGTVIANRIVKEVENNKGQNDKADEVAVSKGQLVQEEEREKGKVGFSVYWKYITTAFGGALVPFILLAQTLFQ  938 (1496)
Q Consensus       859 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~g~v~~~~y~~y~~~~~~~~~~~~~~~~~~~~~  938 (1496)
                      +.. ....... .+ .. +  ..+...++..+.+....++.++|+|+.|.|+|++|++|+++.+|++.+++++++.++.+
T Consensus       757 ~~~-~~~~~~~-~~-~~-~--~~~~~~~~~~~~~~~~~~~~~~ee~~~G~v~~~vY~~Y~~a~~g~~~~~~~~~~~v~~~  830 (1381)
T KOG0054|consen  757 ESG-ESSRESE-SR-SL-E--SLSSEEEKSKDEKEEEDKLVQEEERETGKVSWSVYKKYIKAAGGFLLVLLILLLFVLTQ  830 (1381)
T ss_pred             ccc-ccccchh-hh-hh-h--hhcccccccccccchhhHHHHHHHHhcCEeeHHHHHHHHHhcccHHHHHHHHHHHHHHH
Confidence            000 0000000 00 00 0  00000000011112245677889999999999999999999888888888888899999


Q ss_pred             HHHHHhhhHHHhhcCCCCCCCCc-ccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcccccc
Q 039402          939 ILQIASNYWIVWATPGTKDVKPV-VTGSTLLIVYVALAVGSSFCVLARSTLLATAGYKTATLLFNEMHYCIFRAPMSFFD 1017 (1496)
Q Consensus       939 ~~~~~~~~wl~~~~~~~~~~~~~-~~~~~~l~vy~~l~~~~~~~~~~~~~~~~~~~~~~s~~l~~~ll~~ll~ap~~ffd 1017 (1496)
                      +++++++|||++|++........ .+...|+++|.+++++++++.++|++.+...++++|+.+|++|+++++|+||+|||
T Consensus       831 ~~~~~~~~WLs~W~~~~~~~~~~~~~~~~~~~vY~~l~~~~~~~~~~rs~~~~~~~l~aS~~Lh~~ml~~Ilrapm~FFd  910 (1381)
T KOG0054|consen  831 VLQIASNYWLSYWTDDGEDNGTTTVSTSFYLGVYALLGVASSLLTLLRSFLFAKGGLKASRKLHDKLLNSILRAPMSFFD  910 (1381)
T ss_pred             HHHHHHHHHHHHhcCCcccccccCCCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCcchhcC
Confidence            99999999999998754322221 46778999999999999999999999999999999999999999999999999999


Q ss_pred             ccCchhHHHHHhhhHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 039402         1018 ATPSGRIINRASTDQSAADLGIPSLVGAYAFSIIRILGTIAVMSQVAWQVFIVFVPAVGSCIWYQQYYISSARELSRLVG 1097 (1496)
Q Consensus      1018 ~tp~GrIlnR~s~D~~~vd~~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~ip~~~l~~~~~~~y~~~~r~l~rl~~ 1097 (1496)
                      +||+|||+||||+|++.+|..+|..+..++..+++++++++++++++|+++++++|+.++|+++++||++++||++|+++
T Consensus       911 tTP~GRILNRFSkD~~~vD~~Lp~~~~~~~~~~~~~l~~~~vi~~~~P~fli~~~pl~v~~~~~~~~Y~~tsReLkRLes  990 (1381)
T KOG0054|consen  911 TTPTGRILNRFSKDIDTVDVLLPFTLEFFLQSLLNVLGILVVISYVTPWFLIAIIPLGVIYYFVQRYYLATSRELKRLES  990 (1381)
T ss_pred             CCCccchhhhcccchHHHHHhhHHHHHHHHHHHHHHHHHHHHhhHHhHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhchHHHHHHHhhcchHHHHHhccHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCC
Q 039402         1098 VCKAPVIQHFAETVSGSTTIRSFDQESRFRDRNMKLMDEYSRPTFHIAAAMEWLGLRLDMLSSITFAFTLVFLISIPKGF 1177 (1496)
Q Consensus      1098 ~~~sp~~~~~~Etl~G~~tIRaf~~~~~f~~~~~~~~d~~~~~~~~~~~~~~wl~~rl~~l~~~~~~~~~~~~~~~~~g~ 1177 (1496)
                      ++|||+++||+||++|+.|||||+++++|.+++..++|.+++++|+..+++||+++|+|+++++++++++++.+..+.+.
T Consensus       991 itRSPi~sh~~Etl~GlsTIRAf~~~~rf~~~~~~~~D~~~~~~f~~~~a~RWla~Rle~ig~~~v~~~al~~vl~~~~~ 1070 (1381)
T KOG0054|consen  991 ITRSPIYSHFSETLQGLSTIRAFGKEERFIQENDELIDENSRAFFLSISANRWLAVRLELLGNLVVLIAALFAVLLPSGL 1070 (1381)
T ss_pred             cccchHHHhHHHHhcCcceeeeccccHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999888777666


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHhHHHHHHHhhcCCCCCCCCccCCCCCCCCCCcceEEEEeEEeEeCC
Q 039402         1178 IDPAIAGLAVTYGLTLNTLLATLIWFACDLENKIISVERIFQYTCIPSEPPLAIEESRPNDSWPSHGKIDLLDLQVRYAP 1257 (1496)
Q Consensus      1178 ~~~g~~gl~l~y~l~l~~~l~~~i~~~~~le~~~~sveRi~~~~~~~~E~~~~~~~~~~~~~wp~~g~I~f~nvs~~Y~~ 1257 (1496)
                      .+||.+|++++|++++++.++|++++.+++|++|+|||||.||+++|+|+|+..+..+||++||++|+|+|+|+++||+|
T Consensus      1071 ~~~g~vGLslsyal~lt~~l~~~vR~~~elEn~m~SVERv~eY~~~~~E~p~~~~~~~pp~~WP~~G~I~f~~~~~RYrp 1150 (1381)
T KOG0054|consen 1071 ISPGLVGLSLSYALQLTGLLQWLVRQSSELENNMVSVERVLEYTDIPSEAPLEIEESRPPPSWPSKGEIEFEDLSLRYRP 1150 (1381)
T ss_pred             CCcchHHHHHHHHHHHHHHHHHHHHHHHHHHhcchhhhHHHHHhcCCCCCCCCCcCCCCCCCCCCCCeEEEEEeEEEeCC
Confidence            88999999999999999999999999999999999999999999999998888777779999999999999999999999


Q ss_pred             CCCccceeeeEEeeCCcEEEEEcCCCCCHHHHHHHHhcccCCCccEEEECCeeCCCCChHHHhcccEEEcccccccccch
Q 039402         1258 QMPLVLQGISCTFPGGEKTGIVGRTGSGKSTLIQTLFRIVEPAAGQILIDGIDISLIGLHDLRSRLSIIPQDPVMFEGTV 1337 (1496)
Q Consensus      1258 ~~~~vLk~iS~~I~~GekvgIVGrTGSGKSTLl~~L~rl~ep~~G~I~IDG~dI~~i~l~~LR~~i~iIpQdp~LF~gTI 1337 (1496)
                      +.|+|||||||+|+||||||||||||||||||+++|||+.||.+|+|.|||+||+++++||||++++||||||+||+||+
T Consensus      1151 ~lp~VLk~is~~I~p~eKVGIVGRTGaGKSSL~~aLFRl~e~~~G~I~IDgvdI~~igL~dLRsrlsIIPQdPvLFsGTv 1230 (1381)
T KOG0054|consen 1151 NLPLVLKGISFTIKPGEKVGIVGRTGAGKSSLILALFRLVEPAEGEILIDGVDISKIGLHDLRSRLSIIPQDPVLFSGTV 1230 (1381)
T ss_pred             CCcchhcCceEEEcCCceEEEeCCCCCCHHHHHHHHHHhcCccCCeEEEcCeecccccHHHHHhcCeeeCCCCceecCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhccCCCCCCcHHHHHHHHHHcCCcHHHHhccCCcccccccCCCCCCchHHHHHHHHHHHccCCCEEEEEcCCCCCCHHH
Q 039402         1338 RSNLDPLEESTDEQIWEALDKCQLGDEVRKKEGKLDSKVTENGENWSMGQRQLVCLGRVLLKRSKILMLDEATASVDTAT 1417 (1496)
Q Consensus      1338 R~NLdp~~~~sd~eI~~aL~~~~L~~~i~~lp~gLdt~v~e~G~nLS~GQrQll~LARALLr~~~ILiLDEaTsslD~~T 1417 (1496)
                      |+||||+++|+|+|||+|||+|+|+++|+++|+|||++|.|+|+|||.||||++||||||||++||||||||||++|++|
T Consensus      1231 R~NLDPf~e~sD~~IW~ALe~~~Lk~~v~~~p~~Ld~~v~egG~N~SvGQRQLlCLARALLr~skILvLDEATAsVD~~T 1310 (1381)
T KOG0054|consen 1231 RFNLDPFDEYSDDEIWEALERCQLKDVVSSLPGGLDSEVSEGGENFSVGQRQLLCLARALLRKSKILVLDEATASVDPET 1310 (1381)
T ss_pred             ccccCcccccCHHHHHHHHHHhChHHHHhhCCcCCCceecCCCccCChHHHHHHHHHHHHhccCCEEEEecccccCChHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhcCCcEEEEEccCcchhcccCEEEEEeCCeEeEecChhhHhhcCCcHHHHHHHHHhhccC
Q 039402         1418 DNLIQQTLRQHFSDCTVLTIAHRITSVIDSDLVLLLNHGLIEEFDNPANLLENKSSSFSQLVAEYTLRSS 1487 (1496)
Q Consensus      1418 d~~Iq~~I~~~f~~~TVI~IAHRl~ti~~~DrIlVL~~G~IvE~g~p~~Ll~~~~s~F~~l~~~~~~~~~ 1487 (1496)
                      |+.||++||++|+|||||+||||++||+|||||+|||+|+|+|+|+|++|+++++|.|++++.++..++.
T Consensus      1311 D~lIQ~tIR~~F~dcTVltIAHRl~TVmd~DrVlVld~G~v~EfdsP~~Ll~~~~S~f~~~l~~~~~~~~ 1380 (1381)
T KOG0054|consen 1311 DALIQKTIREEFKDCTVLTIAHRLNTVMDSDRVLVLDAGRVVEFDSPAELLSDKDSLFSSLLKEAALSSR 1380 (1381)
T ss_pred             HHHHHHHHHHHhcCCeEEEEeeccchhhhcCeEEEeeCCeEeecCChHHHHhCCcchHHHHHHHHHHhhc
Confidence            9999999999999999999999999999999999999999999999999999999999999999887653



>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1496
2cbz_A237 Structure Of The Human Multidrug Resistance Protein 2e-57
2cbz_A237 Structure Of The Human Multidrug Resistance Protein 5e-08
4f4c_A1321 The Crystal Structure Of The Multi-Drug Transporter 4e-54
4f4c_A 1321 The Crystal Structure Of The Multi-Drug Transporter 2e-21
3g5u_A1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 4e-48
3g5u_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 2e-25
3g60_A1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 5e-48
3g60_A 1284 Structure Of P-Glycoprotein Reveals A Molecular Bas 2e-25
1q3h_A286 Mouse Cftr Nbd1 With Amp.Pnp Length = 286 2e-42
1q3h_A286 Mouse Cftr Nbd1 With Amp.Pnp Length = 286 3e-06
1r0z_A286 Phosphorylated Cystic Fibrosis Transmembrane Conduc 4e-42
1r0z_A286 Phosphorylated Cystic Fibrosis Transmembrane Conduc 2e-06
2pzg_A241 Minimal Human Cftr First Nucleotide Binding Domain 5e-42
2pzg_A241 Minimal Human Cftr First Nucleotide Binding Domain 1e-06
2pze_A229 Minimal Human Cftr First Nucleotide Binding Domain 6e-42
2pze_A229 Minimal Human Cftr First Nucleotide Binding Domain 1e-06
1xfa_A283 Structure Of Nbd1 From Murine Cftr- F508r Mutant Le 2e-41
1xfa_A283 Structure Of Nbd1 From Murine Cftr- F508r Mutant Le 6e-06
1xf9_A283 Structure Of Nbd1 From Murine Cftr- F508s Mutant Le 2e-41
1xf9_A283 Structure Of Nbd1 From Murine Cftr- F508s Mutant Le 5e-06
1xmi_A291 Crystal Structure Of Human F508a Nbd1 Domain With A 8e-41
1xmi_A291 Crystal Structure Of Human F508a Nbd1 Domain With A 4e-06
2bbo_A291 Human Nbd1 With Phe508 Length = 291 3e-40
2bbo_A291 Human Nbd1 With Phe508 Length = 291 1e-05
3si7_A285 The Crystal Structure Of The Nbd1 Domain Of The Mou 3e-40
3si7_A285 The Crystal Structure Of The Nbd1 Domain Of The Mou 2e-06
2bbt_A290 Human Deltaf508 Nbd1 With Two Solublizing Mutations 4e-40
2bbt_A290 Human Deltaf508 Nbd1 With Two Solublizing Mutations 2e-07
2bbs_A290 Human Deltaf508 Nbd1 With Three Solubilizing Mutati 4e-40
2bbs_A290 Human Deltaf508 Nbd1 With Three Solubilizing Mutati 3e-07
2pzf_A228 Minimal Human Cftr First Nucleotide Binding Domain 9e-40
2pzf_A228 Minimal Human Cftr First Nucleotide Binding Domain 7e-07
1xmj_A290 Crystal Structure Of Human Deltaf508 Human Nbd1 Dom 4e-38
1xmj_A290 Crystal Structure Of Human Deltaf508 Human Nbd1 Dom 6e-06
3qf4_B598 Crystal Structure Of A Heterodimeric Abc Transporte 2e-36
3gd7_A 390 Crystal Structure Of Human Nbd2 Complexed With N6- 3e-35
4ayt_A595 Structure Of The Human Mitochondrial Abc Transporte 6e-35
4ayw_A619 Structure Of The Human Mitochondrial Abc Transporte 1e-33
3b5x_A582 Crystal Structure Of Msba From Vibrio Cholerae Leng 1e-33
3qf4_A587 Crystal Structure Of A Heterodimeric Abc Transporte 3e-31
3b5w_A582 Crystal Structure Of Eschericia Coli Msba Length = 6e-28
3b5y_A582 Crystal Structure Of Msba From Salmonella Typhimuri 3e-27
2hyd_A578 Multidrug Abc Transporter Sav1866 Length = 578 1e-26
2hyd_A578 Multidrug Abc Transporter Sav1866 Length = 578 7e-24
2ghi_A260 Crystal Structure Of Plasmodium Yoelii Multidrug Re 3e-25
1mv5_A243 Crystal Structure Of Lmra Atp-Binding Domain Length 1e-23
2pmk_A243 Crystal Structures Of An Isolated Abc-Atpase In Com 1e-22
3b5j_A243 Crystal Structures Of The S504a Mutant Of An Isolat 2e-22
1mt0_A241 Atp-Binding Domain Of Haemolysin B From Escherichia 6e-22
2ff7_A247 The Abc-Atpase Of The Abc-Transporter Hlyb In The A 6e-22
3nh6_A306 Nucleotide Binding Domain Of Human Abcb6 (Apo Struc 1e-21
2ffb_A247 The Crystal Structure Of The Hlyb-Nbd E631q Mutant 2e-21
1xef_A241 Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI 1e-20
2ffa_A247 Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr 1e-20
1jj7_A260 Crystal Structure Of The C-Terminal Atpase Domain O 4e-17
2ixf_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 1e-15
1q1b_A381 Crystal Structure Of E. Coli Malk In The Nucleotide 2e-15
1q12_A381 Crystal Structure Of The Atp-bound E. Coli Malk Len 2e-15
4hlu_D268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 3e-15
4hlu_D268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 1e-04
2r6g_A381 The Crystal Structure Of The E. Coli Maltose Transp 4e-15
3d31_A348 Modbc From Methanosarcina Acetivorans Length = 348 6e-15
2ixg_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 2e-14
2ixe_A271 Crystal Structure Of The Atpase Domain Of Tap1 With 2e-14
2it1_A362 Structure Of Ph0203 Protein From Pyrococcus Horikos 3e-12
1l2t_A235 Dimeric Structure Of Mj0796, A Bacterial Abc Transp 4e-11
1z47_A355 Structure Of The Atpase Subunit Cysa Of The Putativ 8e-11
1z47_A355 Structure Of The Atpase Subunit Cysa Of The Putativ 1e-07
3tif_A235 Dimeric Structure Of A Post-Hydrolysis State Of The 8e-11
2nq2_C253 An Inward-Facing Conformation Of A Putative Metal-C 1e-10
2nq2_C253 An Inward-Facing Conformation Of A Putative Metal-C 1e-04
1f3o_A235 Crystal Structure Of Mj0796 Atp-Binding Cassette Le 2e-10
1oxs_C353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 2e-10
3c41_J242 Abc Protein Artp In Complex With Amp-PnpMG2+ Length 4e-10
3c41_J242 Abc Protein Artp In Complex With Amp-PnpMG2+ Length 2e-05
2olj_A263 Abc Protein Artp In Complex With AdpMG2+ Length = 2 4e-10
2olj_A263 Abc Protein Artp In Complex With AdpMG2+ Length = 2 2e-05
3fvq_A359 Crystal Structure Of The Nucleotide Binding Domain 4e-10
1oxx_K353 Crystal Structure Of Glcv, The Abc-Atpase Of The Gl 1e-09
1vci_A373 Crystal Structure Of The Atp-binding Cassette Of Mu 1e-09
1v43_A372 Crystal Structure Of Atpase Subunit Of Abc Sugar Tr 1e-09
2yyz_A359 Crystal Structure Of Sugar Abc Transporter, Atp-Bin 2e-09
1b0u_A262 Atp-Binding Subunit Of The Histidine Permease From 6e-09
4hlu_A268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 9e-09
2yz2_A266 Crystal Structure Of The Abc Transporter In The Cob 9e-09
3dhw_C343 Crystal Structure Of Methionine Importer Metni Leng 2e-08
2onk_A240 Abc Transporter Modbc In Complex With Its Binding P 4e-08
2onk_A240 Abc Transporter Modbc In Complex With Its Binding P 2e-04
1g29_1372 Malk Length = 372 5e-08
1g29_1 372 Malk Length = 372 5e-04
4g1u_C266 X-Ray Structure Of The Bacterial Heme Transporter H 5e-08
3tui_C366 Inward Facing Conformations Of The Metni Methionine 6e-08
2ihy_A279 Structure Of The Staphylococcus Aureus Putative Atp 1e-07
3tuj_C366 Inward Facing Conformations Of The Metni Methionine 3e-07
3gfo_A275 Structure Of Cbio1 From Clostridium Perfringens: Pa 1e-06
2pcj_A224 Crystal Structure Of Abc Transporter (Aq_297) From 1e-06
4fwi_B334 Crystal Structure Of The Nucleotide-binding Domain 2e-06
2d62_A375 Crystal Structure Of Multiple Sugar Binding Transpo 3e-06
1vpl_A256 Crystal Structure Of Abc Transporter Atp-binding Pr 5e-06
1sgw_A214 Putative Abc Transporter (Atp-Binding Protein) From 9e-06
3j15_B593 Model Of Ribosome-Bound Archaeal Pelota And Abce1 L 2e-05
3bk7_A607 Structure Of The Complete Abce1RNAASE-L Inhibitor P 2e-05
1ji0_A240 Crystal Structure Analysis Of The Abc Transporter F 3e-05
2pjz_A263 The Crystal Structure Of Putative Cobalt Transport 5e-05
1yqt_A538 Rnase-L Inhibitor Length = 538 1e-04
1g9x_A257 Characterization Of The Twinning Structure Of Mj126 9e-04
2vf7_A842 Crystal Structure Of Uvra2 From Deinococcus Radiodu 9e-04
>pdb|2CBZ|A Chain A, Structure Of The Human Multidrug Resistance Protein 1 Nucleotide Binding Domain 1 Length = 237 Back     alignment and structure

Iteration: 1

Score = 221 bits (563), Expect = 2e-57, Method: Compositional matrix adjust. Identities = 108/226 (47%), Positives = 150/226 (66%), Gaps = 3/226 (1%) Query: 616 TALDIVDGNFSWDISSHNPTLKDINLKVFHGMRVAVCGTVGSGKSSLLSCILGEVPKISG 675 ++ + + F+W S PTL I + G VAV G VG GKSSLLS +L E+ K+ G Sbjct: 2 NSITVRNATFTW-ARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEG 60 Query: 676 TLKLCGTKAYVAQSPWIQSGKIEDNILFGKEMNRERYNAVLDACSLKKDLEILSFGDQTV 735 + + G+ AYV Q WIQ+ + +NILFG ++ Y +V+ AC+L DLEIL GD+T Sbjct: 61 HVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTE 120 Query: 736 IGERGINLSGGQKQRIQIARALYQDSDIYLFDDPFSAVDAHTGSHLFQEVL--LGLLSSK 793 IGE+G+NLSGGQKQR+ +ARA+Y ++DIYLFDDP SAVDAH G H+F+ V+ G+L +K Sbjct: 121 IGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNK 180 Query: 794 TVIYVTHQVEFLPAADLILVMKDGKITQAGKYNDLINSGTDFMELV 839 T I VTH + +LP D+I+VM GKI++ G Y +L+ F E + Sbjct: 181 TRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFL 226
>pdb|2CBZ|A Chain A, Structure Of The Human Multidrug Resistance Protein 1 Nucleotide Binding Domain 1 Length = 237 Back     alignment and structure
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure
>pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 Back     alignment and structure
>pdb|1Q3H|A Chain A, Mouse Cftr Nbd1 With Amp.Pnp Length = 286 Back     alignment and structure
>pdb|1Q3H|A Chain A, Mouse Cftr Nbd1 With Amp.Pnp Length = 286 Back     alignment and structure
>pdb|1R0Z|A Chain A, Phosphorylated Cystic Fibrosis Transmembrane Conductance Regulator (Cftr) Nucleotide-Binding Domain One (Nbd1) With Atp Length = 286 Back     alignment and structure
>pdb|1R0Z|A Chain A, Phosphorylated Cystic Fibrosis Transmembrane Conductance Regulator (Cftr) Nucleotide-Binding Domain One (Nbd1) With Atp Length = 286 Back     alignment and structure
>pdb|2PZG|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Monomer Length = 241 Back     alignment and structure
>pdb|2PZG|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Monomer Length = 241 Back     alignment and structure
>pdb|2PZE|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer Length = 229 Back     alignment and structure
>pdb|2PZE|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer Length = 229 Back     alignment and structure
>pdb|1XFA|A Chain A, Structure Of Nbd1 From Murine Cftr- F508r Mutant Length = 283 Back     alignment and structure
>pdb|1XFA|A Chain A, Structure Of Nbd1 From Murine Cftr- F508r Mutant Length = 283 Back     alignment and structure
>pdb|1XF9|A Chain A, Structure Of Nbd1 From Murine Cftr- F508s Mutant Length = 283 Back     alignment and structure
>pdb|1XF9|A Chain A, Structure Of Nbd1 From Murine Cftr- F508s Mutant Length = 283 Back     alignment and structure
>pdb|1XMI|A Chain A, Crystal Structure Of Human F508a Nbd1 Domain With Atp Length = 291 Back     alignment and structure
>pdb|1XMI|A Chain A, Crystal Structure Of Human F508a Nbd1 Domain With Atp Length = 291 Back     alignment and structure
>pdb|2BBO|A Chain A, Human Nbd1 With Phe508 Length = 291 Back     alignment and structure
>pdb|2BBO|A Chain A, Human Nbd1 With Phe508 Length = 291 Back     alignment and structure
>pdb|3SI7|A Chain A, The Crystal Structure Of The Nbd1 Domain Of The Mouse Cftr Protein, Deltaf508 Mutant Length = 285 Back     alignment and structure
>pdb|3SI7|A Chain A, The Crystal Structure Of The Nbd1 Domain Of The Mouse Cftr Protein, Deltaf508 Mutant Length = 285 Back     alignment and structure
>pdb|2BBT|A Chain A, Human Deltaf508 Nbd1 With Two Solublizing Mutations. Length = 290 Back     alignment and structure
>pdb|2BBT|A Chain A, Human Deltaf508 Nbd1 With Two Solublizing Mutations. Length = 290 Back     alignment and structure
>pdb|2BBS|A Chain A, Human Deltaf508 Nbd1 With Three Solubilizing Mutations Length = 290 Back     alignment and structure
>pdb|2BBS|A Chain A, Human Deltaf508 Nbd1 With Three Solubilizing Mutations Length = 290 Back     alignment and structure
>pdb|2PZF|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer With Delta F508 Length = 228 Back     alignment and structure
>pdb|2PZF|A Chain A, Minimal Human Cftr First Nucleotide Binding Domain As A Head-To-Tail Dimer With Delta F508 Length = 228 Back     alignment and structure
>pdb|1XMJ|A Chain A, Crystal Structure Of Human Deltaf508 Human Nbd1 Domain With Atp Length = 290 Back     alignment and structure
>pdb|1XMJ|A Chain A, Crystal Structure Of Human Deltaf508 Human Nbd1 Domain With Atp Length = 290 Back     alignment and structure
>pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 Back     alignment and structure
>pdb|3GD7|A Chain A, Crystal Structure Of Human Nbd2 Complexed With N6- Phenylethyl-Atp (P-Atp) Length = 390 Back     alignment and structure
>pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 Back     alignment and structure
>pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 Back     alignment and structure
>pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 Back     alignment and structure
>pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 Back     alignment and structure
>pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 Back     alignment and structure
>pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 Back     alignment and structure
>pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 Back     alignment and structure
>pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 Back     alignment and structure
>pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 Back     alignment and structure
>pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 Back     alignment and structure
>pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 Back     alignment and structure
>pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 Back     alignment and structure
>pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 Back     alignment and structure
>pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 Back     alignment and structure
>pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 Back     alignment and structure
>pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 Back     alignment and structure
>pdb|1JJ7|A Chain A, Crystal Structure Of The C-Terminal Atpase Domain Of Human Tap1 Length = 260 Back     alignment and structure
>pdb|2IXF|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (D645q, Q678h Mutant) Length = 271 Back     alignment and structure
>pdb|1Q1B|A Chain A, Crystal Structure Of E. Coli Malk In The Nucleotide-Free Form Length = 381 Back     alignment and structure
>pdb|1Q12|A Chain A, Crystal Structure Of The Atp-bound E. Coli Malk Length = 381 Back     alignment and structure
>pdb|4HLU|D Chain D, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|4HLU|D Chain D, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|2R6G|A Chain A, The Crystal Structure Of The E. Coli Maltose Transporter Length = 381 Back     alignment and structure
>pdb|3D31|A Chain A, Modbc From Methanosarcina Acetivorans Length = 348 Back     alignment and structure
>pdb|2IXG|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (S621a, G622v, D645n Mutant) Length = 271 Back     alignment and structure
>pdb|2IXE|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (d645n Mutant) Length = 271 Back     alignment and structure
>pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 Back     alignment and structure
>pdb|1L2T|A Chain A, Dimeric Structure Of Mj0796, A Bacterial Abc Transporter Cassette Length = 235 Back     alignment and structure
>pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 Back     alignment and structure
>pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 Back     alignment and structure
>pdb|3TIF|A Chain A, Dimeric Structure Of A Post-Hydrolysis State Of The Atp-Binding Cassette Mj0796 Bound To Adp And Pi Length = 235 Back     alignment and structure
>pdb|2NQ2|C Chain C, An Inward-Facing Conformation Of A Putative Metal-Chelate Type Abc Transporter. Length = 253 Back     alignment and structure
>pdb|2NQ2|C Chain C, An Inward-Facing Conformation Of A Putative Metal-Chelate Type Abc Transporter. Length = 253 Back     alignment and structure
>pdb|1F3O|A Chain A, Crystal Structure Of Mj0796 Atp-Binding Cassette Length = 235 Back     alignment and structure
>pdb|1OXS|C Chain C, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 Back     alignment and structure
>pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 Back     alignment and structure
>pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 Back     alignment and structure
>pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 Back     alignment and structure
>pdb|3FVQ|A Chain A, Crystal Structure Of The Nucleotide Binding Domain Fbpc Complexed With Atp Length = 359 Back     alignment and structure
>pdb|1OXX|K Chain K, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 Back     alignment and structure
>pdb|1VCI|A Chain A, Crystal Structure Of The Atp-binding Cassette Of Multisugar Transporter From Pyrococcus Horikoshii Ot3 Complexed With Atp Length = 373 Back     alignment and structure
>pdb|1V43|A Chain A, Crystal Structure Of Atpase Subunit Of Abc Sugar Transporter Length = 372 Back     alignment and structure
>pdb|2YYZ|A Chain A, Crystal Structure Of Sugar Abc Transporter, Atp-Binding Protein Length = 359 Back     alignment and structure
>pdb|1B0U|A Chain A, Atp-Binding Subunit Of The Histidine Permease From Salmonella Typhimurium Length = 262 Back     alignment and structure
>pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|2YZ2|A Chain A, Crystal Structure Of The Abc Transporter In The Cobalt Transport System Length = 266 Back     alignment and structure
>pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 Back     alignment and structure
>pdb|2ONK|A Chain A, Abc Transporter Modbc In Complex With Its Binding Protein Moda Length = 240 Back     alignment and structure
>pdb|2ONK|A Chain A, Abc Transporter Modbc In Complex With Its Binding Protein Moda Length = 240 Back     alignment and structure
>pdb|1G29|1 Chain 1, Malk Length = 372 Back     alignment and structure
>pdb|1G29|1 Chain 1, Malk Length = 372 Back     alignment and structure
>pdb|4G1U|C Chain C, X-Ray Structure Of The Bacterial Heme Transporter Hmuuv From Yersinia Pestis Length = 266 Back     alignment and structure
>pdb|3TUI|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Cy5 Native Crystal Form Length = 366 Back     alignment and structure
>pdb|2IHY|A Chain A, Structure Of The Staphylococcus Aureus Putative Atpase Subunit Of An Atp-Binding Cassette (Abc) Transporter Length = 279 Back     alignment and structure
>pdb|3TUJ|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Dm Crystal Form Length = 366 Back     alignment and structure
>pdb|3GFO|A Chain A, Structure Of Cbio1 From Clostridium Perfringens: Part Of The Abc Transporter Complex Cbionq Length = 275 Back     alignment and structure
>pdb|2PCJ|A Chain A, Crystal Structure Of Abc Transporter (Aq_297) From Aquifex Aeolicus Vf5 Length = 224 Back     alignment and structure
>pdb|4FWI|B Chain B, Crystal Structure Of The Nucleotide-binding Domain Of A Dipeptide Abc Transporter Length = 334 Back     alignment and structure
>pdb|2D62|A Chain A, Crystal Structure Of Multiple Sugar Binding Transport Atp- Binding Protein Length = 375 Back     alignment and structure
>pdb|1VPL|A Chain A, Crystal Structure Of Abc Transporter Atp-binding Protein (tm0544) From Thermotoga Maritima At 2.10 A Resolution Length = 256 Back     alignment and structure
>pdb|1SGW|A Chain A, Putative Abc Transporter (Atp-Binding Protein) From Pyrococcus Furiosus Pfu-867808-001 Length = 214 Back     alignment and structure
>pdb|3J15|B Chain B, Model Of Ribosome-Bound Archaeal Pelota And Abce1 Length = 593 Back     alignment and structure
>pdb|3BK7|A Chain A, Structure Of The Complete Abce1RNAASE-L Inhibitor Protein From Pyrococcus Abysii Length = 607 Back     alignment and structure
>pdb|1JI0|A Chain A, Crystal Structure Analysis Of The Abc Transporter From Thermotoga Maritima Length = 240 Back     alignment and structure
>pdb|2PJZ|A Chain A, The Crystal Structure Of Putative Cobalt Transport Atp- Binding Protein (cbio-2), St1066 Length = 263 Back     alignment and structure
>pdb|1YQT|A Chain A, Rnase-L Inhibitor Length = 538 Back     alignment and structure
>pdb|1G9X|A Chain A, Characterization Of The Twinning Structure Of Mj1267, An Atp-Binding Cassette Of An Abc Transporter Length = 257 Back     alignment and structure
>pdb|2VF7|A Chain A, Crystal Structure Of Uvra2 From Deinococcus Radiodurans Length = 842 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1496
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 1e-147
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 5e-27
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 1e-135
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 3e-29
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 1e-130
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 2e-24
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 1e-130
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 5e-28
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 1e-111
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 1e-64
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 2e-78
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 6e-48
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 7e-78
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 8e-49
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 2e-77
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 1e-45
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 2e-69
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 4e-29
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 7e-67
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 5e-36
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 4e-64
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 1e-37
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 3e-59
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 1e-35
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 1e-58
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 4e-34
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 9e-58
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 5e-35
2ghi_A260 Transport protein; multidrug resistance protein, M 2e-54
2ghi_A260 Transport protein; multidrug resistance protein, M 4e-34
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 1e-47
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 2e-33
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 4e-32
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 2e-23
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 5e-30
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 2e-22
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 2e-29
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 7e-21
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 3e-28
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 9e-21
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 3e-27
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 7e-21
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 5e-23
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 2e-18
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 5e-17
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 3e-15
1sgw_A214 Putative ABC transporter; structural genomics, P p 1e-22
1sgw_A214 Putative ABC transporter; structural genomics, P p 2e-17
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 6e-22
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 1e-16
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 2e-16
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 4e-15
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 6e-22
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 5e-20
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 6e-20
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 2e-14
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 1e-21
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 2e-20
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 5e-19
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 2e-13
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 9e-21
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 4e-18
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 1e-19
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 1e-12
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 6e-19
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 4e-13
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 1e-18
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 5e-10
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 2e-18
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 8e-11
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 4e-18
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 2e-07
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 5e-18
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 4e-08
1b0u_A262 Histidine permease; ABC transporter, transport pro 6e-18
1b0u_A262 Histidine permease; ABC transporter, transport pro 3e-09
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 4e-17
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 1e-07
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 8e-17
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 1e-12
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 3e-16
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 7e-11
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 5e-16
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 6e-08
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 1e-15
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 4e-04
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 5e-15
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 2e-11
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 1e-07
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 3e-07
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 1e-05
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 2e-14
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 1e-13
1ji0_A240 ABC transporter; ATP binding protein, structural g 2e-13
1ji0_A240 ABC transporter; ATP binding protein, structural g 6e-06
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 5e-13
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-10
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-08
1g6h_A257 High-affinity branched-chain amino acid transport 2e-08
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 4e-07
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 5e-05
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
 Score =  454 bits (1169), Expect = e-147
 Identities = 87/264 (32%), Positives = 143/264 (54%), Gaps = 1/264 (0%)

Query: 1231 IEESRPNDSWPSHGKIDLLDLQVRYAPQMPLVLQGISCTFPGGEKTGIVGRTGSGKSTLI 1290
                + +D WPS G++ + DL  +Y      +L+ IS +   G++ G++GRTGSGKSTL+
Sbjct: 5    NSHVKKDDIWPSGGQMTVKDLTAKYTEGGNAILENISFSISPGQRVGLLGRTGSGKSTLL 64

Query: 1291 QTLFRIVEPAAGQILIDGIDISLIGLHDLRSRLSIIPQDPVMFEGTVRSNLDPLEESTDE 1350
                R++    G+I IDG+    I L   R    +IPQ   +F GT R NLDP    +D+
Sbjct: 65   SAFLRLLNTE-GEIQIDGVSWDSITLEQWRKAFGVIPQKVFIFSGTFRKNLDPNAAHSDQ 123

Query: 1351 QIWEALDKCQLGDEVRKKEGKLDSKVTENGENWSMGQRQLVCLGRVLLKRSKILMLDEAT 1410
            +IW+  D+  L   + +  GKLD  + + G   S G +QL+CL R +L ++KIL+LDE +
Sbjct: 124  EIWKVADEVGLRSVIEQFPGKLDFVLVDGGCVLSHGHKQLMCLARSVLSKAKILLLDEPS 183

Query: 1411 ASVDTATDNLIQQTLRQHFSDCTVLTIAHRITSVIDSDLVLLLNHGLIEEFDNPANLLEN 1470
            A +D  T  +I++TL+Q F+DCTV+    RI ++++ D  L++    + ++D+   L   
Sbjct: 184  AHLDPVTYQIIRRTLKQAFADCTVILCEARIEAMLECDQFLVIEENKVRQYDSILELYHY 243

Query: 1471 KSSSFSQLVAEYTLRSSSSFENLA 1494
             +  F          +    +  A
Sbjct: 244  PADRFVAGFIGSPKMNFLPVKVTA 267


>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Length = 359 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Length = 372 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Length = 381 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Length = 148 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1496
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 100.0
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 100.0
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 100.0
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 100.0
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 100.0
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 100.0
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 100.0
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 100.0
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 100.0
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 100.0
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 100.0
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 100.0
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 100.0
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 100.0
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 100.0
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 100.0
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 100.0
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 100.0
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 100.0
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 100.0
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 100.0
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 100.0
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 100.0
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 100.0
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 100.0
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 100.0
2ghi_A260 Transport protein; multidrug resistance protein, M 100.0
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 100.0
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 100.0
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 100.0
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 100.0
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 100.0
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 100.0
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 100.0
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 100.0
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 100.0
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 100.0
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 100.0
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 100.0
2ghi_A260 Transport protein; multidrug resistance protein, M 100.0
1ji0_A240 ABC transporter; ATP binding protein, structural g 100.0
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 100.0
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 100.0
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 100.0
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 100.0
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 100.0
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 100.0
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 100.0
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 100.0
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 100.0
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 100.0
1b0u_A262 Histidine permease; ABC transporter, transport pro 100.0
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 100.0
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 100.0
1g6h_A257 High-affinity branched-chain amino acid transport 100.0
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 100.0
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 100.0
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 100.0
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 100.0
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 100.0
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 100.0
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 100.0
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 100.0
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 100.0
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 100.0
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 100.0
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 100.0
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 100.0
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 100.0
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 100.0
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 100.0
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 100.0
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 100.0
1ji0_A240 ABC transporter; ATP binding protein, structural g 100.0
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 100.0
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 100.0
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 100.0
1b0u_A262 Histidine permease; ABC transporter, transport pro 100.0
1g6h_A257 High-affinity branched-chain amino acid transport 100.0
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 100.0
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 100.0
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 100.0
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 100.0
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 100.0
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 100.0
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 100.0
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 100.0
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 100.0
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 100.0
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 100.0
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
1sgw_A214 Putative ABC transporter; structural genomics, P p 100.0
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 100.0
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 100.0
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 100.0
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 100.0
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 100.0
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 100.0
1sgw_A214 Putative ABC transporter; structural genomics, P p 100.0
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 99.97
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 99.97
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 99.97
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.97
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.97
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.96
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 99.96
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.96
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 99.95
4aby_A415 DNA repair protein RECN; hydrolase, double strand 99.94
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 99.94
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.94
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.92
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.92
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 99.92
1e69_A322 Chromosome segregation SMC protein; structural mai 99.91
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 99.91
4aby_A415 DNA repair protein RECN; hydrolase, double strand 99.91
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 99.9
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.87
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 99.87
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 99.87
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 99.87
1e69_A322 Chromosome segregation SMC protein; structural mai 99.86
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 99.85
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 99.85
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 99.85
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 99.85
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 99.82
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 99.82
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 99.8
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 99.8
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.77
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.77
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 99.77
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 99.76
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 99.76
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 99.76
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 99.75
2ewv_A372 Twitching motility protein PILT; pilus retraction 99.75
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 99.74
2og2_A359 Putative signal recognition particle receptor; nuc 99.74
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 99.74
2eyu_A261 Twitching motility protein PILT; pilus retraction 99.73
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 99.72
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 99.72
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 99.72
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 99.72
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 99.71
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 99.71
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.71
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 99.7
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 99.7
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 99.69
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 99.68
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 99.67
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 99.66
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 99.66
2og2_A359 Putative signal recognition particle receptor; nuc 99.65
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 99.65
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 99.63
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 99.63
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 99.63
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 99.62
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 99.62
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 99.62
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 99.62
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 99.62
2eyu_A261 Twitching motility protein PILT; pilus retraction 99.61
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.6
4a74_A231 DNA repair and recombination protein RADA; hydrola 99.6
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 99.59
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 99.59
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 99.59
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 99.58
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 99.57
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 99.57
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 99.57
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 99.57
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 99.56
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 99.56
4a74_A231 DNA repair and recombination protein RADA; hydrola 99.55
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 99.55
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 99.54
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 99.53
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 99.53
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 99.53
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 99.51
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.51
3kta_B173 Chromosome segregation protein SMC; structural mai 99.49
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 99.48
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 99.48
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 99.48
2ewv_A372 Twitching motility protein PILT; pilus retraction 99.48
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 99.47
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 99.46
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 99.44
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 99.44
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 99.44
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.43
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.41
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 99.41
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 99.41
3kta_B173 Chromosome segregation protein SMC; structural mai 99.4
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 99.4
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 99.4
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 99.39
2cvh_A220 DNA repair and recombination protein RADB; filamen 99.39
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 99.38
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 99.38
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 99.37
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 99.36
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 99.35
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 99.35
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 99.34
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 99.34
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 99.34
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 99.33
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.33
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 99.29
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 99.26
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 99.26
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 99.25
2cvh_A220 DNA repair and recombination protein RADB; filamen 99.24
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 99.23
2oap_1511 GSPE-2, type II secretion system protein; hexameri 99.22
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 99.2
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 99.2
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 99.18
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 99.18
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 99.17
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 99.15
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 99.15
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 99.14
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 99.13
1p9r_A418 General secretion pathway protein E; bacterial typ 99.12
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 99.11
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 99.11
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 99.09
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 99.07
2kjq_A149 DNAA-related protein; solution structure, NESG, st 99.06
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 99.04
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 99.03
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 99.01
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.0
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 98.97
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 98.97
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.96
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 98.95
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.95
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 98.95
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.93
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 98.92
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.92
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.92
2oap_1511 GSPE-2, type II secretion system protein; hexameri 98.91
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 98.89
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 98.87
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 98.87
1p9r_A418 General secretion pathway protein E; bacterial typ 98.86
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 98.85
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.84
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.83
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 98.82
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 98.77
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.76
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 98.76
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 98.75
1vma_A306 Cell division protein FTSY; TM0570, structural gen 98.75
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 98.72
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.71
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 98.69
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 98.68
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 98.65
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 98.63
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 98.61
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 98.59
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.55
2ius_A 512 DNA translocase FTSK; nucleotide-binding, chromoso 98.54
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 98.53
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 98.51
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 98.49
1vma_A306 Cell division protein FTSY; TM0570, structural gen 98.48
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.47
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 98.47
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 98.47
2r6a_A454 DNAB helicase, replicative helicase; replication, 98.47
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 98.46
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 98.46
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 98.46
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 98.45
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 98.4
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 98.38
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 98.38
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 98.38
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.37
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 98.36
2r6a_A454 DNAB helicase, replicative helicase; replication, 98.32
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.28
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 98.27
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 98.27
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 98.24
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.22
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 98.22
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 98.2
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.15
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.15
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 98.12
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.11
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 98.08
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 98.05
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 98.04
3kta_A182 Chromosome segregation protein SMC; structural mai 98.03
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 98.03
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 98.02
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 98.01
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 98.0
3kta_A182 Chromosome segregation protein SMC; structural mai 98.0
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.99
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 97.99
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.97
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 97.94
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 97.93
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 97.91
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 97.9
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.87
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 97.86
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 97.86
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 97.86
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 97.8
2z43_A324 DNA repair and recombination protein RADA; archaea 97.8
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 97.8
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 97.78
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 97.78
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.77
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 97.76
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.71
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.7
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.66
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.65
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 97.65
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.65
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 97.65
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 97.63
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 97.63
3ice_A422 Transcription termination factor RHO; transcriptio 97.63
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 97.62
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.62
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 97.61
2dy1_A665 Elongation factor G; translocation, GTP complex, s 97.57
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 97.53
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 97.51
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.5
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 97.49
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 97.46
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 97.45
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.44
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.42
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.37
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 97.35
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 97.35
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 97.34
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.28
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.27
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 97.25
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 97.25
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 97.22
2z43_A324 DNA repair and recombination protein RADA; archaea 97.17
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 97.16
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 97.14
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 97.14
3lxx_A239 GTPase IMAP family member 4; structural genomics c 97.1
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 97.1
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 97.09
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.07
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 97.06
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 97.04
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.03
2www_A349 Methylmalonic aciduria type A protein, mitochondri 97.03
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 97.01
3lxx_A239 GTPase IMAP family member 4; structural genomics c 97.0
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 96.99
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 96.93
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.92
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 96.91
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 96.88
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.87
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 96.86
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 96.85
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 96.8
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.8
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 96.8
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 96.79
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 96.78
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 96.76
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 96.76
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 96.71
1u94_A356 RECA protein, recombinase A; homologous recombinat 96.68
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 96.66
3ice_A422 Transcription termination factor RHO; transcriptio 96.61
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 96.58
3r20_A233 Cytidylate kinase; structural genomics, seattle st 96.57
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 96.55
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 96.54
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 96.54
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 96.53
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 96.5
1kag_A173 SKI, shikimate kinase I; transferase, structural g 96.5
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 96.46
2wji_A165 Ferrous iron transport protein B homolog; membrane 96.46
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 96.45
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 96.42
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 96.41
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 96.41
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 96.39
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 96.38
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.37
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 96.37
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.35
1kag_A173 SKI, shikimate kinase I; transferase, structural g 96.33
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.31
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 96.28
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 96.27
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 96.24
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.2
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 96.17
3bos_A242 Putative DNA replication factor; P-loop containing 96.16
2wji_A165 Ferrous iron transport protein B homolog; membrane 96.15
3lxw_A247 GTPase IMAP family member 1; immunity, structural 96.15
1u94_A356 RECA protein, recombinase A; homologous recombinat 96.14
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.13
3bos_A242 Putative DNA replication factor; P-loop containing 96.11
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 96.11
2www_A349 Methylmalonic aciduria type A protein, mitochondri 96.09
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 96.08
3lxw_A247 GTPase IMAP family member 1; immunity, structural 96.08
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.06
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 96.04
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.0
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 95.96
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 95.96
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 95.94
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 95.92
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 95.92
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 95.92
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 95.9
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 95.85
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 95.84
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 95.66
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 95.61
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 95.6
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 95.59
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 95.57
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 95.5
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 95.5
1jal_A 363 YCHF protein; nucleotide-binding fold, structural 95.45
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 95.44
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 95.4
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 95.38
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 95.31
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 95.3
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 95.29
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 95.25
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.15
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 95.15
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 95.13
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 95.1
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 95.09
1xp8_A366 RECA protein, recombinase A; recombination, radior 95.03
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 95.0
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 94.99
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 94.96
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 94.95
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 94.94
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 94.91
2qgz_A308 Helicase loader, putative primosome component; str 94.89
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 94.8
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 94.8
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 94.78
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 94.72
2v1u_A387 Cell division control protein 6 homolog; DNA repli 94.71
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 94.58
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 94.53
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 94.52
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 94.51
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 94.43
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 94.31
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 94.28
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 94.26
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 94.17
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 94.14
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 94.13
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 94.07
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 94.04
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 94.04
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 94.0
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 93.97
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 93.97
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 93.96
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 93.95
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
Probab=100.00  E-value=2.2e-171  Score=1748.59  Aligned_cols=1233  Identities=19%  Similarity=0.228  Sum_probs=927.9

Q ss_pred             HHccc-cCCCCCCCCCCCCCCCcHhHHHHHHHHHHhhccCC-----------CCCCchhhHHHHHHHH-hHHHHHHHHHH
Q 039402          243 IALGN-KKTLDLEDVPQLDSGDSVSGAFANFKNKLETEGGV-----------GSGLTTVKLIKAMFCS-VWKDVLVTGFL  309 (1496)
Q Consensus       243 ~~~g~-~~~L~~~Dl~~l~~~~~~~~~~~~f~~~w~~~~~~-----------~~~~~~~~l~~al~~~-~~~~~~~~~~~  309 (1496)
                      ++.|. +++|+.+|.+.+.|+|..+...+.+++.|......           +...++.+ ++.++|. -+++.++.++-
T Consensus         2 ~r~~~~~~~l~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~-~~~Lfrya~~~d~~l~~~g   80 (1321)
T 4f4c_A            2 LRNGSLRQSLRTLDSFSLAPEDVLKTAIKTVEDYEGDNIDSNGEIKITRDAKEEVVNKVS-IPQLYRYTTTLEKLLLFIG   80 (1321)
T ss_dssp             --CHHHHHHHHHHHHTCCCHHHHHHHHHHHHHTTSTTTBCSSSCBCCSCC---CCSSCCC-HHHHTTTCCHHHHHHHHHH
T ss_pred             CCCchhhcCCcccccccCCchhhcccccchhhhhcccccccccccchhhhhhhcccCCCC-HHHHhhccChHHHHHHHHH
Confidence            44444 45799999999999999999999998887553210           00111223 3345542 13333333332


Q ss_pred             HHHHHHHHHHHH---HHHHHHHHHhcCC-------C--------Cc-----chhHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 039402          310 TVLYTLASYVGP---YLIDTFVQYLNGR-------R--------DF-----ENEGYVLVSAFCVAKLVECLCQRFRVFRL  366 (1496)
Q Consensus       310 ~l~~~~~~~~~P---~ll~~~i~~~~~~-------~--------~~-----~~~g~~l~~~l~~~~~~~~l~~~~~~~~~  366 (1496)
                      .++..+...+.|   ++++++++.+.+.       .        ..     ......++..++...+...++.....+..
T Consensus        81 ~~~a~~~G~~~p~~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~~~~~~~~  160 (1321)
T 4f4c_A           81 TLVAVITGAGLPLMSILQGKVSQAFINEQIVINNNGSTFLPTGQNYTKTDFEHDVMNVVWSYAAMTVGMWAAGQITVTCY  160 (1321)
T ss_dssp             HHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHTTSCBCSSTTCBCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhcccccccccccccccccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            333333344444   4555665543210       0        00     01111222233333333444444455555


Q ss_pred             HHHHHHHHHHHHHHHHHHHhcCCcchhcCCCHHHHHHHHHHHHHHHHHHH-HHhhHHHHHHHHHHHHHHHHHHHhHHHHH
Q 039402          367 QQLGIRMRAALIAMIYNKGLTLSSQAKQGQSSGEIINFMTVDAERVADFS-WYIHDPWLVLFEVALSILILYKNLGIASL  445 (1496)
Q Consensus       367 ~~~~~~ir~~L~~~iy~K~L~ls~~~~~~~~~G~i~nl~s~D~~~i~~~~-~~~~~~~~~pl~i~~~~~lL~~~lg~~~l  445 (1496)
                      ...|.|+-..++..+|+|.++++...++++++|+++|++++|++++++++ ..+..++..++.++.++++++..-...++
T Consensus       161 ~~~~~r~~~~lR~~~~~~ll~~~~~~fd~~~~G~l~sr~~~D~~~i~~~~~~~l~~~~~~~~~~i~~~i~~~~~~~~l~l  240 (1321)
T 4f4c_A          161 LYVAEQMNNRLRREFVKSILRQEISWFDTNHSGTLATKLFDNLERVKEGTGDKIGMAFQYLSQFITGFIVAFTHSWQLTL  240 (1321)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTSCHHHHHHTCCTTHHHHHHHHHHHHHHTSSHHHHHHHHHHHHHHHHHHHHHHHCHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCHHHHCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            66777777788888999999999999999999999999999999999975 45778888888888888877766555667


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHhCcHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 039402          446 AALFGTVIVMLVNIPLGRVQENFQDKLMKSKDERMKATSEILRNMRILKLQGWEMKFLSKIINLRKRETGWLKKYVYTSA  525 (1496)
Q Consensus       446 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~R~~~~~E~L~~ir~IK~~~wE~~~~~~i~~~R~~E~~~l~~~~~~~~  525 (1496)
                      +.++++++++++...+.+...+..++.++..+++.+.++|.++|||+||+|+||+.+.+++.+..++..+...+......
T Consensus       241 v~l~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~l~gi~~ik~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~  320 (1321)
T 4f4c_A          241 VMLAVTPIQALCGFAIAKSMSTFAIRETLRYAKAGKVVEETISSIRTVVSLNGLRYELERYSTAVEEAKKAGVLKGLFLG  320 (1321)
T ss_dssp             HHHTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHTTCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHhcccHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            77777777778888899999999999999999999999999999999999999999999988776666555544444444


Q ss_pred             HHHHHHHHHH--HHHHHHHHHHHHHhcCCcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCC
Q 039402          526 ISSFVFWGAP--TFVSVATFGTCILLNVPLESGKMLSAIATFRLLQVPIYNLPDVISMIIQTKVSLQRIASFFCLDDLQP  603 (1496)
Q Consensus       526 ~~~~~~~~~p--~~v~~~~f~~~~~~~~~L~~~~vft~l~l~~~l~~pl~~lp~~i~~~~~a~vs~~Ri~~fL~~~e~~~  603 (1496)
                      ..........  .++.+++++++.+.++.+++|.+++++.++..+..|+..++..+..+.++.+|++||.+|++.++..+
T Consensus       321 ~~~~~~~~~~~~~~~~~~~~g~~~v~~g~lt~g~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~s~~ri~~~l~~~~~~~  400 (1321)
T 4f4c_A          321 ISFGAMQASNFISFALAFYIGVGWVHDGSLNFGDMLTTFSSVMMGSMALGLAGPQLAVLGTAQGAASGIYEVLDRKPVID  400 (1321)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHTTTSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTSCCSS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHcCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCcccc
Confidence            3333332222  23445567778888999999999999999999999999999999999999999999999998765432


Q ss_pred             cccc-CCCCCCCCccEEEEeeEEEecCCCCCCceeeeeEEEeCCcEEEEEecCCCcHHHHHHHHhcCCCCCccEEEEcC-
Q 039402          604 DLVE-KQPSGSSETALDIVDGNFSWDISSHNPTLKDINLKVFHGMRVAVCGTVGSGKSSLLSCILGEVPKISGTLKLCG-  681 (1496)
Q Consensus       604 ~~~~-~~~~~~~~~~i~~~~~~~~~~~~~~~~~L~~i~l~i~~G~~~~ivG~~GsGKSTLl~~ilG~~~~~~G~i~~~g-  681 (1496)
                      +... ..+.......|+++|++|+|+..+++++|+|+||+|++||++|||||+|||||||+++|+|+++|++|+|.++| 
T Consensus       401 ~~~~~~~~~~~~~g~I~~~nvsF~Y~~~~~~~vL~~isl~i~~G~~vaivG~sGsGKSTll~ll~~~~~~~~G~I~idG~  480 (1321)
T 4f4c_A          401 SSSKAGRKDMKIKGDITVENVHFTYPSRPDVPILRGMNLRVNAGQTVALVGSSGCGKSTIISLLLRYYDVLKGKITIDGV  480 (1321)
T ss_dssp             CSSSCCCCCCCCCCCEEEEEEEECCSSSTTSCSEEEEEEEECTTCEEEEEECSSSCHHHHHHHHTTSSCCSEEEEEETTE
T ss_pred             ccccccccCCCCCCcEEEEEeeeeCCCCCCCceeeceEEeecCCcEEEEEecCCCcHHHHHHHhccccccccCcccCCCc
Confidence            2211 11122234579999999999866678999999999999999999999999999999999999999999999999 


Q ss_pred             ------------eeEEEccCCccCCCcHHHHhccCCC-CCHHHHHHHHHHhchhhHHHhccCCCcccccCCCCCCChHHH
Q 039402          682 ------------TKAYVAQSPWIQSGKIEDNILFGKE-MNRERYNAVLDACSLKKDLEILSFGDQTVIGERGINLSGGQK  748 (1496)
Q Consensus       682 ------------~~~yv~Q~~~i~~~ti~eNI~~g~~-~~~~~~~~v~~~~~l~~d~~~l~~g~~t~ig~~g~~LSGGQk  748 (1496)
                                  ++|||+|+||+|++||||||+||.+ .+++++.++++.|++++|++.+|+|++|+|||+|.+||||||
T Consensus       481 ~i~~~~~~~lr~~i~~v~Q~~~Lf~~TI~eNI~~g~~~~~~~~v~~a~~~a~l~~~i~~lp~G~~T~vGe~G~~LSGGQk  560 (1321)
T 4f4c_A          481 DVRDINLEFLRKNVAVVSQEPALFNCTIEENISLGKEGITREEMVAACKMANAEKFIKTLPNGYNTLVGDRGTQLSGGQK  560 (1321)
T ss_dssp             ETTTSCHHHHHHHEEEECSSCCCCSEEHHHHHHTTCTTCCHHHHHHHHHHTTCHHHHHHSTTTTSSEESSSSCCCCHHHH
T ss_pred             cchhccHHHHhhcccccCCcceeeCCchhHHHhhhcccchHHHHHHHHHHccchhHHHcCCCCCccEecCCCCCCCHHHH
Confidence                        4799999999999999999999986 789999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHccCCCEEEEecCCCCCCHHHHHHHHHHHHHHHhCCcEEEEEccCcCccccCCEEEEEeCCeEEEecChHHH
Q 039402          749 QRIQIARALYQDSDIYLFDDPFSAVDAHTGSHLFQEVLLGLLSSKTVIYVTHQVEFLPAADLILVMKDGKITQAGKYNDL  828 (1496)
Q Consensus       749 qRv~LARAl~~~~~illLDep~saLD~~~~~~i~~~~~~~~~~~~tvilvtH~~~~l~~~d~i~~l~~G~i~~~G~~~~l  828 (1496)
                      |||+||||+|+||+||||||||||||+++++ ++++++.++.+|||+|+|||+++.++.||+|++|++|+|+++|+|+||
T Consensus       561 QRiaiARAl~~~~~IliLDE~tSaLD~~te~-~i~~~l~~~~~~~T~iiiaHrls~i~~aD~Iivl~~G~ive~Gth~eL  639 (1321)
T 4f4c_A          561 QRIAIARALVRNPKILLLDEATSALDAESEG-IVQQALDKAAKGRTTIIIAHRLSTIRNADLIISCKNGQVVEVGDHRAL  639 (1321)
T ss_dssp             HHHHHHHHHTTCCSEEEEESTTTTSCTTTHH-HHHHHHHHHHTTSEEEEECSCTTTTTTCSEEEEEETTEEEEEECHHHH
T ss_pred             HHHHHHHHHccCCCEEEEecccccCCHHHHH-HHHHHHHHHhCCCEEEEEcccHHHHHhCCEEEEeeCCeeeccCCHHHH
Confidence            9999999999999999999999999999855 556788888999999999999999999999999999999999999999


Q ss_pred             HhcCcchHHHHHHhHHHHhhhCCCCCCCCccCC--CCCCCCccccccc--hhhhcc-ccCC------C-Cchhhhhh---
Q 039402          829 INSGTDFMELVGAHEQALLALGSIEGRPASERA--SGENGGTVIANRI--VKEVEN-NKGQ------N-DKADEVAV---  893 (1496)
Q Consensus       829 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~--~~~~~~-~~~~------~-~~~~~~~~---  893 (1496)
                      ++.++.|.+++..+..........+.....+..  .............  .++... .+..      + ...++++.   
T Consensus       640 ~~~~g~y~~l~~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  719 (1321)
T 4f4c_A          640 MAQQGLYYDLVTAQTFTDAVDSAAEGKFSRENSVARQTSEHEGLSRQASEMDDIMNRVRSSTIGSITNGPVIDEKEERIG  719 (1321)
T ss_dssp             HTTTCHHHHHHHHHHHHHHHHHHHCC--------------------------------------------------CCCC
T ss_pred             HHhhhHHHHHHHhhhcccccccccccccccccccccccccccccccccccccchhhhhhccccccccCCcchhHHHhhcc
Confidence            999999999987654322111000000000000  0000000000000  000000 0000      0 00000000   


Q ss_pred             -hccchhHHHHHhhccchHHHHHHHHHHhhhhh-HHHHHHHHHHHHHHHHHHhhhHHHhhcCC-C-CCCCCcccchHHHH
Q 039402          894 -SKGQLVQEEEREKGKVGFSVYWKYITTAFGGA-LVPFILLAQTLFQILQIASNYWIVWATPG-T-KDVKPVVTGSTLLI  969 (1496)
Q Consensus       894 -~~~~~~~~e~~~~g~v~~~~y~~y~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~wl~~~~~~-~-~~~~~~~~~~~~l~  969 (1496)
                       ......+++.++.|......|+.| ....+.+ .+.+.+++.++.........+|+.+|... . ..........+|..
T Consensus       720 ~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  798 (1321)
T 4f4c_A          720 KDALSRLKQELEENNAQKTNLFEIL-YHARPHALSLFIGMSTATIGGFIYPTYSVFFTSFMNVFAGNPADFLSQGHFWAL  798 (1321)
T ss_dssp             CCHHHHHHHTTTTSCCCCCCHHHHH-HHTGGGHHHHHHHHHHHHHGGGHHHHHHHHHHHHHHHTSSCSSTTTTTHHHHHH
T ss_pred             chhHHHHHHHHHHcCCcceeHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCchhhhhHHHHHHH
Confidence             000111222233333333333322 2222322 22222222222222222233333322111 0 11112233457788


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCccccccc--cCchhHHHHHhhhHHHHHhhhhHHHHHHH
Q 039402          970 VYVALAVGSSFCVLARSTLLATAGYKTATLLFNEMHYCIFRAPMSFFDA--TPSGRIINRASTDQSAADLGIPSLVGAYA 1047 (1496)
Q Consensus       970 vy~~l~~~~~~~~~~~~~~~~~~~~~~s~~l~~~ll~~ll~ap~~ffd~--tp~GrIlnR~s~D~~~vd~~l~~~~~~~~ 1047 (1496)
                      +|++++++..++.+++.++....+.++++++|.+++++++++|++|||+  +|+|+|+||+++|++.+|..++..+..++
T Consensus       799 ~~~~l~~~~~i~~~~~~~~~~~~~~~~~~~lr~~l~~~il~~~~~ffd~~~~~~G~i~~r~s~D~~~i~~~l~~~l~~~~  878 (1321)
T 4f4c_A          799 MFLVLAAAQGICSFLMTFFMGIASESLTRDLRNKLFRNVLSQHIGFFDSPQNASGKISTRLATDVPNLRTAIDFRFSTVI  878 (1321)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSCSSSTTSGGGCHHHHHHHHHTHHHHHHTTTSHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCchhhccCCCChHHHHhcchhhHHHHHHHHHHHHHHHH
Confidence            8999999999999999999999999999999999999999999999996  89999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhchHHHHHHHhhcchHHHHHhccHHHHH
Q 039402         1048 FSIIRILGTIAVMSQVAWQVFIVFVPAVGSCIWYQQYYISSARELSRLVGVCKAPVIQHFAETVSGSTTIRSFDQESRFR 1127 (1496)
Q Consensus      1048 ~~~~~~l~~~~~~~~~~~~~~~~~ip~~~l~~~~~~~y~~~~r~l~rl~~~~~sp~~~~~~Etl~G~~tIRaf~~~~~f~ 1127 (1496)
                      ..++.+++.++++++.+|++.++++++++++++...++.+..+...+......++...++.|+++|+.|||+|++|++|.
T Consensus       879 ~~~~~~i~~~~~~~~~~~~l~lv~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~l~gi~tIra~~~e~~~~  958 (1321)
T 4f4c_A          879 TTLVSMVAGIGLAFFYGWQMALLIIAILPIVAFGQYLRGRRFTGKNVKSASEFADSGKIAIEAIENVRTVQALAREDTFY  958 (1321)
T ss_dssp             HHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHTSCCSSCSTTTSSHHHHHHHHHHHHHHTHHHHHHTTTHHHHH
T ss_pred             HHhhhHHHHeeeehHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHhccchHHHH
Confidence            99999999999999999999888777777766666555544333333334445666788899999999999999999999


Q ss_pred             HHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHhc--CCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q 039402         1128 DRNMKLMDEYSRPTFHIAAAMEWLGLRLDMLSSITFAFTLVFL-ISIP--KGFIDPAIAGLAVTYGLTLNTLLATLIWFA 1204 (1496)
Q Consensus      1128 ~~~~~~~d~~~~~~~~~~~~~~wl~~rl~~l~~~~~~~~~~~~-~~~~--~g~~~~g~~gl~l~y~l~l~~~l~~~i~~~ 1204 (1496)
                      +++.+..+.+.+..+.....+.+.......+..+..+++..+. ....  ...++++.+..++.+.......+.++...+
T Consensus       959 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~lv~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~ 1038 (1321)
T 4f4c_A          959 ENFCEKLDIPHKEAIKEAFIQGLSYGCASSVLYLLNTCAYRMGLALIITDPPTMQPMRVLRVMYAITISTSTLGFATSYF 1038 (1321)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHTTSSSSCSSCHHHHHHHHHHHHTTTSSTTGGGGHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHhcCccccchHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999888776655555444433333333322222221 1222  233455444444444444455667788888


Q ss_pred             HHHHHhHhHHHHHHHhhcCCCCCCCCccCCCCCCCCCCcceEEEEeEEeEeCCCC-CccceeeeEEeeCCcEEEEEcCCC
Q 039402         1205 CDLENKIISVERIFQYTCIPSEPPLAIEESRPNDSWPSHGKIDLLDLQVRYAPQM-PLVLQGISCTFPGGEKTGIVGRTG 1283 (1496)
Q Consensus      1205 ~~le~~~~sveRi~~~~~~~~E~~~~~~~~~~~~~wp~~g~I~f~nvs~~Y~~~~-~~vLk~iS~~I~~GekvgIVGrTG 1283 (1496)
                      .++++.+.+++|+.++.+.++|.+   +...+++.||..|.|+|+||+|+|+++. .+|||||||+|+||||||||||||
T Consensus      1039 ~~~~~~~~a~~ri~~~l~~~~~~~---~~~~~~~~~~~~g~I~f~nVsf~Y~~~~~~~VL~~isl~I~~Ge~vaIVG~SG 1115 (1321)
T 4f4c_A         1039 PEYAKATFAGGIIFGMLRKISKID---SLSLAGEKKKLYGKVIFKNVRFAYPERPEIEILKGLSFSVEPGQTLALVGPSG 1115 (1321)
T ss_dssp             HHHHHHHHHHHHHHHHHHCCCSSC---TTCCCSBCCCCCCCEEEEEEEECCTTSCSSCSEEEEEEEECTTCEEEEECSTT
T ss_pred             HHHHHHHHHHHHHHHHhhCcccCC---CccCCCCCCCCCCeEEEEEEEEeCCCCCCCccccceeEEECCCCEEEEECCCC
Confidence            999999999999999998776643   2344567799999999999999997543 369999999999999999999999


Q ss_pred             CCHHHHHHHHhcccCCCccEEEECCeeCCCCChHHHhcccEEEcccccccccchhhcc----CCCCCCcHHHHHHHHHHc
Q 039402         1284 SGKSTLIQTLFRIVEPAAGQILIDGIDISLIGLHDLRSRLSIIPQDPVMFEGTVRSNL----DPLEESTDEQIWEALDKC 1359 (1496)
Q Consensus      1284 SGKSTLl~~L~rl~ep~~G~I~IDG~dI~~i~l~~LR~~i~iIpQdp~LF~gTIR~NL----dp~~~~sd~eI~~aL~~~ 1359 (1496)
                      ||||||+++|+|+|+|++|+|+|||+||+++++++||++|++|||||+||+||||+||    || ++++|+|||+||++|
T Consensus      1116 sGKSTL~~lL~rl~~p~~G~I~iDG~di~~i~~~~lR~~i~~V~Qdp~LF~gTIreNI~~gld~-~~~sd~ei~~Al~~a 1194 (1321)
T 4f4c_A         1116 CGKSTVVALLERFYDTLGGEIFIDGSEIKTLNPEHTRSQIAIVSQEPTLFDCSIAENIIYGLDP-SSVTMAQVEEAARLA 1194 (1321)
T ss_dssp             SSTTSHHHHHTTSSCCSSSEEEETTEETTTBCHHHHHTTEEEECSSCCCCSEEHHHHHSSSSCT-TTSCHHHHHHHHHHT
T ss_pred             ChHHHHHHHHhcCccCCCCEEEECCEEhhhCCHHHHHhheEEECCCCEeeCccHHHHHhccCCC-CCCCHHHHHHHHHHh
Confidence            9999999999999999999999999999999999999999999999999999999996    44 578999999999999


Q ss_pred             CCcHHHHhccCCcccccccCCCCCCchHHHHHHHHHHHccCCCEEEEEcCCCCCCHHHHHHHHHHHHHhcCCcEEEEEcc
Q 039402         1360 QLGDEVRKKEGKLDSKVTENGENWSMGQRQLVCLGRVLLKRSKILMLDEATASVDTATDNLIQQTLRQHFSDCTVLTIAH 1439 (1496)
Q Consensus      1360 ~L~~~i~~lp~gLdt~v~e~G~nLS~GQrQll~LARALLr~~~ILiLDEaTsslD~~Td~~Iq~~I~~~f~~~TVI~IAH 1439 (1496)
                      +++|+|.++|+||||+|||+|.|||||||||+||||||||+|+|||||||||+||++||+.||++|++.+++||||+|||
T Consensus      1195 ~l~~~I~~Lp~GldT~vge~G~~LSgGQrQriaiARAllr~~~ILiLDEaTSaLD~~tE~~Iq~~l~~~~~~~TvI~IAH 1274 (1321)
T 4f4c_A         1195 NIHNFIAELPEGFETRVGDRGTQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEKVVQEALDRAREGRTCIVIAH 1274 (1321)
T ss_dssp             TCHHHHHTSTTTTCSEETTTSCSSCHHHHHHHHHHHHHHSCCSEEEEESCCCSTTSHHHHHHHHHHTTTSSSSEEEEECS
T ss_pred             CChHHHHcCcCCCCCEecCCCcccCHHHHHHHHHHHHHHhCCCEEEEeCccccCCHHHHHHHHHHHHHHcCCCEEEEecc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcchhcccCEEEEEeCCeEeEecChhhHhhcCCcHHHHHHHHHh
Q 039402         1440 RITSVIDSDLVLLLNHGLIEEFDNPANLLENKSSSFSQLVAEYT 1483 (1496)
Q Consensus      1440 Rl~ti~~~DrIlVL~~G~IvE~g~p~~Ll~~~~s~F~~l~~~~~ 1483 (1496)
                      |++||++||||+|||+|+|+|+|+|+||+++ +|.|++|++++.
T Consensus      1275 RLsTi~~aD~I~Vld~G~IvE~Gth~eLl~~-~g~y~~L~~~Q~ 1317 (1321)
T 4f4c_A         1275 RLNTVMNADCIAVVSNGTIIEKGTHTQLMSE-KGAYYKLTQKQM 1317 (1321)
T ss_dssp             SSSTTTTCSEEEEESSSSEEEEECHHHHHHC-C-----------
T ss_pred             CHHHHHhCCEEEEEECCEEEEECCHHHHHhC-CcHHHHHHHHHH
Confidence            9999999999999999999999999999986 689999998654



>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1496
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 4e-69
d2hyda1255 c.37.1.12 (A:324-578) Putative multidrug export AT 3e-58
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 3e-66
d1r0wa_281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 2e-54
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 2e-65
d3b60a1253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 3e-56
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 5e-62
d2pmka1241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 1e-47
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 1e-59
d1jj7a_251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 3e-51
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 8e-57
d1mv5a_242 c.37.1.12 (A:) Multidrug resistance ABC transporte 2e-49
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 8e-33
d1b0ua_258 c.37.1.12 (A:) ATP-binding subunit of the histidin 2e-26
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 2e-32
d1v43a3239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 2e-30
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 8e-32
d3dhwc1240 c.37.1.12 (C:1-240) Methionine import ATP-binding 5e-25
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 4e-31
d1l2ta_230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 6e-31
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 1e-29
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 1e-24
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 3e-28
d1sgwa_200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 2e-24
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 3e-28
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 3e-26
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 1e-26
d1g2912240 c.37.1.12 (1:1-240) Maltose transport protein MalK 3e-25
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 1e-26
d1ji0a_240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 4e-25
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 3e-26
d1vpla_238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 8e-24
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 5e-26
d2awna2232 c.37.1.12 (A:4-235) Maltose transport protein MalK 1e-25
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 3e-24
d1oxxk2242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 1e-21
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 3e-24
d3d31a2229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 2e-23
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 6e-23
d2onka1240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 4e-21
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 2e-17
d1ye8a1178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 2e-13
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 5e-10
d2hyda2323 f.37.1.1 (A:1-323) Putative multidrug export ATP-b 7e-07
g1ii8.1369 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 9e-07
g1f2t.1292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 3e-06
d3b60a2319 f.37.1.1 (A:10-328) Multidrug resistance ABC trans 7e-04
d1w1wa_427 c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac 0.003
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative multidrug export ATP-binding/permease protein SAV1866
species: Staphylococcus aureus [TaxId: 1280]
 Score =  230 bits (589), Expect = 4e-69
 Identities = 75/258 (29%), Positives = 135/258 (52%), Gaps = 12/258 (4%)

Query: 1224 PSEPPLAIEESRPNDSWPSHGKIDLLDLQVRYAPQMPLVLQGISCTFPGGEKTGIVGRTG 1283
                P+ I++          G+ID+  +  +Y      +L+ I+ +   GE    VG +G
Sbjct: 5    VGAQPIEIKQ----------GRIDIDHVSFQYNDNEAPILKDINLSIEKGETVAFVGMSG 54

Query: 1284 SGKSTLIQTLFRIVEPAAGQILIDGIDISLIGLHDLRSRLSIIPQDPVMFEGTVRSNL-D 1342
             GKSTLI  + R  +  +GQILIDG +I       LR+++ ++ QD ++F  TV+ N+  
Sbjct: 55   GGKSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLRNQIGLVQQDNILFSDTVKENILL 114

Query: 1343 PLEESTDEQIWEALDKCQLGDEVRKKEGKLDSKVTENGENWSMGQRQLVCLGRVLLKRSK 1402
                +TDE++ EA       D +       D++V E G   S GQ+Q + + R+ L    
Sbjct: 115  GRPTATDEEVVEAAKMANAHDFIMNLPQGYDTEVGERGVKLSGGQKQRLSIARIFLNNPP 174

Query: 1403 ILMLDEATASVDTATDNLIQQTLRQHFSDCTVLTIAHRITSVIDSDLVLLLNHGLIEEFD 1462
            IL+LDEAT+++D  ++++IQ+ L     D T L +AHR++++  +D ++++ +G I E  
Sbjct: 175  ILILDEATSALDLESESIIQEALDVLSKDRTTLIVAHRLSTITHADKIVVIENGHIVETG 234

Query: 1463 NPANLLENKSSSFSQLVA 1480
                L+  +  ++  L +
Sbjct: 235  THRELIAKQ-GAYEHLYS 251


>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 323 Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 319 Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1496
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 100.0
d2hyda1255 Putative multidrug export ATP-binding/permease pro 100.0
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 100.0
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 100.0
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 100.0
d2awna2232 Maltose transport protein MalK, N-terminal domain 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 100.0
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 100.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 100.0
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 100.0
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 100.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 100.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 100.0
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 100.0
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 100.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 100.0
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 100.0
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 100.0
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 100.0
d3b60a2319 Multidrug resistance ABC transporter MsbA, N-termi 99.9
d2hyda2323 Putative multidrug export ATP-binding/permease pro 99.9
d3b60a2319 Multidrug resistance ABC transporter MsbA, N-termi 99.88
d2hyda2323 Putative multidrug export ATP-binding/permease pro 99.85
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.71
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.69
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.65
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.5
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.35
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.3
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 99.07
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 98.87
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 98.67
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 98.55
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 98.38
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 98.16
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.43
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 97.35
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 97.02
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 96.87
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.8
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.68
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 96.4
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.39
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.21
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.14
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 96.12
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 95.94
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.92
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 95.82
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.77
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.77
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.73
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.72
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.72
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 95.71
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.61
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 95.61
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.57
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 95.52
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 95.45
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.41
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.41
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.22
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.17
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.16
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.14
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 95.1
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 95.05
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 94.97
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 94.96
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.96
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 94.94
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 94.91
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 94.91
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 94.89
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.83
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 94.81
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 94.81
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.78
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 94.74
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 94.74
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 94.73
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.73
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 94.72
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 94.7
d1j8yf2211 GTPase domain of the signal sequence recognition p 94.65
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 94.65
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 94.64
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 94.61
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 94.6
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 94.6
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 94.52
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 94.51
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 94.48
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 94.44
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 94.39
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.37
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 94.35
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 94.32
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 94.26
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 94.25
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 94.25
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 94.24
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 94.21
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.2
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.16
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.14
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.13
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 94.11
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.11
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 94.1
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 94.08
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.04
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 93.97
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 93.94
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 93.86
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.84
d1okkd2207 GTPase domain of the signal recognition particle r 93.82
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 93.78
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 93.72
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 93.64
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 93.62
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 93.62
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 93.55
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 93.49
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 93.48
d1nrjb_209 Signal recognition particle receptor beta-subunit 93.45
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 93.44
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 93.38
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 93.36
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 93.3
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 93.29
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 93.24
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 93.23
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 93.21
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 93.13
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 93.11
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 93.1
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 93.09
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 92.97
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 92.97
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 92.96
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 92.92
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 92.84
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 92.83
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 92.82
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.79
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.78
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 92.72
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 92.71
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 92.67
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 92.66
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 92.63
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 92.6
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 92.56
d1nrjb_209 Signal recognition particle receptor beta-subunit 92.5
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 92.48
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 92.48
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.47
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.45
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.43
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 92.38
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 92.37
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 92.28
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 92.27
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 92.23
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 92.1
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 92.08
d2qy9a2211 GTPase domain of the signal recognition particle r 91.99
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 91.88
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 91.83
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 91.72
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 91.68
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 91.68
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 91.63
d1vmaa2213 GTPase domain of the signal recognition particle r 91.62
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 91.55
d1ls1a2207 GTPase domain of the signal sequence recognition p 91.54
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 91.5
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 91.43
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.42
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 91.24
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 91.23
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 91.15
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 91.14
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 91.12
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 91.11
d2fh5b1207 Signal recognition particle receptor beta-subunit 91.06
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 91.0
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.0
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 90.97
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 90.94
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.81
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 90.77
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 90.76
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 90.74
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 90.71
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 90.69
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 90.65
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 90.57
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 90.56
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 90.56
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 90.55
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 90.53
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 90.51
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 90.51
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 90.48
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 90.47
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 90.44
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.43
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 90.41
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 90.4
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 90.37
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 90.35
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 90.25
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 90.2
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 90.18
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 90.11
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.1
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 90.08
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 90.06
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 90.02
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 90.01
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 89.95
d2fh5b1207 Signal recognition particle receptor beta-subunit 89.9
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 89.86
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 89.77
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 89.75
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 89.74
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 89.69
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 89.68
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 89.67
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 89.65
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 89.63
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 89.57
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 89.57
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 89.56
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 89.56
d1okkd2207 GTPase domain of the signal recognition particle r 89.56
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 89.54
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 89.54
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 89.54
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 89.53
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 89.5
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 89.49
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 89.47
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 89.45
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 89.34
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 89.29
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 89.27
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 89.21
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 89.2
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 89.2
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 89.18
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 89.16
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 89.15
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 89.14
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 89.05
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 89.04
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 89.0
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 88.98
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 88.91
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 88.81
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 88.78
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 88.72
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 88.7
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 88.63
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 88.58
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 88.55
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 88.53
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 88.51
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 88.46
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 88.42
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 88.36
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 88.33
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 88.28
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 88.28
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 88.27
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 88.27
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 88.26
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 88.23
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 88.19
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 88.18
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 88.15
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 88.12
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 88.11
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 88.1
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 88.1
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 88.06
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 88.06
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 88.03
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 88.01
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 87.99
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 87.94
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 87.86
d1vmaa2213 GTPase domain of the signal recognition particle r 87.85
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 87.83
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 87.79
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 87.72
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 87.71
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 87.66
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 87.66
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 87.64
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 87.6
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 87.59
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 87.58
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 87.56
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 87.52
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 87.5
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 87.43
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 87.43
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 87.4
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 87.32
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 87.23
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 87.21
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 87.21
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 87.1
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 87.08
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 87.0
d1xpua3289 Transcription termination factor Rho, ATPase domai 87.0
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 86.99
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 86.95
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 86.89
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 86.82
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 86.72
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 86.69
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 86.68
d2qy9a2211 GTPase domain of the signal recognition particle r 86.66
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 86.61
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 86.59
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 86.55
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 86.51
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 86.43
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 86.4
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 86.39
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 86.25
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 86.22
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 86.2
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 86.17
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 86.17
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 86.08
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 86.07
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 86.05
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 86.05
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 86.04
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 86.03
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 85.95
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 85.95
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 85.91
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 85.9
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 85.89
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 85.89
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 85.85
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 85.83
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 85.8
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 85.66
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 85.61
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 85.6
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 85.58
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 85.58
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 85.57
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 85.35
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 85.27
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 85.25
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 85.21
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 85.17
d1ls1a2207 GTPase domain of the signal sequence recognition p 85.12
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 85.07
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 84.95
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 84.93
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 84.84
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 84.55
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 84.43
d1j8yf2211 GTPase domain of the signal sequence recognition p 84.27
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 84.24
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 84.17
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 84.14
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 84.13
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 84.1
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 84.07
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 83.95
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 83.91
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 83.89
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 83.87
d1xpua3289 Transcription termination factor Rho, ATPase domai 83.72
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 83.44
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 83.26
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 83.18
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 83.11
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 83.02
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 82.33
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 81.92
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 81.89
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 81.82
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 81.56
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 81.56
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 81.33
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 81.32
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 81.11
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 80.98
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 80.98
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 80.77
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 80.45
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 80.42
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 80.23
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Haemolysin B ATP-binding protein
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=3.1e-64  Score=561.10  Aligned_cols=237  Identities=32%  Similarity=0.508  Sum_probs=230.6

Q ss_pred             eEEEEeEEeEeCCCCCccceeeeEEeeCCcEEEEEcCCCCCHHHHHHHHhcccCCCccEEEECCeeCCCCChHHHhcccE
Q 039402         1245 KIDLLDLQVRYAPQMPLVLQGISCTFPGGEKTGIVGRTGSGKSTLIQTLFRIVEPAAGQILIDGIDISLIGLHDLRSRLS 1324 (1496)
Q Consensus      1245 ~I~f~nvs~~Y~~~~~~vLk~iS~~I~~GekvgIVGrTGSGKSTLl~~L~rl~ep~~G~I~IDG~dI~~i~l~~LR~~i~ 1324 (1496)
                      +|+|+||+|+|+++.++||+||||+|++||++||||+||||||||+++|.|+++|++|+|.|||+||+.++.+++|++|+
T Consensus         1 eI~~~nvsf~Y~~~~~~vL~~isl~i~~Ge~vaIvG~sGsGKSTLl~ll~gl~~p~~G~I~i~g~~i~~~~~~~lr~~i~   80 (241)
T d2pmka1           1 DITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVG   80 (241)
T ss_dssp             EEEEEEEEEESSTTSCEEEEEEEEEEETTCEEEEECSTTSSHHHHHHHHTTSSCCSEEEEEETTEETTTSCHHHHHHHEE
T ss_pred             CeEEEEEEEEeCCCCcceEeeeEEEEcCCCEEEEECCCCCCHHHHHHHHHhcCCCCCCEEEECCEEecccchhhhhceEE
Confidence            58999999999988889999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEcccccccccchhhccCCCC-CCcHHHHHHHHHHcCCcHHHHhccCCcccccccCCCCCCchHHHHHHHHHHHccCCCE
Q 039402         1325 IIPQDPVMFEGTVRSNLDPLE-ESTDEQIWEALDKCQLGDEVRKKEGKLDSKVTENGENWSMGQRQLVCLGRVLLKRSKI 1403 (1496)
Q Consensus      1325 iIpQdp~LF~gTIR~NLdp~~-~~sd~eI~~aL~~~~L~~~i~~lp~gLdt~v~e~G~nLS~GQrQll~LARALLr~~~I 1403 (1496)
                      +|||||.+|++|||+||.... ..++++++++++.+++.+++..+|+|+||.++++|.+||||||||+||||||+++|+|
T Consensus        81 ~v~Q~~~lf~~Ti~eNi~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~t~i~~~g~~LSGGq~QRvalARal~~~p~i  160 (241)
T d2pmka1          81 VVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKI  160 (241)
T ss_dssp             EECSSCCCTTSBHHHHHCTTSTTCCHHHHHHHHHHHTCHHHHTTSTTGGGSBCSTTTTCCCHHHHHHHHHHHHHTTCCSE
T ss_pred             EEecccccCCccccccccccCccccHHHHHHHHHHHhhHHHHHhhhcchhhhcCCCCCccCHHHHHHHhhhhhhhcccch
Confidence            999999999999999998654 5899999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEcCCCCCCHHHHHHHHHHHHHhcCCcEEEEEccCcchhcccCEEEEEeCCeEeEecChhhHhhcCCcHHHHHHHH
Q 039402         1404 LMLDEATASVDTATDNLIQQTLRQHFSDCTVLTIAHRITSVIDSDLVLLLNHGLIEEFDNPANLLENKSSSFSQLVAE 1481 (1496)
Q Consensus      1404 LiLDEaTsslD~~Td~~Iq~~I~~~f~~~TVI~IAHRl~ti~~~DrIlVL~~G~IvE~g~p~~Ll~~~~s~F~~l~~~ 1481 (1496)
                      ||||||||+||+.|++.|.+.|++..+++|||+||||++++..||||+||++|+|+|+|+|++|++++++.|++|++.
T Consensus       161 lilDEpts~LD~~~~~~i~~~l~~l~~~~Tvi~itH~l~~~~~~D~i~vl~~G~Iv~~G~~~ell~~~~~~y~~l~~~  238 (241)
T d2pmka1         161 LIFDEATSALDYESEHVIMRNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYLYQL  238 (241)
T ss_dssp             EEECCCCSCCCHHHHHHHHHHHHHHHTTSEEEEECSSGGGGTTSSEEEEEETTEEEEEECHHHHHHSTTCHHHHHHHH
T ss_pred             hhhhCCccccCHHHHHHHHHHHHHHhCCCEEEEEECCHHHHHhCCEEEEEECCEEEEECCHHHHHhCCCCHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999999999999999999888999999864



>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3b60a2 f.37.1.1 (A:10-328) Multidrug resistance ABC transporter MsbA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure