Citrus Sinensis ID: 039466

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260---

MAAEPVNLNAFQELARLALPKMYYDFYAGGVENQYTLKENMEAFHGITFWPRILVDVCRIDISTSTLDYKISASIIIAPTGLHKLANPEGEVATARAAASCNTIMVLSFTSSCSIEEVAASCNAAYKKRDMAATLVQRAERNGFMALVLTADTPRLDRREADIKNKMIAQQLKNLEGLLSTKVTSDTGSNLEAYAKETMDPSLSWKDIEWLRSITNLPILIKGVLTREDAIKAVEVGVAGIIVSNHGARQLDYTPATISALEE

cccccccHHHHHHHHHHHcccHHHHHHcccccHHHHHHHHHHHHHccccccccccccccccccEEEcccccccccEEHHHHHHHccccHHHHHHHHHHHHccccEEEcccccccHHHHHHHcccccccHHHHHHHHHHHHHccccEEEEEEcccccccccHHHcccccccccccccccccccccccccccHHHHHHHccccccccccHHHHHccccccEEEEccccHHHHHHHHHHcccEEEEcccccccccccccccccccc

cccccEcHHHHHHHHHHHccHHHHHHHHcccccHHHHHHHHHHHHHcccccHEEEEcccccccEEEEcccccccEEEccHHHcccccccHHHHHHHHHHHccccEEEEEcccccHHHHHHHcccccccHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHccccccccccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHccccEEEEEEccHHHHHHHHHccccEEEEEccccccccccccHHHHccc

maaepvnlNAFQELARLALPKMYYdfyaggvenqyTLKENMeafhgitfwpRILVDVCRIDiststldykisasiiiaptglhklanpegeVATARAAASCNTIMVLSFTSSCSIEEVAASCNAAYKKRDMAATLVQRAERNGFMALVLtadtprldrREADIKNKMIAQQLKNLEGLLstkvtsdtgsnLEAYAKetmdpslswkdiEWLRSITNLPILIKGVLTREDAIKAVEVGVAGIIVsnhgarqldytpatiSALEE

maaepvnlNAFQELARLALPKMYYDFYAGGVENQYTLKENMEAFHGITFWPRILVDVCRIDISTSTLDYKISASIIIAPTGLHKLANPEGEVATARAAASCNTIMVLSFTSSCSIEEVAASCNAAYKKRDMAATLVQRAerngfmalvltadtprlDRREADIKNKMIAQQLKNLEGLLSTKVTSDTGSNLEAyaketmdpslswKDIEWLRSITNLPILIKGVLTREDAIKAVEVGVAGIivsnhgarqldytpatisalee

*******LNAFQELARLALPKMYYDFYAGGVENQYTLKENMEAFHGITFWPRILVDVCRIDISTSTLDYKISASIIIAPTGLHKLANPEGEVATARAAASCNTIMVLSFTSSCSIEEVAASCNAAYKKRDMAATLVQRAERNGFMALVLTADTPR***********MIA**LKNLEGLL*********************PSLSWKDIEWLRSITNLPILIKGVLTREDAIKAVEVGVAGIIVSNHGARQLDYT*********

*AAEPVNLNAFQELARLALPKMYYDFYAGGVENQYTLKENMEAFHGITFWPRILVDVCRIDISTSTLDYKISASIIIAPTGLHKLANPEGEVATARAAASCNTIMVLSFTSSCSIEEVAASCNAAYKKRDMAATLVQRAERNGFMALVLTADTPRLDRREADIKNKMIAQQLKNL******************YAKETMDPSLSWKDIEWLRSITNLPILIKGVLTREDAIKAVEVGVAGIIVSNHGARQLDYTPATISALEE

***EPVNLNAFQELARLALPKMYYDFYAGGVENQYTLKENMEAFHGITFWPRILVDVCRIDISTSTLDYKISASIIIAPTGLHKLANPEGEVATARAAASCNTIMVLSFTSSCSIEEVAASCNAAYKKRDMAATLVQRAERNGFMALVLTADTPRLDRREADIKNKMIAQQLKNLEGLLS*******GSNLEAYAKETMDPSLSWKDIEWLRSITNLPILIKGVLTREDAIKAVEVGVAGIIVSNHGARQLDYTPATIS*LEE

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		263	2.2.26 [Sep-21-2011]
Q9LJH5		363	Peroxisomal (S)-2-hydroxy	yes	no	0.980	0.710	0.675	1e-101
Q24JJ8		363	Peroxisomal (S)-2-hydroxy	no	no	0.980	0.710	0.664	2e-99
Q8H3I4		366	Peroxisomal (S)-2-hydroxy	yes	no	0.984	0.707	0.629	2e-94
B8B8K5		366	Peroxisomal (S)-2-hydroxy	N/A	no	0.984	0.707	0.625	8e-94
O49506		368	Peroxisomal (S)-2-hydroxy	no	no	0.988	0.706	0.544	1e-77
P05414		369	Peroxisomal (S)-2-hydroxy	N/A	no	0.988	0.704	0.548	1e-73
Q10CE4		369	Peroxisomal (S)-2-hydroxy	no	no	0.992	0.707	0.542	1e-73
B8AKX6		369	Peroxisomal (S)-2-hydroxy	N/A	no	0.992	0.707	0.542	1e-73
Q6YT73		369	Peroxisomal (S)-2-hydroxy	no	no	0.992	0.707	0.538	2e-73
B8B7C5		369	Peroxisomal (S)-2-hydroxy	N/A	no	0.992	0.707	0.538	2e-73

>sp\|Q9LJH5\|GLO4_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 OS=Arabidopsis thaliana GN=GLO4 PE=2 SV=1	Back alignment and function desciption

 Score =  368 bits (944), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 179/265 (67%), Positives = 218/265 (82%), Gaps = 7/265 (2%)

Query: 6   VNLNAFQELARLALPKMYYDFYAGGVENQYTLKENMEAFHGITFWPRILVDVCRIDISTS 65
           VN++ FQELA+ ALPKMYYDFY GG E+Q+TL EN++AF  I F PR+LVDV  ID+STS
Sbjct: 5   VNVDEFQELAKQALPKMYYDFYNGGAEDQHTLNENVQAFRRIMFRPRVLVDVSNIDMSTS 64

Query: 66  TLDYKISASIIIAPTGLHKLANPEGEVATARAAASCNTIMVLSFTSSCSIEEVAASCNAA 125
            L Y ISA I+IAPT +HKLA+P+GE+ATA+AAA+CNTIM++SF S+C+IEEVA+SCNA 
Sbjct: 65  MLGYPISAPIMIAPTAMHKLAHPKGEIATAKAAAACNTIMIVSFMSTCTIEEVASSCNAV 124

Query: 126 -------YKKRDMAATLVQRAERNGFMALVLTADTPRLDRREADIKNKMIAQQLKNLEGL 178
                  YK+RD+ A +V+RAE+ GF A+VLT D PRL RREADIKNKMI+ QLKN EGL
Sbjct: 125 RFLQIYVYKRRDVTAQIVKRAEKAGFKAIVLTVDVPRLGRREADIKNKMISPQLKNFEGL 184

Query: 179 LSTKVTSDTGSNLEAYAKETMDPSLSWKDIEWLRSITNLPILIKGVLTREDAIKAVEVGV 238
           +ST+V  + GS +EA+A    D SLSWKDIEWLRSIT LPIL+KG+LTREDA+KAVE GV
Sbjct: 185 VSTEVRPNEGSGVEAFASSAFDASLSWKDIEWLRSITKLPILVKGLLTREDALKAVEAGV 244

Query: 239 AGIIVSNHGARQLDYTPATISALEE 263
            GI+VSNHGARQLDY+PATI+ LEE
Sbjct: 245 DGIVVSNHGARQLDYSPATITVLEE 269

Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 5

>sp\|Q24JJ8\|GLO3_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO3 OS=Arabidopsis thaliana GN=GLO3 PE=2 SV=1	Back alignment and function description

>sp\|Q8H3I4\|GLO4_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 OS=Oryza sativa subsp. japonica GN=GLO4 PE=2 SV=2	Back alignment and function description

>sp\|B8B8K5\|GLO4_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 OS=Oryza sativa subsp. indica GN=GLO4 PE=2 SV=2	Back alignment and function description

>sp\|O49506\|GLO5_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 OS=Arabidopsis thaliana GN=GLO5 PE=1 SV=1	Back alignment and function description

>sp\|P05414\|GOX_SPIOL Peroxisomal (S)-2-hydroxy-acid oxidase OS=Spinacia oleracea PE=1 SV=1	Back alignment and function description

>sp\|Q10CE4\|GLO1_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 OS=Oryza sativa subsp. japonica GN=GLO1 PE=1 SV=1	Back alignment and function description

>sp\|B8AKX6\|GLO1_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 OS=Oryza sativa subsp. indica GN=GLO1 PE=3 SV=1	Back alignment and function description

>sp\|Q6YT73\|GLO5_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 OS=Oryza sativa subsp. japonica GN=GLO5 PE=2 SV=1	Back alignment and function description

>sp\|B8B7C5\|GLO5_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 OS=Oryza sativa subsp. indica GN=GLO5 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		263
255576607		364	(S)-2-hydroxy-acid oxidase, putative [Ri	1.0	0.722	0.740	1e-112
147789144		364	hypothetical protein VITISV_031318 [Viti	1.0	0.722	0.737	1e-111
225442054		364	PREDICTED: peroxisomal (S)-2-hydroxy-aci	1.0	0.722	0.733	1e-110
225442052		364	PREDICTED: peroxisomal (S)-2-hydroxy-aci	1.0	0.722	0.737	1e-109
147789143		364	hypothetical protein VITISV_031317 [Viti	1.0	0.722	0.737	1e-109
255576595		364	(S)-2-hydroxy-acid oxidase, putative [Ri	1.0	0.722	0.729	1e-107
224074053		364	predicted protein [Populus trichocarpa]	1.0	0.722	0.703	1e-102
224074051		370	predicted protein [Populus trichocarpa]	1.0	0.710	0.688	1e-101
15231789		363	Aldolase-type TIM barrel family protein	0.980	0.710	0.675	1e-99
255576605		364	(S)-2-hydroxy-acid oxidase, putative [Ri	1.0	0.722	0.688	2e-99

>gi\|255576607\|ref\|XP_002529194.1\| (S)-2-hydroxy-acid oxidase, putative [Ricinus communis] gi\|223531372\|gb\|EEF33208.1\| (S)-2-hydroxy-acid oxidase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 200/270 (74%), Positives = 232/270 (85%), Gaps = 7/270 (2%)

Query: 1   MAAEPVNLNAFQELARLALPKMYYDFYAGGVENQYTLKENMEAFHGITFWPRILVDVCRI 60
           M +EPVN+N FQELA+ ALPKMYYD+YAGG E+Q+TLKEN+EAFH IT  PRILVDV +I
Sbjct: 1   MGSEPVNVNEFQELAKQALPKMYYDYYAGGAEDQHTLKENVEAFHRITIRPRILVDVSQI 60

Query: 61  DISTSTLDYKISASIIIAPTGLHKLANPEGEVATARAAASCNTIMVLSFTSSCSIEEVAA 120
           D+ST+ L YKISA I+IAPT +HKLANPEGE ATARAAA CNTIMVLS+ SSC++EEVA+
Sbjct: 61  DMSTTILGYKISAPIMIAPTAMHKLANPEGEAATARAAAVCNTIMVLSYMSSCTVEEVAS 120

Query: 121 SCNA-------AYKKRDMAATLVQRAERNGFMALVLTADTPRLDRREADIKNKMIAQQLK 173
           SCNA        YK+RD++A LVQRAERNG+ A+VLT D PRL RREADI+NKM+A QLK
Sbjct: 121 SCNAIRFYQLYVYKRRDISAQLVQRAERNGYKAIVLTVDAPRLGRREADIRNKMVAPQLK 180

Query: 174 NLEGLLSTKVTSDTGSNLEAYAKETMDPSLSWKDIEWLRSITNLPILIKGVLTREDAIKA 233
           N EGL+ST+V S+ GSNLE +AKET D S+SWKDI WLRSIT+LPILIKGVLT EDAIKA
Sbjct: 181 NFEGLISTEVASNEGSNLEVFAKETFDASMSWKDISWLRSITSLPILIKGVLTHEDAIKA 240

Query: 234 VEVGVAGIIVSNHGARQLDYTPATISALEE 263
           VEVGVAGI+VSNHGARQLDY+PATI+ LEE
Sbjct: 241 VEVGVAGIVVSNHGARQLDYSPATITVLEE 270

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|147789144\|emb\|CAN60339.1\| hypothetical protein VITISV_031318 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225442054\|ref\|XP_002270101.1\| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO4 [Vitis vinifera] gi\|297742968\|emb\|CBI35835.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225442052\|ref\|XP_002270074.1\| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO4 [Vitis vinifera] gi\|297742966\|emb\|CBI35833.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147789143\|emb\|CAN60338.1\| hypothetical protein VITISV_031317 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255576595\|ref\|XP_002529188.1\| (S)-2-hydroxy-acid oxidase, putative [Ricinus communis] gi\|223531366\|gb\|EEF33202.1\| (S)-2-hydroxy-acid oxidase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224074053\|ref\|XP_002304232.1\| predicted protein [Populus trichocarpa] gi\|222841664\|gb\|EEE79211.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224074051\|ref\|XP_002304231.1\| predicted protein [Populus trichocarpa] gi\|222841663\|gb\|EEE79210.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi|15231789|ref|NP_188029.1| Aldolase-type TIM barrel family protein [Arabidopsis thaliana] gi|75335069|sp|Q9LJH5.1|GLO4_ARATH RecName: Full=Peroxisomal (S)-2-hydroxy-acid oxidase GLO4; AltName: Full=Glycolate oxidase 4; Short=AtGLO4; Short=GOX 4; AltName: Full=Short chain alpha-hydroxy acid oxidase GLO4 gi|9294638|dbj|BAB02977.1| glycolate oxidase [Arabidopsis thaliana] gi|27754229|gb|AAO22568.1| putative glycolate oxidase [Arabidopsis thaliana] gi|332641954|gb|AEE75475.1| Aldolase-type TIM barrel family protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|255576605\|ref\|XP_002529193.1\| (S)-2-hydroxy-acid oxidase, putative [Ricinus communis] gi\|223531371\|gb\|EEF33207.1\| (S)-2-hydroxy-acid oxidase, putative [Ricinus communis]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		263
TAIR\|locus:2087487		363	HAOX1 [Arabidopsis thaliana (t	0.980	0.710	0.675	3e-92
TAIR\|locus:2087517		363	HAOX2 [Arabidopsis thaliana (t	0.980	0.710	0.664	1.5e-90
UNIPROTKB\|Q8H3I4		366	GLO4 "Peroxisomal (S)-2-hydrox	0.984	0.707	0.629	5.6e-84
UNIPROTKB\|B8B8K5		366	GLO4 "Peroxisomal (S)-2-hydrox	0.984	0.707	0.625	2.4e-83
TAIR\|locus:2124499		368	GOX3 "glycolate oxidase 3" [Ar	0.988	0.706	0.544	8.9e-70
UNIPROTKB\|B8AKX6		369	GLO1 "Peroxisomal (S)-2-hydrox	0.988	0.704	0.544	1.8e-69
UNIPROTKB\|Q10CE4		369	GLO1 "Peroxisomal (S)-2-hydrox	0.988	0.704	0.544	1.8e-69
UNIPROTKB\|B8B7C5		369	GLO5 "Peroxisomal (S)-2-hydrox	0.988	0.704	0.540	8e-69
UNIPROTKB\|Q6YT73		369	GLO5 "Peroxisomal (S)-2-hydrox	0.988	0.704	0.540	8e-69
UNIPROTKB\|Q01KC2		368	GLO2 "Peroxisomal (S)-2-hydrox	0.977	0.698	0.550	1e-68

TAIR\|locus:2087487 HAOX1 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 919 (328.6 bits), Expect = 3.0e-92, P = 3.0e-92
 Identities = 179/265 (67%), Positives = 218/265 (82%)

Query:     6 VNLNAFQELARLALPKMYYDFYAGGVENQYTLKENMEAFHGITFWPRILVDVCRIDISTS 65
             VN++ FQELA+ ALPKMYYDFY GG E+Q+TL EN++AF  I F PR+LVDV  ID+STS
Sbjct:     5 VNVDEFQELAKQALPKMYYDFYNGGAEDQHTLNENVQAFRRIMFRPRVLVDVSNIDMSTS 64

Query:    66 TLDYKISASIIIAPTGLHKLANPEGEVATARAAASCNTIMVLSFTSSCSIEEVAASCNAA 125
              L Y ISA I+IAPT +HKLA+P+GE+ATA+AAA+CNTIM++SF S+C+IEEVA+SCNA 
Sbjct:    65 MLGYPISAPIMIAPTAMHKLAHPKGEIATAKAAAACNTIMIVSFMSTCTIEEVASSCNAV 124

Query:   126 -------YKKRDMAATLVQRAERNGFMALVLTADTPRLDRREADIKNKMIAQQLKNLEGL 178
                    YK+RD+ A +V+RAE+ GF A+VLT D PRL RREADIKNKMI+ QLKN EGL
Sbjct:   125 RFLQIYVYKRRDVTAQIVKRAEKAGFKAIVLTVDVPRLGRREADIKNKMISPQLKNFEGL 184

Query:   179 LSTKVTSDTGSNLEAYAKETMDPSLSWKDIEWLRSITNLPILIKGVLTREDAIKAVEVGV 238
             +ST+V  + GS +EA+A    D SLSWKDIEWLRSIT LPIL+KG+LTREDA+KAVE GV
Sbjct:   185 VSTEVRPNEGSGVEAFASSAFDASLSWKDIEWLRSITKLPILVKGLLTREDALKAVEAGV 244

Query:   239 AGIIVSNHGARQLDYTPATISALEE 263
              GI+VSNHGARQLDY+PATI+ LEE
Sbjct:   245 DGIVVSNHGARQLDYSPATITVLEE 269

GO:0003824 "catalytic activity" evidence=IEA

GO:0005737 "cytoplasm" evidence=ISM

GO:0008891 "glycolate oxidase activity" evidence=ISS

GO:0010181 "FMN binding" evidence=IEA

GO:0016491 "oxidoreductase activity" evidence=IEA

GO:0042742 "defense response to bacterium" evidence=IMP

GO:0050665 "hydrogen peroxide biosynthetic process" evidence=IMP

TAIR\|locus:2087517 HAOX2 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8H3I4 GLO4 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO4" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

UNIPROTKB\|B8B8K5 GLO4 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO4" [Oryza sativa Indica Group (taxid:39946)]	Back alignment and assigned GO terms

TAIR\|locus:2124499 GOX3 "glycolate oxidase 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|B8AKX6 GLO1 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO1" [Oryza sativa Indica Group (taxid:39946)]	Back alignment and assigned GO terms

UNIPROTKB\|Q10CE4 GLO1 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO1" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

UNIPROTKB\|B8B7C5 GLO5 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO5" [Oryza sativa Indica Group (taxid:39946)]	Back alignment and assigned GO terms

UNIPROTKB\|Q6YT73 GLO5 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO5" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

UNIPROTKB\|Q01KC2 GLO2 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO2" [Oryza sativa Indica Group (taxid:39946)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q8H3I4	GLO4_ORYSJ	1, ., 1, ., 3, ., 1, 5	0.6292	0.9847	0.7076	yes	no
Q9LJH5	GLO4_ARATH	1, ., 1, ., 3, ., 1, 5	0.6754	0.9809	0.7107	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	1.1.3	0.921
3rd Layer	1.1.3.15	0.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		263
PLN02535		364	PLN02535, PLN02535, glycolate oxidase	1e-168
PLN02493		367	PLN02493, PLN02493, probable peroxisomal (S)-2-hyd	2e-91
cd02809		299	cd02809, alpha_hydroxyacid_oxid_FMN, Family of hom	4e-88
pfam01070		302	pfam01070, FMN_dh, FMN-dependent dehydrogenase	5e-86
cd02922		344	cd02922, FCB2_FMN, Flavocytochrome b2 (FCB2) FMN-b	6e-80
PLN02979		366	PLN02979, PLN02979, glycolate oxidase	1e-77
COG1304		360	COG1304, idi, Isopentenyl diphosphate isomerase (B	8e-63
cd03332		383	cd03332, LMO_FMN, L-Lactate 2-monooxygenase (LMO)	1e-61
cd04737		351	cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN	5e-60
cd04736		361	cd04736, MDH_FMN, Mandelate dehydrogenase (MDH)-li	2e-55
PRK11197		381	PRK11197, lldD, L-lactate dehydrogenase; Provision	3e-45
TIGR02708		367	TIGR02708, L_lactate_ox, L-lactate oxidase	4e-44
TIGR03966		385	TIGR03966, actino_HemFlav, heme/flavin dehydrogena	4e-42

>gnl\|CDD\|215294 PLN02535, PLN02535, glycolate oxidase	Back alignment and domain information

 Score =  469 bits (1209), Expect = e-168
 Identities = 206/270 (76%), Positives = 234/270 (86%), Gaps = 7/270 (2%)

Query: 1   MAAEPVNLNAFQELARLALPKMYYDFYAGGVENQYTLKENMEAFHGITFWPRILVDVCRI 60
           MA E VN+N FQELA+ ALPKMYYDFYAGG E+Q+TLKEN++AF  ITF PR+LVDV +I
Sbjct: 1   MADEIVNVNEFQELAKQALPKMYYDFYAGGAEDQHTLKENVQAFRRITFRPRVLVDVSKI 60

Query: 61  DISTSTLDYKISASIIIAPTGLHKLANPEGEVATARAAASCNTIMVLSFTSSCSIEEVAA 120
           D+ST+ L Y ISA I+IAPT +HKLA+PEGE+ATARAAA+CNTIMVLSF +SC++EEVA+
Sbjct: 61  DMSTTILGYTISAPIMIAPTAMHKLAHPEGEIATARAAAACNTIMVLSFMASCTVEEVAS 120

Query: 121 SCNA-------AYKKRDMAATLVQRAERNGFMALVLTADTPRLDRREADIKNKMIAQQLK 173
           SCNA        YK+RD+AA LVQRAE+NG+ A+VLTAD PRL RREADIKNKMI+ QLK
Sbjct: 121 SCNAVRFLQLYVYKRRDIAAQLVQRAEKNGYKAIVLTADVPRLGRREADIKNKMISPQLK 180

Query: 174 NLEGLLSTKVTSDTGSNLEAYAKETMDPSLSWKDIEWLRSITNLPILIKGVLTREDAIKA 233
           N EGLLST+V SD GS LEA+A ET D SLSWKDIEWLRSITNLPILIKGVLTREDAIKA
Sbjct: 181 NFEGLLSTEVVSDKGSGLEAFASETFDASLSWKDIEWLRSITNLPILIKGVLTREDAIKA 240

Query: 234 VEVGVAGIIVSNHGARQLDYTPATISALEE 263
           VEVGVAGIIVSNHGARQLDY+PATIS LEE
Sbjct: 241 VEVGVAGIIVSNHGARQLDYSPATISVLEE 270

Length = 364

>gnl\|CDD\|166134 PLN02493, PLN02493, probable peroxisomal (S)-2-hydroxy-acid oxidase	Back alignment and domain information

>gnl\|CDD\|239203 cd02809, alpha_hydroxyacid_oxid_FMN, Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes	Back alignment and domain information

>gnl\|CDD\|216281 pfam01070, FMN_dh, FMN-dependent dehydrogenase	Back alignment and domain information

>gnl\|CDD\|239238 cd02922, FCB2_FMN, Flavocytochrome b2 (FCB2) FMN-binding domain	Back alignment and domain information

>gnl\|CDD\|166620 PLN02979, PLN02979, glycolate oxidase	Back alignment and domain information

>gnl\|CDD\|224223 COG1304, idi, Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|239448 cd03332, LMO_FMN, L-Lactate 2-monooxygenase (LMO) FMN-binding domain	Back alignment and domain information

>gnl\|CDD\|240088 cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain	Back alignment and domain information

>gnl\|CDD\|240087 cd04736, MDH_FMN, Mandelate dehydrogenase (MDH)-like FMN-binding domain	Back alignment and domain information

>gnl\|CDD\|183033 PRK11197, lldD, L-lactate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|131755 TIGR02708, L_lactate_ox, L-lactate oxidase	Back alignment and domain information

>gnl\|CDD\|188481 TIGR03966, actino_HemFlav, heme/flavin dehydrogenase, mycofactocin system	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		263
KOG0538		363	consensus Glycolate oxidase [Energy production and	100.0
PLN02493		367	probable peroxisomal (S)-2-hydroxy-acid oxidase	100.0
PLN02535		364	glycolate oxidase	100.0
PRK11197		381	lldD L-lactate dehydrogenase; Provisional	100.0
cd04736		361	MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin	100.0
cd03332		383	LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin	100.0
TIGR02708		367	L_lactate_ox L-lactate oxidase. Members of this pr	100.0
cd04737		351	LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d	100.0
PF01070		356	FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR	100.0
cd02922		344	FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom	100.0
PLN02979		366	glycolate oxidase	100.0
COG1304		360	idi Isopentenyl diphosphate isomerase (BS_ypgA, MT	100.0
cd02809		299	alpha_hydroxyacid_oxid_FMN Family of homologous FM	100.0
cd02811		326	IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di	99.92
PRK05437		352	isopentenyl pyrophosphate isomerase; Provisional	99.92
TIGR02151		333	IPP_isom_2 isopentenyl-diphosphate delta-isomerase	99.89
TIGR01306		321	GMP_reduct_2 guanosine monophosphate reductase, ba	99.76
PRK05458		326	guanosine 5'-monophosphate oxidoreductase; Provisi	99.67
TIGR01305		343	GMP_reduct_1 guanosine monophosphate reductase, eu	99.65
PRK08649		368	inosine 5-monophosphate dehydrogenase; Validated	99.38
TIGR01304		369	IMP_DH_rel_2 IMP dehydrogenase family protein. Thi	99.23
PRK06843		404	inosine 5-monophosphate dehydrogenase; Validated	99.1
cd00381		325	IMPDH IMPDH: The catalytic domain of the inosine m	99.07
cd02808		392	GltS_FMN Glutamate synthase (GltS) FMN-binding dom	99.06
COG0042		323	tRNA-dihydrouridine synthase [Translation, ribosom	99.04
PRK07107		502	inosine 5-monophosphate dehydrogenase; Validated	98.72
PLN02274		505	inosine-5'-monophosphate dehydrogenase	98.52
PF01207		309	Dus: Dihydrouridine synthase (Dus); InterPro: IPR0	98.43
TIGR01037		300	pyrD_sub1_fam dihydroorotate dehydrogenase (subfam	98.39
KOG2335		358	consensus tRNA-dihydrouridine synthase [Translatio	98.35
PRK05567		486	inosine 5'-monophosphate dehydrogenase; Reviewed	98.33
PRK10550		312	tRNA-dihydrouridine synthase C; Provisional	98.3
PRK10415		321	tRNA-dihydrouridine synthase B; Provisional	98.29
cd02940		299	DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM	98.26
TIGR00736		231	nifR3_rel_arch TIM-barrel protein, putative. Membe	98.26
cd04739		325	DHOD_like Dihydroorotate dehydrogenase (DHOD) like	98.24
PRK07259		301	dihydroorotate dehydrogenase 1B; Reviewed	98.23
PF00478		352	IMPDH: IMP dehydrogenase / GMP reductase domain; I	98.12
cd04728		248	ThiG Thiazole synthase (ThiG) is the tetrameric en	98.09
PRK07565		334	dihydroorotate dehydrogenase 2; Reviewed	98.08
TIGR00742		318	yjbN tRNA dihydrouridine synthase A. Members of th	98.06
PRK00208		250	thiG thiazole synthase; Reviewed	98.06
cd02911		233	arch_FMN Archeal FMN-binding domain. This family o	98.05
cd04740		296	DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c	98.02
PRK01033		258	imidazole glycerol phosphate synthase subunit HisF	98.01
TIGR01302		450	IMP_dehydrog inosine-5'-monophosphate dehydrogenas	97.97
TIGR00737		319	nifR3_yhdG putative TIM-barrel protein, nifR3 fami	97.97
cd02810		289	DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD)	97.86
PRK05096		346	guanosine 5'-monophosphate oxidoreductase; Provisi	97.84
PLN02495		385	oxidoreductase, acting on the CH-CH group of donor	97.83
TIGR03151		307	enACPred_II putative enoyl-(acyl-carrier-protein)	97.8
TIGR00007		230	phosphoribosylformimino-5-aminoimidazole carboxami	97.76
PTZ00314		495	inosine-5'-monophosphate dehydrogenase; Provisiona	97.71
cd04732		234	HisA HisA. Phosphoribosylformimino-5-aminoimidazol	97.69
PRK13585		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	97.67
PLN02826		409	dihydroorotate dehydrogenase	97.66
cd04730		236	NPD_like 2-Nitropropane dioxygenase (NPD), one of	97.65
PRK11815		333	tRNA-dihydrouridine synthase A; Provisional	97.65
TIGR03572		232	WbuZ glycosyl amidation-associated protein WbuZ. T	97.63
cd04731		243	HisF The cyclase subunit of imidazoleglycerol phos	97.57
TIGR00735		254	hisF imidazoleglycerol phosphate synthase, cyclase	97.55
cd02940		299	DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM	97.53
TIGR00737		319	nifR3_yhdG putative TIM-barrel protein, nifR3 fami	97.5
PRK05286		344	dihydroorotate dehydrogenase 2; Reviewed	97.49
PRK02083		253	imidazole glycerol phosphate synthase subunit HisF	97.47
PRK00748		233	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	97.44
cd02810		289	DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD)	97.43
TIGR01037		300	pyrD_sub1_fam dihydroorotate dehydrogenase (subfam	97.42
cd02801		231	DUS_like_FMN Dihydrouridine synthase-like (DUS-lik	97.42
PRK14024		241	phosphoribosyl isomerase A; Provisional	97.34
PRK13587		234	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	97.33
COG0167		310	PyrD Dihydroorotate dehydrogenase [Nucleotide tran	97.31
cd02809		299	alpha_hydroxyacid_oxid_FMN Family of homologous FM	97.31
cd00331		217	IGPS Indole-3-glycerol phosphate synthase (IGPS);	97.27
cd04738		327	DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl	97.26
PRK08318		420	dihydropyrimidine dehydrogenase subunit B; Validat	97.21
cd04740		296	DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c	97.19
cd04723		233	HisA_HisF Phosphoribosylformimino-5-aminoimidazole	97.18
CHL00200		263	trpA tryptophan synthase alpha subunit; Provisiona	97.18
PLN02591		250	tryptophan synthase	97.15
cd04727		283	pdxS PdxS is a subunit of the pyridoxal 5'-phospha	97.12
cd04739		325	DHOD_like Dihydroorotate dehydrogenase (DHOD) like	97.12
PRK11840		326	bifunctional sulfur carrier protein/thiazole synth	97.09
PRK07259		301	dihydroorotate dehydrogenase 1B; Reviewed	97.07
TIGR00343		287	pyridoxal 5'-phosphate synthase, synthase subunit	97.04
TIGR00262		256	trpA tryptophan synthase, alpha subunit. Tryptopha	97.01
COG0106		241	HisA Phosphoribosylformimino-5-aminoimidazole carb	97.0
PF05690		247	ThiG: Thiazole biosynthesis protein ThiG; InterPro	96.95
cd04732		234	HisA HisA. Phosphoribosylformimino-5-aminoimidazol	96.95
PRK04180		293	pyridoxal biosynthesis lyase PdxS; Provisional	96.94
cd04729		219	NanE N-acetylmannosamine-6-phosphate epimerase (Na	96.92
PRK01130		221	N-acetylmannosamine-6-phosphate 2-epimerase; Provi	96.9
CHL00162		267	thiG thiamin biosynthesis protein G; Validated	96.9
PRK00278		260	trpC indole-3-glycerol-phosphate synthase; Reviewe	96.86
PRK07565		334	dihydroorotate dehydrogenase 2; Reviewed	96.86
PRK08318		420	dihydropyrimidine dehydrogenase subunit B; Validat	96.81
TIGR02708		367	L_lactate_ox L-lactate oxidase. Members of this pr	96.79
TIGR00007		230	phosphoribosylformimino-5-aminoimidazole carboxami	96.75
TIGR01769		205	GGGP geranylgeranylglyceryl phosphate synthase. Th	96.71
cd00381		325	IMPDH IMPDH: The catalytic domain of the inosine m	96.7
PRK13957		247	indole-3-glycerol-phosphate synthase; Provisional	96.69
PRK07695		201	transcriptional regulator TenI; Provisional	96.67
COG2022		262	ThiG Uncharacterized enzyme of thiazole biosynthes	96.66
PRK07998		283	gatY putative fructose-1,6-bisphosphate aldolase;	96.64
TIGR01036		335	pyrD_sub2 dihydroorotate dehydrogenase, subfamily	96.55
KOG2333		614	consensus Uncharacterized conserved protein [Gener	96.54
PRK13396		352	3-deoxy-7-phosphoheptulonate synthase; Provisional	96.51
PF04131		192	NanE: Putative N-acetylmannosamine-6-phosphate epi	96.47
PRK05458		326	guanosine 5'-monophosphate oxidoreductase; Provisi	96.45
TIGR01768		223	GGGP-family geranylgeranylglyceryl phosphate synth	96.44
PF01645		368	Glu_synthase: Conserved region in glutamate syntha	96.41
PRK12738		286	kbaY tagatose-bisphosphate aldolase; Reviewed	96.41
PRK12595		360	bifunctional 3-deoxy-7-phosphoheptulonate synthase	96.37
COG3010		229	NanE Putative N-acetylmannosamine-6-phosphate epim	96.35
cd04731		243	HisF The cyclase subunit of imidazoleglycerol phos	96.34
PRK02083		253	imidazole glycerol phosphate synthase subunit HisF	96.29
cd04738		327	DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl	96.28
cd04741		294	DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c	96.25
TIGR00734		221	hisAF_rel hisA/hisF family protein. This alignment	96.25
TIGR01919		243	hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy	96.23
cd00331		217	IGPS Indole-3-glycerol phosphate synthase (IGPS);	96.19
TIGR01303		475	IMP_DH_rel_1 IMP dehydrogenase family protein. Thi	96.19
TIGR01361		260	DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate	96.18
cd04729		219	NanE N-acetylmannosamine-6-phosphate epimerase (Na	96.16
PF03060		330	NMO: Nitronate monooxygenase; InterPro: IPR004136	96.15
TIGR00735		254	hisF imidazoleglycerol phosphate synthase, cyclase	96.14
PRK05286		344	dihydroorotate dehydrogenase 2; Reviewed	96.12
PLN02274		505	inosine-5'-monophosphate dehydrogenase	96.1
PRK13397		250	3-deoxy-7-phosphoheptulonate synthase; Provisional	96.09
cd04736		361	MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin	96.09
cd02812		219	PcrB_like PcrB_like proteins. One member of this f	96.07
PRK00748		233	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	96.04
PRK13111		258	trpA tryptophan synthase subunit alpha; Provisiona	96.03
PRK06843		404	inosine 5-monophosphate dehydrogenase; Validated	96.02
PRK06801		286	hypothetical protein; Provisional	95.98
PRK00278		260	trpC indole-3-glycerol-phosphate synthase; Reviewe	95.96
cd04734		343	OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN	95.96
PRK04169		232	geranylgeranylglyceryl phosphate synthase-like pro	95.95
PRK06806		281	fructose-bisphosphate aldolase; Provisional	95.94
TIGR01859		282	fruc_bis_ald_ fructose-1,6-bisphosphate aldolase,	95.94
TIGR01858		282	tag_bisphos_ald class II aldolase, tagatose bispho	95.9
cd02803		327	OYE_like_FMN_family Old yellow enzyme (OYE)-like F	95.87
COG2070		336	Dioxygenases related to 2-nitropropane dioxygenase	95.83
PRK01130		221	N-acetylmannosamine-6-phosphate 2-epimerase; Provi	95.83
PRK14114		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	95.76
PRK02506		310	dihydroorotate dehydrogenase 1A; Reviewed	95.75
PRK10550		312	tRNA-dihydrouridine synthase C; Provisional	95.73
PTZ00314		495	inosine-5'-monophosphate dehydrogenase; Provisiona	95.71
cd04737		351	LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d	95.7
PRK12737		284	gatY tagatose-bisphosphate aldolase; Reviewed	95.68
PRK13585		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	95.65
PRK13523		337	NADPH dehydrogenase NamA; Provisional	95.65
cd04741		294	DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c	95.56
cd00452		190	KDPG_aldolase KDPG and KHG aldolase. This family b	95.54
PRK12857		284	fructose-1,6-bisphosphate aldolase; Reviewed	95.53
PF00218		254	IGPS: Indole-3-glycerol phosphate synthase; InterP	95.51
TIGR00259		257	thylakoid_BtpA membrane complex biogenesis protein	95.49
PRK09195		284	gatY tagatose-bisphosphate aldolase; Reviewed	95.44
TIGR01163		210	rpe ribulose-phosphate 3-epimerase. This family co	95.41
PRK11815		333	tRNA-dihydrouridine synthase A; Provisional	95.41
cd04722		200	TIM_phosphate_binding TIM barrel proteins share a	95.32
COG0191		286	Fba Fructose/tagatose bisphosphate aldolase [Carbo	95.24
PRK00043		212	thiE thiamine-phosphate pyrophosphorylase; Reviewe	95.24
TIGR01182		204	eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho	95.13
cd04735		353	OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN	95.11
PRK08610		286	fructose-bisphosphate aldolase; Reviewed	95.1
PRK08673		335	3-deoxy-7-phosphoheptulonate synthase; Reviewed	95.09
PRK07709		285	fructose-bisphosphate aldolase; Provisional	95.08
PRK09140		206	2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R	95.05
cd00945		201	Aldolase_Class_I Class I aldolases. The class I al	95.03
cd02931		382	ER_like_FMN Enoate reductase (ER)-like FMN-binding	95.02
PF00977		229	His_biosynth: Histidine biosynthesis protein; Inte	94.91
TIGR00167		288	cbbA ketose-bisphosphate aldolases. fructose-bisph	94.9
PRK10415		321	tRNA-dihydrouridine synthase B; Provisional	94.87
PRK13586		232	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	94.86
KOG2550		503	consensus IMP dehydrogenase/GMP reductase [Nucleot	94.8
TIGR03572		232	WbuZ glycosyl amidation-associated protein WbuZ. T	94.79
PRK13398		266	3-deoxy-7-phosphoheptulonate synthase; Provisional	94.75
TIGR01302		450	IMP_dehydrog inosine-5'-monophosphate dehydrogenas	94.68
PLN02460		338	indole-3-glycerol-phosphate synthase	94.62
PRK04128		228	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	94.62
PRK02615		347	thiamine-phosphate pyrophosphorylase; Provisional	94.61
PRK07807		479	inosine 5-monophosphate dehydrogenase; Validated	94.55
COG0352		211	ThiE Thiamine monophosphate synthase [Coenzyme met	94.55
COG0134		254	TrpC Indole-3-glycerol phosphate synthase [Amino a	94.54
TIGR01306		321	GMP_reduct_2 guanosine monophosphate reductase, ba	94.52
PF01884		230	PcrB: PcrB family; InterPro: IPR008205 This entry	94.43
PRK09140		206	2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R	94.42
PRK05835		307	fructose-bisphosphate aldolase; Provisional	94.37
COG0159		265	TrpA Tryptophan synthase alpha chain [Amino acid t	94.35
cd02933		338	OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind	94.31
cd02930		353	DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin	94.26
PRK05567		486	inosine 5'-monophosphate dehydrogenase; Reviewed	94.25
cd04743		320	NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma	94.21
cd00947		276	TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a	94.17
TIGR02129		253	hisA_euk phosphoribosylformimino-5-aminoimidazole	94.12
PRK12457		281	2-dehydro-3-deoxyphosphooctonate aldolase; Provisi	94.09
PRK06552		213	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	94.08
PRK06015		201	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	94.03
cd02932		336	OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN	94.01
cd04733		338	OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN	94.0
PRK13802		695	bifunctional indole-3-glycerol phosphate synthase/	94.0
PF04309		175	G3P_antiterm: Glycerol-3-phosphate responsive anti	93.84
TIGR02151		333	IPP_isom_2 isopentenyl-diphosphate delta-isomerase	93.74
cd04742		418	NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom	93.73
PRK13125		244	trpA tryptophan synthase subunit alpha; Provisiona	93.62
PRK04128		228	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	93.54
PRK05718		212	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	93.36
cd00564		196	TMP_TenI Thiamine monophosphate synthase (TMP synt	93.35
TIGR00742		318	yjbN tRNA dihydrouridine synthase A. Members of th	93.35
PLN02617		538	imidazole glycerol phosphate synthase hisHF	93.26
PLN02446		262	(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy	93.24
COG0107		256	HisF Imidazoleglycerol-phosphate synthase [Amino a	93.19
COG2876		286	AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (	93.18
cd00452		190	KDPG_aldolase KDPG and KHG aldolase. This family b	93.16
PLN02826		409	dihydroorotate dehydrogenase	93.14
COG0800		211	Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca	93.1
PF01081		196	Aldolase: KDPG and KHG aldolase; InterPro: IPR0008	93.03
PRK07084		321	fructose-bisphosphate aldolase; Provisional	92.93
COG1954		181	GlpP Glycerol-3-phosphate responsive antiterminato	92.83
cd04722		200	TIM_phosphate_binding TIM barrel proteins share a	92.76
cd03332		383	LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin	92.71
PRK08883		220	ribulose-phosphate 3-epimerase; Provisional	92.66
COG1646		240	Predicted phosphate-binding enzymes, TIM-barrel fo	92.56
cd04724		242	Tryptophan_synthase_alpha Ttryptophan synthase (TR	92.52
TIGR01303		475	IMP_DH_rel_1 IMP dehydrogenase family protein. Thi	92.48
COG2070		336	Dioxygenases related to 2-nitropropane dioxygenase	92.45
PLN03033		290	2-dehydro-3-deoxyphosphooctonate aldolase; Provisi	92.4
cd02911		233	arch_FMN Archeal FMN-binding domain. This family o	92.15
cd04726		202	KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl	92.13
PRK05437		352	isopentenyl pyrophosphate isomerase; Provisional	92.11
PF00977		229	His_biosynth: Histidine biosynthesis protein; Inte	92.08
PF00290		259	Trp_syntA: Tryptophan synthase alpha chain; InterP	92.06
PRK06552		213	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	91.96
PF01070		356	FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR	91.93
PF02581		180	TMP-TENI: Thiamine monophosphate synthase/TENI; In	91.87
TIGR00262		256	trpA tryptophan synthase, alpha subunit. Tryptopha	91.85
PF00218		254	IGPS: Indole-3-glycerol phosphate synthase; InterP	91.83
cd02922		344	FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom	91.71
PLN02535		364	glycolate oxidase	91.71
PRK11197		381	lldD L-lactate dehydrogenase; Provisional	91.7
cd04747		361	OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN	91.68
TIGR01362		258	KDO8P_synth 3-deoxy-8-phosphooctulonate synthase.	91.49
PRK13587		234	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	91.43
cd02929		370	TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH)	91.41
PRK09427		454	bifunctional indole-3-glycerol phosphate synthase/	91.13
PRK08649		368	inosine 5-monophosphate dehydrogenase; Validated	91.05
PRK07455		187	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	91.05
TIGR01304		369	IMP_DH_rel_2 IMP dehydrogenase family protein. Thi	90.97
COG0269		217	SgbH 3-hexulose-6-phosphate synthase and related p	90.93
PRK11750		1485	gltB glutamate synthase subunit alpha; Provisional	90.9
PRK06512		221	thiamine-phosphate pyrophosphorylase; Provisional	90.76
PRK07455		187	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	90.56
PRK07114		222	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	90.54
PRK07315		293	fructose-bisphosphate aldolase; Provisional	90.5
PRK07807		479	inosine 5-monophosphate dehydrogenase; Validated	90.48
PRK05198		264	2-dehydro-3-deoxyphosphooctonate aldolase; Provisi	90.43
TIGR03151		307	enACPred_II putative enoyl-(acyl-carrier-protein)	90.4
TIGR01182		204	eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho	90.25
PRK09196		347	fructose-1,6-bisphosphate aldolase; Reviewed	90.21
PRK04180		293	pyridoxal biosynthesis lyase PdxS; Provisional	90.04
PRK00507		221	deoxyribose-phosphate aldolase; Provisional	90.01
PRK08255		765	salicylyl-CoA 5-hydroxylase; Reviewed	89.98
TIGR00693		196	thiE thiamine-phosphate pyrophosphorylase. This mo	89.89
PRK01033		258	imidazole glycerol phosphate synthase subunit HisF	89.76
PRK07028		430	bifunctional hexulose-6-phosphate synthase/ribonuc	89.73
PF01180		295	DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP	89.71
PRK14024		241	phosphoribosyl isomerase A; Provisional	89.6
cd02801		231	DUS_like_FMN Dihydrouridine synthase-like (DUS-lik	89.59
PRK04302		223	triosephosphate isomerase; Provisional	89.35
TIGR03128		206	RuMP_HxlA 3-hexulose-6-phosphate synthase. at the	89.23
PRK10605		362	N-ethylmaleimide reductase; Provisional	89.22
cd02808		392	GltS_FMN Glutamate synthase (GltS) FMN-binding dom	89.13
PF03437		254	BtpA: BtpA family; InterPro: IPR005137 Photosystem	89.12
TIGR01919		243	hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy	89.11
cd02803		327	OYE_like_FMN_family Old yellow enzyme (OYE)-like F	89.07
cd02811		326	IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di	89.04
PF01180		295	DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP	88.93
PLN02858		1378	fructose-bisphosphate aldolase	88.92
cd00408		281	DHDPS-like Dihydrodipicolinate synthase family. A	88.76
PF01116		287	F_bP_aldolase: Fructose-bisphosphate aldolase clas	88.68
cd04724		242	Tryptophan_synthase_alpha Ttryptophan synthase (TR	88.61
TIGR00343		287	pyridoxal 5'-phosphate synthase, synthase subunit	88.56
PLN02460		338	indole-3-glycerol-phosphate synthase	88.48
cd00958		235	DhnA Class I fructose-1,6-bisphosphate (FBP) aldol	88.47
PRK13125		244	trpA tryptophan synthase subunit alpha; Provisiona	88.46
cd00405		203	PRAI Phosphoribosylanthranilate isomerase (PRAI) c	88.36
PLN02495		385	oxidoreductase, acting on the CH-CH group of donor	88.28
TIGR03569		329	NeuB_NnaB N-acetylneuraminate synthase. This famil	88.18
TIGR01305		343	GMP_reduct_1 guanosine monophosphate reductase, eu	88.15
COG0167		310	PyrD Dihydroorotate dehydrogenase [Nucleotide tran	88.02
TIGR01521		347	FruBisAldo_II_B fructose-bisphosphate aldolase, cl	88.01
COG0214		296	SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme meta	87.94
TIGR02814		444	pfaD_fam PfaD family protein. The protein PfaD is	87.84
TIGR02129		253	hisA_euk phosphoribosylformimino-5-aminoimidazole	87.78
cd04742		418	NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom	87.33
PRK08999		312	hypothetical protein; Provisional	87.05
cd04723		233	HisA_HisF Phosphoribosylformimino-5-aminoimidazole	86.94
COG0134		254	TrpC Indole-3-glycerol phosphate synthase [Amino a	86.85
PRK13957		247	indole-3-glycerol-phosphate synthase; Provisional	86.8
PRK13399		347	fructose-1,6-bisphosphate aldolase; Provisional	86.74
PTZ00413		398	lipoate synthase; Provisional	86.51
KOG1606		296	consensus Stationary phase-induced protein, SOR/SN	86.38
cd04727		283	pdxS PdxS is a subunit of the pyridoxal 5'-phospha	86.35
cd00429		211	RPE Ribulose-5-phosphate 3-epimerase (RPE). This e	86.3
PRK13802		695	bifunctional indole-3-glycerol phosphate synthase/	86.26
COG0434		263	SgcQ Predicted TIM-barrel enzyme [General function	86.04
PRK05718		212	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	85.93
COG0159		265	TrpA Tryptophan synthase alpha chain [Amino acid t	85.89
TIGR03239		249	GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co	85.86
PRK03620		303	5-dehydro-4-deoxyglucarate dehydratase; Provisiona	85.7
COG0069		485	GltB Glutamate synthase domain 2 [Amino acid trans	85.69
PF03060		330	NMO: Nitronate monooxygenase; InterPro: IPR004136	85.67
PRK08185		283	hypothetical protein; Provisional	85.67
cd00954		288	NAL N-Acetylneuraminic acid aldolase, also called	85.66
cd00945		201	Aldolase_Class_I Class I aldolases. The class I al	85.63
cd00951		289	KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also	85.52
PRK08005		210	epimerase; Validated	85.28
cd08565		235	GDPD_pAtGDE_like Glycerophosphodiester phosphodies	85.09
PRK09517		755	multifunctional thiamine-phosphate pyrophosphoryla	85.03
cd08210		364	RLP_RrRLP Ribulose bisphosphate carboxylase like p	84.8
PRK09197		350	fructose-bisphosphate aldolase; Provisional	84.76
COG0329		299	DapA Dihydrodipicolinate synthase/N-acetylneuramin	84.62
PRK00366		360	ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate s	84.55
COG0329		299	DapA Dihydrodipicolinate synthase/N-acetylneuramin	84.35
cd08601		256	GDPD_SaGlpQ_like Glycerophosphodiester phosphodies	84.3
cd03319		316	L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat	84.19
PRK05742		277	nicotinate-nucleotide pyrophosphorylase; Provision	83.81
PRK14114		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	83.69
COG5016		472	Pyruvate/oxaloacetate carboxyltransferase [Energy	83.6
PRK05096		346	guanosine 5'-monophosphate oxidoreductase; Provisi	83.58
cd03315		265	MLE_like Muconate lactonizing enzyme (MLE) like su	83.45
TIGR01163		210	rpe ribulose-phosphate 3-epimerase. This family co	83.38
PRK02506		310	dihydroorotate dehydrogenase 1A; Reviewed	82.92
COG5564		276	Predicted TIM-barrel enzyme, possibly a dioxygenas	82.68
cd07937		275	DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar	82.67
cd02932		336	OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN	82.59
TIGR02311		249	HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola	82.4
PRK03512		211	thiamine-phosphate pyrophosphorylase; Provisional	82.33
COG0135		208	TrpF Phosphoribosylanthranilate isomerase [Amino a	82.3
PRK13307		391	bifunctional formaldehyde-activating enzyme/3-hexu	81.93
TIGR01520		357	FruBisAldo_II_A fructose-bisphosphate aldolase, cl	81.57
PRK13586		232	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	81.55
PRK06015		201	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	81.43
cd07948		262	DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s	81.29
PF04131		192	NanE: Putative N-acetylmannosamine-6-phosphate epi	81.17
cd00946		345	FBP_aldolase_IIA Class II Type A, Fructose-1,6-bis	81.14
PRK10558		256	alpha-dehydro-beta-deoxy-D-glucarate aldolase; Pro	80.97
PRK09722		229	allulose-6-phosphate 3-epimerase; Provisional	80.91
cd08205		367	RuBisCO_IV_RLP Ribulose bisphosphate carboxylase l	80.63
PF01680		208	SOR_SNZ: SOR/SNZ family; InterPro: IPR001852 Snz1p	80.57
PRK08745		223	ribulose-phosphate 3-epimerase; Provisional	80.56
TIGR01036		335	pyrD_sub2 dihydroorotate dehydrogenase, subfamily	80.48
TIGR00259		257	thylakoid_BtpA membrane complex biogenesis protein	80.46
PLN02898		502	HMP-P kinase/thiamin-monophosphate pyrophosphoryla	80.42
PRK05848		273	nicotinate-nucleotide pyrophosphorylase; Provision	80.19
PRK07107		502	inosine 5-monophosphate dehydrogenase; Validated	80.14
cd08583		237	PI-PLCc_GDPD_SF_unchar1 Uncharacterized hypothetic	80.07

>KOG0538 consensus Glycolate oxidase [Energy production and conversion]	Back alignment and domain information

Probab=100.00  E-value=8.8e-89  Score=600.20  Aligned_cols=259  Identities=61%  Similarity=0.921  Sum_probs=247.2

Q ss_pred             CCChHHHHHHHHHhCCccccccccCCccchHHHHHHHHhccccceeccccccccccccccccCCcccccceeecccCCcc
Q 039466            5 PVNLNAFQELARLALPKMYYDFYAGGVENQYTLKENMEAFHGITFWPRILVDVCRIDISTSTLDYKISASIIIAPTGLHK   84 (263)
Q Consensus         5 ~~~~~d~~~~A~~~l~~~~~~y~~~ga~~e~t~~~N~~af~~~~l~pr~L~~v~~~d~st~~lG~~~~~Pi~iaP~~~~~   84 (263)
                      ++|++|||+.|+++||+.+|+||.|||+|++|+++|++||+||+|+||+|+||+.+|+||++||+++++||+|||+++|+
T Consensus         1 lv~~~dfe~~A~~~L~K~a~dyy~sgA~d~~Tl~~N~~AF~ri~~rPr~L~dVs~iD~sTtvlG~~i~~Pi~iapTa~qk   80 (363)
T KOG0538|consen    1 LVNVDDFEALAKQQLPKMAYDYYESGAEDQETLDENINAFRRILFRPRILRDVSKIDTSTTVLGQKISAPIMIAPTAMQK   80 (363)
T ss_pred             CccHHHHHHHHHHhhhHHHHHHHhcCCcchhhHHHHHHHHHhhhccchhheecccccccceeccccccceeEEcchHHHh
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCChhHHHHHHHHHHCCCceeecCCCCccHHHHHHhccc--------cccCHHHHHHHHHHHHHcCCCEEEEccCCCCC
Q 039466           85 LANPEGEVATARAAASCNTIMVLSFTSSCSIEEVAASCNA--------AYKKRDMAATLVQRAERNGFMALVLTADTPRL  156 (263)
Q Consensus        85 l~~~~ge~a~AraA~~~gi~~~lss~s~~sieeV~~~~~~--------~~~d~~~~~~li~ra~~aG~~al~vTvD~~~~  156 (263)
                      |+|||||.++||||+++|++|++||+++||+|||++++|.        +++|++++++|++|||++||+||+||||+|++
T Consensus        81 ma~pdGE~~taraa~~~~~~~i~Ss~at~S~EdI~~aap~~~rwfQLYvykdr~It~~Lv~raEk~GfkAlvlTvDtP~l  160 (363)
T KOG0538|consen   81 MAHPDGELATARAAQAAGTIMILSSWATCSVEDIASAAPPGIRWFQLYVYKDRDITEQLVKRAEKAGFKALVLTVDTPRL  160 (363)
T ss_pred             ccCCcccHHHHHHHHhcCCcEEEechhcCCHHHHHhhCCCCcEEEEEEecCchHHHHHHHHHHHHcCceEEEEEeccccc
Confidence            9999999999999999999999999999999999999974        78999999999999999999999999999999


Q ss_pred             cchHHHHhhhhhhh---hhhhhhhccccCCCCCCCccHHHHHHHhcCCCCCHHHHHHHHhhcCCCEEEEecCCHHHHHHH
Q 039466          157 DRREADIKNKMIAQ---QLKNLEGLLSTKVTSDTGSNLEAYAKETMDPSLSWKDIEWLRSITNLPILIKGVLTREDAIKA  233 (263)
Q Consensus       157 g~R~~d~r~~~~~p---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~W~dl~~lr~~~~lPiilKGI~s~eDA~~a  233 (263)
                      |+|+.|++|+|.+|   +++|+......+..+...++...+.+.++|++++|+||+|||+.|++|||+||||+.|||++|
T Consensus       161 G~R~~D~~n~f~lp~~l~lknfe~~~~~~v~~~~~sg~~~~~~~~id~Sl~W~Di~wLr~~T~LPIvvKGilt~eDA~~A  240 (363)
T KOG0538|consen  161 GRRESDIKNKFSLPKNLTLKNFEGLKLTEVEEAGDSGLAAYVSSQIDPSLSWKDIKWLRSITKLPIVVKGVLTGEDARKA  240 (363)
T ss_pred             cCchhhhhhcccCCcccccccccccccccCCcccchhhhhhhhcCCCCCCChhhhHHHHhcCcCCeEEEeecccHHHHHH
Confidence            99999999999998   567776655555555566778899999999999999999999999999999999999999999


Q ss_pred             HHcCCCEEEEcCCCCCCCCCchhhhccccC
Q 039466          234 VEVGVAGIIVSNHGARQLDYTPATISALEE  263 (263)
Q Consensus       234 ~~~G~dgI~VSNHGGRqlD~~~~~i~~Lpe  263 (263)
                      +|+|++||+||||||||||+.|+||++|||
T Consensus       241 ve~G~~GIIVSNHGgRQlD~vpAtI~~L~E  270 (363)
T KOG0538|consen  241 VEAGVAGIIVSNHGGRQLDYVPATIEALPE  270 (363)
T ss_pred             HHhCCceEEEeCCCccccCcccchHHHHHH
Confidence            999999999999999999999999999997

>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase	Back alignment and domain information

>PLN02535 glycolate oxidase	Back alignment and domain information

>PRK11197 lldD L-lactate dehydrogenase; Provisional	Back alignment and domain information

>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain	Back alignment and domain information

>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain	Back alignment and domain information

>TIGR02708 L_lactate_ox L-lactate oxidase	Back alignment and domain information

>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain	Back alignment and domain information

>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related	Back alignment and domain information

>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain	Back alignment and domain information

>PLN02979 glycolate oxidase	Back alignment and domain information

>COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism]	Back alignment and domain information

>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes	Back alignment and domain information

>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain	Back alignment and domain information

>PRK05437 isopentenyl pyrophosphate isomerase; Provisional	Back alignment and domain information

>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2	Back alignment and domain information

>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial	Back alignment and domain information

>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic	Back alignment and domain information

>PRK08649 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein	Back alignment and domain information

>PRK06843 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase	Back alignment and domain information

>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain	Back alignment and domain information

>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK07107 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>PLN02274 inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA	Back alignment and domain information

>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein	Back alignment and domain information

>KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>PRK10550 tRNA-dihydrouridine synthase C; Provisional	Back alignment and domain information

>PRK10415 tRNA-dihydrouridine synthase B; Provisional	Back alignment and domain information

>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative	Back alignment and domain information

>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins	Back alignment and domain information

>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed	Back alignment and domain information

>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase	Back alignment and domain information

>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism	Back alignment and domain information

>PRK07565 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>TIGR00742 yjbN tRNA dihydrouridine synthase A	Back alignment and domain information

>PRK00208 thiG thiazole synthase; Reviewed	Back alignment and domain information

>cd02911 arch_FMN Archeal FMN-binding domain	Back alignment and domain information

>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain	Back alignment and domain information

>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family	Back alignment and domain information

>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>PLN02495 oxidoreductase, acting on the CH-CH group of donors	Back alignment and domain information

>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II	Back alignment and domain information

>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase	Back alignment and domain information

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>cd04732 HisA HisA	Back alignment and domain information

>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PLN02826 dihydroorotate dehydrogenase	Back alignment and domain information

>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites	Back alignment and domain information

>PRK11815 tRNA-dihydrouridine synthase A; Provisional	Back alignment and domain information

>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ	Back alignment and domain information

>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit	Back alignment and domain information

>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family	Back alignment and domain information

>PRK05286 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated	Back alignment and domain information

>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein	Back alignment and domain information

>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain	Back alignment and domain information

>PRK14024 phosphoribosyl isomerase A; Provisional	Back alignment and domain information

>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes	Back alignment and domain information

>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water	Back alignment and domain information

>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2	Back alignment and domain information

>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated	Back alignment and domain information

>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain	Back alignment and domain information

>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>CHL00200 trpA tryptophan synthase alpha subunit; Provisional	Back alignment and domain information

>PLN02591 tryptophan synthase	Back alignment and domain information

>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa	Back alignment and domain information

>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins	Back alignment and domain information

>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional	Back alignment and domain information

>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed	Back alignment and domain information

>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1	Back alignment and domain information

>TIGR00262 trpA tryptophan synthase, alpha subunit	Back alignment and domain information

>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism]	Back alignment and domain information

>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences	Back alignment and domain information

>cd04732 HisA HisA	Back alignment and domain information

>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional	Back alignment and domain information

>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate	Back alignment and domain information

>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional	Back alignment and domain information

>CHL00162 thiG thiamin biosynthesis protein G; Validated	Back alignment and domain information

>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed	Back alignment and domain information

>PRK07565 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated	Back alignment and domain information

>TIGR02708 L_lactate_ox L-lactate oxidase	Back alignment and domain information

>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase	Back alignment and domain information

>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase	Back alignment and domain information

>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase	Back alignment and domain information

>PRK13957 indole-3-glycerol-phosphate synthase; Provisional	Back alignment and domain information

>PRK07695 transcriptional regulator TenI; Provisional	Back alignment and domain information

>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed	Back alignment and domain information

>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2	Back alignment and domain information

>KOG2333 consensus Uncharacterized conserved protein [General function prediction only]	Back alignment and domain information

>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional	Back alignment and domain information

>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene []	Back alignment and domain information

>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein	Back alignment and domain information

>PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots []	Back alignment and domain information

>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed	Back alignment and domain information

>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed	Back alignment and domain information

>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2	Back alignment and domain information

>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain	Back alignment and domain information

>TIGR00734 hisAF_rel hisA/hisF family protein	Back alignment and domain information

>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase	Back alignment and domain information

>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water	Back alignment and domain information

>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein	Back alignment and domain information

>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase	Back alignment and domain information

>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate	Back alignment and domain information

>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1	Back alignment and domain information

>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit	Back alignment and domain information

>PRK05286 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>PLN02274 inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional	Back alignment and domain information

>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain	Back alignment and domain information

>cd02812 PcrB_like PcrB_like proteins	Back alignment and domain information

>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated	Back alignment and domain information

>PRK13111 trpA tryptophan synthase subunit alpha; Provisional	Back alignment and domain information

>PRK06843 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>PRK06801 hypothetical protein; Provisional	Back alignment and domain information

>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed	Back alignment and domain information

>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3	Back alignment and domain information

>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed	Back alignment and domain information

>PRK06806 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist	Back alignment and domain information

>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family	Back alignment and domain information

>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain	Back alignment and domain information

>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only]	Back alignment and domain information

>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional	Back alignment and domain information

>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed	Back alignment and domain information

>PRK10550 tRNA-dihydrouridine synthase C; Provisional	Back alignment and domain information

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain	Back alignment and domain information

>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed	Back alignment and domain information

>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK13523 NADPH dehydrogenase NamA; Provisional	Back alignment and domain information

>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain	Back alignment and domain information

>cd00452 KDPG_aldolase KDPG and KHG aldolase	Back alignment and domain information

>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed	Back alignment and domain information

>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4	Back alignment and domain information

>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family	Back alignment and domain information

>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed	Back alignment and domain information

>TIGR01163 rpe ribulose-phosphate 3-epimerase	Back alignment and domain information

>PRK11815 tRNA-dihydrouridine synthase A; Provisional	Back alignment and domain information

>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure	Back alignment and domain information

>COG0191 Fba Fructose/tagatose bisphosphate aldolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed	Back alignment and domain information

>TIGR01182 eda Entner-Doudoroff aldolase	Back alignment and domain information

>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4	Back alignment and domain information

>PRK08610 fructose-bisphosphate aldolase; Reviewed	Back alignment and domain information

>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed	Back alignment and domain information

>PRK07709 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed	Back alignment and domain information

>cd00945 Aldolase_Class_I Class I aldolases	Back alignment and domain information

>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain	Back alignment and domain information

>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes	Back alignment and domain information

>TIGR00167 cbbA ketose-bisphosphate aldolases	Back alignment and domain information

>PRK10415 tRNA-dihydrouridine synthase B; Provisional	Back alignment and domain information

>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ	Back alignment and domain information

>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional	Back alignment and domain information

>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>PLN02460 indole-3-glycerol-phosphate synthase	Back alignment and domain information

>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional	Back alignment and domain information

>PRK07807 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism]	Back alignment and domain information

>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial	Back alignment and domain information

>PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P)	Back alignment and domain information

>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed	Back alignment and domain information

>PRK05835 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism]	Back alignment and domain information

>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain	Back alignment and domain information

>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain	Back alignment and domain information

>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS)	Back alignment and domain information

>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases	Back alignment and domain information

>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type	Back alignment and domain information

>PRK12457 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional	Back alignment and domain information

>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain	Back alignment and domain information

>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2	Back alignment and domain information

>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional	Back alignment and domain information

>PF04309 G3P_antiterm: Glycerol-3-phosphate responsive antiterminator; InterPro: IPR006699 Glycerol enters bacterial cells via facilitated diffusion, an energy-independent transport process catalysed by the glycerol transport facilitator GlpF, an integral membrane protein of the aquaporin family	Back alignment and domain information

>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2	Back alignment and domain information

>cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD	Back alignment and domain information

>PRK13125 trpA tryptophan synthase subunit alpha; Provisional	Back alignment and domain information

>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI	Back alignment and domain information

>TIGR00742 yjbN tRNA dihydrouridine synthase A	Back alignment and domain information

>PLN02617 imidazole glycerol phosphate synthase hisHF	Back alignment and domain information

>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	Back alignment and domain information

>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism]	Back alignment and domain information

>cd00452 KDPG_aldolase KDPG and KHG aldolase	Back alignment and domain information

>PLN02826 dihydroorotate dehydrogenase	Back alignment and domain information

>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4	Back alignment and domain information

>PRK07084 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>COG1954 GlpP Glycerol-3-phosphate responsive antiterminator (mRNA-binding) [Transcription]	Back alignment and domain information

>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure	Back alignment and domain information

>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain	Back alignment and domain information

>PRK08883 ribulose-phosphate 3-epimerase; Provisional	Back alignment and domain information

>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only]	Back alignment and domain information

>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA)	Back alignment and domain information

>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein	Back alignment and domain information

>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only]	Back alignment and domain information

>PLN03033 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional	Back alignment and domain information

>cd02911 arch_FMN Archeal FMN-binding domain	Back alignment and domain information

>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS)	Back alignment and domain information

>PRK05437 isopentenyl pyrophosphate isomerase; Provisional	Back alignment and domain information

>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes	Back alignment and domain information

>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4	Back alignment and domain information

>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related	Back alignment and domain information

>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2	Back alignment and domain information

>TIGR00262 trpA tryptophan synthase, alpha subunit	Back alignment and domain information

>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4	Back alignment and domain information

>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain	Back alignment and domain information

>PLN02535 glycolate oxidase	Back alignment and domain information

>PRK11197 lldD L-lactate dehydrogenase; Provisional	Back alignment and domain information

>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5	Back alignment and domain information

>TIGR01362 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase	Back alignment and domain information

>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain	Back alignment and domain information

>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional	Back alignment and domain information

>PRK08649 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein	Back alignment and domain information

>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK11750 gltB glutamate synthase subunit alpha; Provisional	Back alignment and domain information

>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional	Back alignment and domain information

>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK07315 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>PRK07807 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>PRK05198 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional	Back alignment and domain information

>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II	Back alignment and domain information

>TIGR01182 eda Entner-Doudoroff aldolase	Back alignment and domain information

>PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed	Back alignment and domain information

>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional	Back alignment and domain information

>PRK00507 deoxyribose-phosphate aldolase; Provisional	Back alignment and domain information

>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed	Back alignment and domain information

>TIGR00693 thiE thiamine-phosphate pyrophosphorylase	Back alignment and domain information

>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated	Back alignment and domain information

>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway	Back alignment and domain information

>PRK14024 phosphoribosyl isomerase A; Provisional	Back alignment and domain information

>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain	Back alignment and domain information

>PRK04302 triosephosphate isomerase; Provisional	Back alignment and domain information

>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase	Back alignment and domain information

>PRK10605 N-ethylmaleimide reductase; Provisional	Back alignment and domain information

>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain	Back alignment and domain information

>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane	Back alignment and domain information

>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase	Back alignment and domain information

>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain	Back alignment and domain information

>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain	Back alignment and domain information

>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway	Back alignment and domain information

>PLN02858 fructose-bisphosphate aldolase	Back alignment and domain information

>cd00408 DHDPS-like Dihydrodipicolinate synthase family	Back alignment and domain information

>PF01116 F_bP_aldolase: Fructose-bisphosphate aldolase class-II; InterPro: IPR000771 Fructose-bisphosphate aldolase [, ] is a glycolytic enzyme that catalyses the reversible aldol cleavage or condensation of fructose-1,6-bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate	Back alignment and domain information

>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA)	Back alignment and domain information

>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1	Back alignment and domain information

>PLN02460 indole-3-glycerol-phosphate synthase	Back alignment and domain information

>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea	Back alignment and domain information

>PRK13125 trpA tryptophan synthase subunit alpha; Provisional	Back alignment and domain information

>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP)	Back alignment and domain information

>PLN02495 oxidoreductase, acting on the CH-CH group of donors	Back alignment and domain information

>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase	Back alignment and domain information

>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic	Back alignment and domain information

>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype	Back alignment and domain information

>COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism]	Back alignment and domain information

>TIGR02814 pfaD_fam PfaD family protein	Back alignment and domain information

>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type	Back alignment and domain information

>cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD	Back alignment and domain information

>PRK08999 hypothetical protein; Provisional	Back alignment and domain information

>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13957 indole-3-glycerol-phosphate synthase; Provisional	Back alignment and domain information

>PRK13399 fructose-1,6-bisphosphate aldolase; Provisional	Back alignment and domain information

>PTZ00413 lipoate synthase; Provisional	Back alignment and domain information

>KOG1606 consensus Stationary phase-induced protein, SOR/SNZ family [Coenzyme transport and metabolism]	Back alignment and domain information

>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa	Back alignment and domain information

>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE)	Back alignment and domain information

>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional	Back alignment and domain information

>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only]	Back alignment and domain information

>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase	Back alignment and domain information

>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional	Back alignment and domain information

>COG0069 GltB Glutamate synthase domain 2 [Amino acid transport and metabolism]	Back alignment and domain information

>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1	Back alignment and domain information

>PRK08185 hypothetical protein; Provisional	Back alignment and domain information

>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid)	Back alignment and domain information

>cd00945 Aldolase_Class_I Class I aldolases	Back alignment and domain information

>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases	Back alignment and domain information

>PRK08005 epimerase; Validated	Back alignment and domain information

>cd08565 GDPD_pAtGDE_like Glycerophosphodiester phosphodiesterase domain of putative Agrobacterium tumefaciens glycerophosphodiester phosphodiesterase and similar proteins	Back alignment and domain information

>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional	Back alignment and domain information

>cd08210 RLP_RrRLP Ribulose bisphosphate carboxylase like proteins (RLPs) similar to R	Back alignment and domain information

>PRK09197 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed	Back alignment and domain information

>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>cd08601 GDPD_SaGlpQ_like Glycerophosphodiester phosphodiesterase domain of Staphylococcus aureus and similar proteins	Back alignment and domain information

>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides	Back alignment and domain information

>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion]	Back alignment and domain information

>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily	Back alignment and domain information

>TIGR01163 rpe ribulose-phosphate 3-epimerase	Back alignment and domain information

>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed	Back alignment and domain information

>COG5564 Predicted TIM-barrel enzyme, possibly a dioxygenase [General function prediction only]	Back alignment and domain information

>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain	Back alignment and domain information

>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain	Back alignment and domain information

>TIGR02311 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase	Back alignment and domain information

>PRK03512 thiamine-phosphate pyrophosphorylase; Provisional	Back alignment and domain information

>COG0135 TrpF Phosphoribosylanthranilate isomerase [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional	Back alignment and domain information

>TIGR01520 FruBisAldo_II_A fructose-bisphosphate aldolase, class II, yeast/E	Back alignment and domain information

>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain	Back alignment and domain information

>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene []	Back alignment and domain information

>cd00946 FBP_aldolase_IIA Class II Type A, Fructose-1,6-bisphosphate (FBP) aldolases	Back alignment and domain information

>PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional	Back alignment and domain information

>PRK09722 allulose-6-phosphate 3-epimerase; Provisional	Back alignment and domain information

>cd08205 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase like proteins, Rubisco-Form IV	Back alignment and domain information

>PF01680 SOR_SNZ: SOR/SNZ family; InterPro: IPR001852 Snz1p is a highly conserved protein involved in growth arrest in Saccharomyces cerevisiae (Baker's yeast) []	Back alignment and domain information

>PRK08745 ribulose-phosphate 3-epimerase; Provisional	Back alignment and domain information

>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2	Back alignment and domain information

>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family	Back alignment and domain information

>PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase	Back alignment and domain information

>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>PRK07107 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>cd08583 PI-PLCc_GDPD_SF_unchar1 Uncharacterized hypothetical proteins similar to the catalytic domains of Phosphoinositide-specific phospholipaseand Glycerophosphodiester phosphodiesterases	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		263
1gyl_A		369	Involvement Of Tyr24 And Trp108 In Substrate Bindin		3e-75
1gox_A		370	Refined Structure Of Spinach Glycolate Oxidase At 2		8e-75
1al7_A		359	Three-Dimensional Structures Of Glycolate Oxidase W		1e-74
2rdt_A		387	Crystal Structure Of Human Glycolate Oxidase (Go) I		5e-53
2w0u_A		370	Crystal Structure Of Human Glycolate Oxidase In Com		6e-53
2nzl_A		392	Crystal Structure Of Human Hydroxyacid Oxidase 1 Le		6e-53
1szf_A		511	A198g:l230a Mutant Flavocytochrome B2 With Pyruvate		4e-44
1ldc_A		511	X-Ray Structure Of Two Complexes Of The Y143f Flavo		1e-43
1qcw_A		410	Flavocytochrome B2, Arg289lys Mutant Length = 410		3e-43
1sze_A		511	L230a Mutant Flavocytochrome B2 With Benzoylformate		3e-43
1kbj_A		412	Crystallographic Study Of The Recombinant Flavin-Bi		3e-43
1ltd_A		506	The 2.6 Angstroms Refined Structure Of The Escheric		3e-43
1fcb_A		511	Molecular Structure Of Flavocytochrome B2 At 2.4 An		3e-43
1tb3_A		352	Crystal Structure Analysis Of Recombinant Rat Kidne		4e-43
2oz0_A		511	Mechanistic And Structural Studies Of H373q Flavocy		3e-42
3sgz_A		352	High Resolution Crystal Structure Of Rat Long Chain		5e-42
1huv_A		380	Crystal Structure Of A Soluble Mutant Of The Membra		9e-41
2a7n_A		380	Crystal Structure Of The G81a Mutant Of The Active		6e-40
2cdh_0		226	Architecture Of The Thermomyces Lanuginosus Fungal		6e-35
2j6x_A		374	The Crystal Structure Of Lactate Oxidase Length = 3		1e-30
2nli_A		368	Crystal Structure Of The Complex Between L-Lactate		2e-30
2du2_A		374	Crystal Structure Analysis Of The L-Lactate Oxidase		2e-30

>pdb|1GYL|A Chain A, Involvement Of Tyr24 And Trp108 In Substrate Binding And Substrate Specificity Of Glycolate Oxidase Length = 369