Citrus Sinensis ID: 039477
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 92 | ||||||
| 13172242 | 156 | major latex-like protein [Prunus persica | 1.0 | 0.589 | 0.543 | 2e-21 | |
| 30698757 | 316 | MLP-like protein 34 [Arabidopsis thalian | 0.989 | 0.287 | 0.505 | 6e-20 | |
| 297789656 | 245 | hypothetical protein ARALYDRAFT_497302 [ | 0.978 | 0.367 | 0.494 | 8e-20 | |
| 297841835 | 316 | predicted protein [Arabidopsis lyrata su | 0.989 | 0.287 | 0.494 | 9e-20 | |
| 255587428 | 151 | Major latex protein, putative [Ricinus c | 0.934 | 0.569 | 0.522 | 3e-19 | |
| 255590991 | 151 | Major latex protein, putative [Ricinus c | 0.923 | 0.562 | 0.540 | 5e-19 | |
| 297841843 | 159 | bet v I allergen family protein [Arabido | 0.989 | 0.572 | 0.483 | 6e-19 | |
| 15223272 | 159 | polyketide cyclase, dehydrase and lipid | 0.989 | 0.572 | 0.494 | 1e-18 | |
| 224140773 | 120 | predicted protein [Populus trichocarpa] | 0.923 | 0.708 | 0.528 | 2e-18 | |
| 224111490 | 158 | predicted protein [Populus trichocarpa] | 0.989 | 0.575 | 0.510 | 1e-17 |
| >gi|13172242|gb|AAK14060.1|AF239177_1 major latex-like protein [Prunus persica] | Back alignment and taxonomy information |
|---|
Score = 106 bits (265), Expect = 2e-21, Method: Compositional matrix adjust.
Identities = 50/92 (54%), Positives = 64/92 (69%)
Query: 1 GSPQIAKEIIEAIDNENYITNYKVIEGNLLELYKSFSSTVKVTPKENDDGSLVHWIFEYE 60
G ++AKE+IEAID E + +KVIEG+LLE YKSF T+ TPK + GS+VHW EYE
Sbjct: 65 GKAKVAKELIEAIDAEKNLITFKVIEGDLLEHYKSFKITIHATPKAHGQGSIVHWTMEYE 124
Query: 61 KLNEDVPDPTGKLQILIDVAKDIDAHLLSQQP 92
K + D+ DP LQ +DV+KD+DAHL S Q
Sbjct: 125 KHHGDIEDPHTLLQFAVDVSKDVDAHLTSAQA 156
|
Source: Prunus persica Species: Prunus persica Genus: Prunus Family: Rosaceae Order: Rosales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|30698757|ref|NP_850976.1| MLP-like protein 34 [Arabidopsis thaliana] gi|79321108|ref|NP_001031265.1| MLP-like protein 34 [Arabidopsis thaliana] gi|21542143|sp|Q9SSK7.1|MLP34_ARATH RecName: Full=MLP-like protein 34 gi|5902401|gb|AAD55503.1|AC008148_13 Unknown protein [Arabidopsis thaliana] gi|13926294|gb|AAK49615.1|AF372899_1 At1g70850/F15H11_10 [Arabidopsis thaliana] gi|16197688|emb|CAC83579.1| major latex-like protein [Arabidopsis thaliana] gi|16323244|gb|AAL15356.1| At1g70850/F15H11_10 [Arabidopsis thaliana] gi|110740285|dbj|BAF02039.1| hypothetical protein [Arabidopsis thaliana] gi|332197006|gb|AEE35127.1| MLP-like protein 34 [Arabidopsis thaliana] gi|332197008|gb|AEE35129.1| MLP-like protein 34 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297789656|ref|XP_002862771.1| hypothetical protein ARALYDRAFT_497302 [Arabidopsis lyrata subsp. lyrata] gi|297308487|gb|EFH39029.1| hypothetical protein ARALYDRAFT_497302 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|297841835|ref|XP_002888799.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297334640|gb|EFH65058.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|255587428|ref|XP_002534267.1| Major latex protein, putative [Ricinus communis] gi|223525605|gb|EEF28116.1| Major latex protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255590991|ref|XP_002535412.1| Major latex protein, putative [Ricinus communis] gi|223523187|gb|EEF26971.1| Major latex protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297841843|ref|XP_002888803.1| bet v I allergen family protein [Arabidopsis lyrata subsp. lyrata] gi|297334644|gb|EFH65062.1| bet v I allergen family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15223272|ref|NP_177244.1| polyketide cyclase, dehydrase and lipid transport domain-containing protein [Arabidopsis thaliana] gi|16197678|emb|CAC83598.1| major latex-like protein [Arabidopsis thaliana] gi|26450352|dbj|BAC42292.1| unknown protein [Arabidopsis thaliana] gi|28972985|gb|AAO63817.1| putative Csf-2-related protein [Arabidopsis thaliana] gi|332197012|gb|AEE35133.1| polyketide cyclase, dehydrase and lipid transport domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224140773|ref|XP_002323753.1| predicted protein [Populus trichocarpa] gi|222866755|gb|EEF03886.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224111490|ref|XP_002315876.1| predicted protein [Populus trichocarpa] gi|222864916|gb|EEF02047.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 92 | ||||||
| TAIR|locus:2013930 | 316 | MLP34 "AT1G70850" [Arabidopsis | 0.989 | 0.287 | 0.505 | 1.1e-21 | |
| TAIR|locus:2013920 | 159 | AT1G70880 "AT1G70880" [Arabido | 0.978 | 0.566 | 0.521 | 2.7e-20 | |
| TAIR|locus:2014000 | 335 | MLP28 "AT1G70830" [Arabidopsis | 0.989 | 0.271 | 0.461 | 1.2e-19 | |
| TAIR|locus:2013950 | 158 | MLP43 "AT1G70890" [Arabidopsis | 0.989 | 0.575 | 0.439 | 2.5e-19 | |
| TAIR|locus:2013970 | 171 | MLP31 "AT1G70840" [Arabidopsis | 0.989 | 0.532 | 0.461 | 8.3e-19 | |
| TAIR|locus:2143809 | 166 | AT5G28010 "AT5G28010" [Arabido | 0.989 | 0.548 | 0.450 | 2.2e-18 | |
| TAIR|locus:2143804 | 164 | AT5G28000 "AT5G28000" [Arabido | 0.989 | 0.554 | 0.450 | 9.5e-18 | |
| TAIR|locus:2206737 | 152 | MLP165 "AT1G35260" [Arabidopsi | 0.978 | 0.592 | 0.417 | 4.7e-16 | |
| TAIR|locus:2206702 | 151 | MLP168 "AT1G35310" [Arabidopsi | 0.978 | 0.596 | 0.4 | 6.9e-15 | |
| UNIPROTKB|P85524 | 150 | P85524 "Kirola" [Actinidia del | 0.923 | 0.566 | 0.431 | 1.8e-14 |
| TAIR|locus:2013930 MLP34 "AT1G70850" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 253 (94.1 bits), Expect = 1.1e-21, P = 1.1e-21
Identities = 46/91 (50%), Positives = 67/91 (73%)
Query: 1 GSPQIAKEIIEAIDNENYITNYKVIEGNLLELYKSFSSTVKVTPKENDDGSLVHWIFEYE 60
G ++AKE IEA+D E + ++VIEG+L++ YKSF T++VTPK GS+VHW FEYE
Sbjct: 226 GEAKVAKERIEAVDPEKNLITFRVIEGDLMKEYKSFVITIQVTPKHGGSGSVVHWHFEYE 285
Query: 61 KLNEDVPDPTGKLQILIDVAKDIDAHLLSQQ 91
K+NE+V P LQ ++V+K+ID HLL+++
Sbjct: 286 KINEEVAHPETLLQFAVEVSKEIDEHLLAEE 316
|
|
| TAIR|locus:2013920 AT1G70880 "AT1G70880" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2014000 MLP28 "AT1G70830" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2013950 MLP43 "AT1G70890" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2013970 MLP31 "AT1G70840" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2143809 AT5G28010 "AT5G28010" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2143804 AT5G28000 "AT5G28000" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2206737 MLP165 "AT1G35260" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2206702 MLP168 "AT1G35310" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P85524 P85524 "Kirola" [Actinidia deliciosa (taxid:3627)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 92 | |||
| pfam00407 | 150 | pfam00407, Bet_v_1, Pathogenesis-related protein B | 3e-29 | |
| smart01037 | 151 | smart01037, Bet_v_1, Pathogenesis-related protein | 5e-28 | |
| cd07816 | 148 | cd07816, Bet_v1-like, Ligand-binding bet_v_1 domai | 3e-22 | |
| cd07821 | 140 | cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance | 1e-06 |
| >gnl|CDD|215904 pfam00407, Bet_v_1, Pathogenesis-related protein Bet v I family | Back alignment and domain information |
|---|
Score = 101 bits (254), Expect = 3e-29
Identities = 44/89 (49%), Positives = 63/89 (70%), Gaps = 1/89 (1%)
Query: 1 GSPQIAKEIIEAIDNENYITNYKVIEGNLLELYKSFSSTVKVTPKENDDGSLVHWIFEYE 60
G P++ KE IEA D +N Y V+EG++LE YKSF +T++V PK N GS+V W EYE
Sbjct: 62 GKPKVVKERIEADDEKNKTITYSVLEGDVLEDYKSFITTLQVIPKSNG-GSIVKWTIEYE 120
Query: 61 KLNEDVPDPTGKLQILIDVAKDIDAHLLS 89
K+ +DVP+P L+ ++ + KDI+AHLL+
Sbjct: 121 KIGDDVPEPEKYLKFVVKLTKDIEAHLLA 149
|
This family is named after Bet v 1, the major birch pollen allergen. This protein belongs to family 10 of plant pathogenesis-related proteins (PR-10), cytoplasmic proteins of 15-17 kd that are wide-spread among dicotyledonous plants. In recent years, a number of diverse plant proteins with low sequence similarity to Bet v 1 was identified. A classification by sequence similarity yielded several subfamilies related to PR-10: - Pathogenesis-related proteins PR-10: These proteins were identified as major tree pollen allergens in birch and related species (hazel, alder), as plant food allergens expressed in high levels in fruits, vegetables and seeds (apple, celery, hazelnut), and as pathogenesis-related proteins whose expression is induced by pathogen infection, wounding, or abiotic stress. Hyp-1, an enzyme involved in the synthesis of the bioactive naphthodianthrone hypericin in St. John's wort (Hypericum perforatum) also belongs to this family. Most of these proteins were found in dicotyledonous plants. In addition, related sequences were identified in monocots and conifers. - Cytokinin-specific binding proteins: These legume proteins bind cytokinin plant hormones. - (S)-Norcoclaurine synthases are enzymes catalyzing the condensation of dopamine and 4-hydroxyphenylacetaldehyde to (S)-norcoclaurine, the first committed step in the biosynthesis of benzylisoquinoline alkaloids such as morphine. -Major latex proteins and ripening-related proteins are proteins of unknown biological function that were first discovered in the latex of opium poppy (Papaver somniferum) and later found to be upregulated during ripening of fruits such as strawberry and cucumber. The occurrence of Bet v 1-related proteins is confined to seed plants with the exception of a cytokinin-binding protein from the moss Physcomitrella patens. Length = 150 |
| >gnl|CDD|198105 smart01037, Bet_v_1, Pathogenesis-related protein Bet v I family | Back alignment and domain information |
|---|
| >gnl|CDD|176858 cd07816, Bet_v1-like, Ligand-binding bet_v_1 domain of major pollen allergen of white birch (Betula verrucosa), Bet v 1, and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|176863 cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 92 | |||
| PF00407 | 151 | Bet_v_1: Pathogenesis-related protein Bet v I fami | 99.95 | |
| cd07816 | 148 | Bet_v1-like Ligand-binding bet_v_1 domain of major | 99.9 | |
| cd07821 | 140 | PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), | 98.67 | |
| cd08866 | 144 | SRPBCC_11 Ligand-binding SRPBCC domain of an uncha | 98.26 | |
| PF10604 | 139 | Polyketide_cyc2: Polyketide cyclase / dehydrase an | 98.14 | |
| cd08861 | 142 | OtcD1_ARO-CYC_like N-terminal and C-terminal aroma | 97.67 | |
| cd07822 | 141 | SRPBCC_4 Ligand-binding SRPBCC domain of an unchar | 97.22 | |
| cd07813 | 138 | COQ10p_like Coenzyme Q-binding protein COQ10p and | 97.13 | |
| cd07812 | 141 | SRPBCC START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SR | 97.05 | |
| cd08865 | 140 | SRPBCC_10 Ligand-binding SRPBCC domain of an uncha | 96.97 | |
| cd07825 | 144 | SRPBCC_7 Ligand-binding SRPBCC domain of an unchar | 96.94 | |
| cd07819 | 140 | SRPBCC_2 Ligand-binding SRPBCC domain of an unchar | 96.53 | |
| cd07814 | 139 | SRPBCC_CalC_Aha1-like Putative hydrophobic ligand- | 96.47 | |
| PRK10724 | 158 | hypothetical protein; Provisional | 96.22 | |
| cd07818 | 150 | SRPBCC_1 Ligand-binding SRPBCC domain of an unchar | 96.15 | |
| cd07817 | 139 | SRPBCC_8 Ligand-binding SRPBCC domain of an unchar | 96.12 | |
| cd05018 | 144 | CoxG Carbon monoxide dehydrogenase subunit G (CoxG | 95.94 | |
| cd07823 | 146 | SRPBCC_5 Ligand-binding SRPBCC domain of an unchar | 94.95 | |
| cd08862 | 138 | SRPBCC_Smu440-like Ligand-binding SRPBCC domain of | 94.06 | |
| cd07820 | 137 | SRPBCC_3 Ligand-binding SRPBCC domain of an unchar | 93.28 | |
| COG3427 | 146 | Carbon monoxide dehydrogenase subunit G, CoxG [Ene | 91.1 | |
| cd08899 | 157 | SRPBCC_CalC_Aha1-like_6 Putative hydrophobic ligan | 90.06 | |
| PF06240 | 140 | COXG: Carbon monoxide dehydrogenase subunit G (Cox | 89.94 | |
| cd07826 | 142 | SRPBCC_CalC_Aha1-like_9 Putative hydrophobic ligan | 88.98 | |
| COG2867 | 146 | Oligoketide cyclase/lipid transport protein [Lipid | 88.82 | |
| cd08894 | 139 | SRPBCC_CalC_Aha1-like_1 Putative hydrophobic ligan | 88.63 | |
| cd07824 | 146 | SRPBCC_6 Ligand-binding SRPBCC domain of an unchar | 88.47 | |
| cd08898 | 145 | SRPBCC_CalC_Aha1-like_5 Putative hydrophobic ligan | 87.39 | |
| cd08900 | 143 | SRPBCC_CalC_Aha1-like_7 Putative hydrophobic ligan | 84.85 | |
| cd08895 | 146 | SRPBCC_CalC_Aha1-like_2 Putative hydrophobic ligan | 84.84 | |
| cd08896 | 146 | SRPBCC_CalC_Aha1-like_3 Putative hydrophobic ligan | 84.47 | |
| cd08891 | 149 | SRPBCC_CalC Ligand-binding SRPBCC domain of Microm | 81.72 | |
| cd08860 | 146 | TcmN_ARO-CYC_like N-terminal aromatase/cyclase dom | 81.56 | |
| cd08893 | 136 | SRPBCC_CalC_Aha1-like_GntR-HTH Putative hydrophobi | 80.28 | |
| PF03364 | 130 | Polyketide_cyc: Polyketide cyclase / dehydrase and | 80.17 |
| >PF00407 Bet_v_1: Pathogenesis-related protein Bet v I family; InterPro: IPR000916 Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms | Back alignment and domain information |
|---|
Probab=99.95 E-value=1.2e-26 Score=153.82 Aligned_cols=89 Identities=46% Similarity=0.726 Sum_probs=84.7
Q ss_pred CCceeEEEEEEEeeCCCCEEEEEEEecccccceeEEEEEEEEEeeCCCCceEEEEEEEEEEcCCCCCChhhHHHHHHHHH
Q 039477 1 GSPQIAKEIIEAIDNENYITNYKVIEGNLLELYKSFSSTVKVTPKENDDGSLVHWIFEYEKLNEDVPDPTGKLQILIDVA 80 (92)
Q Consensus 1 g~~~~~kErl~~~D~~~~~~~y~i~eg~~~~~~~~~~~ti~v~p~~~g~~~~v~W~~~ye~~~~~~~~~~~~~~~~~~~~ 80 (92)
|++.++|||++++|+++|+++|+++||+++..+.+|.++++++|.++| +|+++|+++|++.++..++|+.+++++.+|+
T Consensus 63 ~~~~~~Kekve~~D~~~~~~~y~viEGd~l~~~~~~~~~~~~~~~~~g-~~v~k~t~~Ye~~~~~~~~p~~~~~~~~~~~ 141 (151)
T PF00407_consen 63 GPFKYVKEKVEAIDEENKTITYTVIEGDVLGDYKSFKSTIQKIPKGDG-GCVVKWTIEYEKKGEDVPPPEKYLDFAVGMF 141 (151)
T ss_dssp SSEEEEEEEEEEEETTTTEEEEEEEEETTGTTTEEEEEEEEEEEETTS-CEEEEEEEEEEESSTSCHHHHHHHHHHHHHH
T ss_pred CCcceeEEEEEeecCCCcEEEEEEEeccccccEEEEEEEEEecCCCCC-ceEEEEEEEEEecCCCCCCcHHHHHHHHHHH
Confidence 567899999999999999999999999999889999999999999888 8999999999999998888999999999999
Q ss_pred HHHHHHHhcC
Q 039477 81 KDIDAHLLSQ 90 (92)
Q Consensus 81 k~ie~~l~~~ 90 (92)
|+||+||++|
T Consensus 142 K~ieayLlan 151 (151)
T PF00407_consen 142 KAIEAYLLAN 151 (151)
T ss_dssp HHHHHHHHHT
T ss_pred HHHHHHHhcC
Confidence 9999999997
|
A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation. The allergens in this family include allergens with the following designations: Aln g 1, Api g 1, Bet v 1, Car b 1, Cor a 1, Dau c 1, Mal d 1 and Pru a 1. Trees within the order Fagales possess particularly potent allergens, e.g. Bet v1, the major White Birch (Betula verrucosa) pollen antigen. Bet v1 is the main cause of type I allergies observed in early spring. Type I, or immunoglobulin E-mediated (IgE-mediated) allergies affect 1 in 5 people in Europe and North America. Commonly-observed symptoms are hay fever, dermatitis, asthma and, in severe cases, anaphylactic shock. First contact with these allergens results in sensitisation; subsequent contact produces a cross-linking reaction of IgE on mast cells and concomitant release of histamine. The inevitable symptoms of an allergic reaction ensue. Recent NMR analysis [] has confirmed earlier predictions of the protein structure and site of the major T-cell epitope []. The Bet v1 protein comprises 6 anti-parallel beta-strands and 3 alpha-helices. Four of the strands dominate the global fold, and 2 of the helices form a C-terminal amphipathic helical motif. This motif is believed to be the T-cell epitope. Other proteins belonging to this family include the major pollen allergens: Aln g I from Alnus glutinosa (Alder); Api G I from Apium graveolens (Celery); Car b I from Carpinus betulus (European hornbeam); Cor a I from Corylus avellana (European hazel); Mal d I from Malus domestica (Apple). The motif is also found in: the wound-induced protein AoPR1 from Asparagus officinalis (Garden asparagus); pathogenesis-related proteins from Phaseolus vulgaris (Kidney bean) and Petroselinum crispum (Parsley) (PR1-1 and PR1-3); the disease resistance response proteins, STH-2 and STH-21, from Solanum tuberosum (Potato) and pI49, pI176 and DRRG49-C from Pisum sativum (Garden pea); the P. sativum abscisic acid-responsive proteins ABR17 and ABR18; and the stress-induced protein SAM22 from Glycine max (Soybean). ; GO: 0006952 defense response, 0009607 response to biotic stimulus; PDB: 1IFV_A 4A8V_A 4A8U_A 2K7H_A 2QIM_A 3E85_A 1H2O_A 1E09_A 1QMR_A 1FSK_D .... |
| >cd07816 Bet_v1-like Ligand-binding bet_v_1 domain of major pollen allergen of white birch (Betula verrucosa), Bet v 1, and related proteins | Back alignment and domain information |
|---|
| >cd07821 PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins | Back alignment and domain information |
|---|
| >cd08866 SRPBCC_11 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >PF10604 Polyketide_cyc2: Polyketide cyclase / dehydrase and lipid transport; InterPro: IPR019587 This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis | Back alignment and domain information |
|---|
| >cd08861 OtcD1_ARO-CYC_like N-terminal and C-terminal aromatase/cyclase domains of Streptomyces rimosus OtcD1 and related domains | Back alignment and domain information |
|---|
| >cd07822 SRPBCC_4 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd07813 COQ10p_like Coenzyme Q-binding protein COQ10p and similar proteins | Back alignment and domain information |
|---|
| >cd07812 SRPBCC START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC) ligand-binding domain superfamily | Back alignment and domain information |
|---|
| >cd08865 SRPBCC_10 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd07825 SRPBCC_7 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd07819 SRPBCC_2 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd07814 SRPBCC_CalC_Aha1-like Putative hydrophobic ligand-binding SRPBCC domain of Micromonospora echinospora CalC, human Aha1, and related proteins | Back alignment and domain information |
|---|
| >PRK10724 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd07818 SRPBCC_1 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd07817 SRPBCC_8 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd05018 CoxG Carbon monoxide dehydrogenase subunit G (CoxG) | Back alignment and domain information |
|---|
| >cd07823 SRPBCC_5 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd08862 SRPBCC_Smu440-like Ligand-binding SRPBCC domain of Streptococcus mutans Smu | Back alignment and domain information |
|---|
| >cd07820 SRPBCC_3 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >COG3427 Carbon monoxide dehydrogenase subunit G, CoxG [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd08899 SRPBCC_CalC_Aha1-like_6 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >PF06240 COXG: Carbon monoxide dehydrogenase subunit G (CoxG); InterPro: IPR010419 The CO dehydrogenase structural genes coxMSL are flanked by nine accessory genes arranged as the cox gene cluster | Back alignment and domain information |
|---|
| >cd07826 SRPBCC_CalC_Aha1-like_9 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >COG2867 Oligoketide cyclase/lipid transport protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd08894 SRPBCC_CalC_Aha1-like_1 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >cd07824 SRPBCC_6 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins | Back alignment and domain information |
|---|
| >cd08898 SRPBCC_CalC_Aha1-like_5 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >cd08900 SRPBCC_CalC_Aha1-like_7 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >cd08895 SRPBCC_CalC_Aha1-like_2 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >cd08896 SRPBCC_CalC_Aha1-like_3 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins | Back alignment and domain information |
|---|
| >cd08891 SRPBCC_CalC Ligand-binding SRPBCC domain of Micromonospora echinospora CalC and related proteins | Back alignment and domain information |
|---|
| >cd08860 TcmN_ARO-CYC_like N-terminal aromatase/cyclase domain of the multifunctional protein tetracenomycin (TcmN) and related domains | Back alignment and domain information |
|---|
| >cd08893 SRPBCC_CalC_Aha1-like_GntR-HTH Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins; some contain an N-terminal GntR family winged HTH DNA-binding domain | Back alignment and domain information |
|---|
| >PF03364 Polyketide_cyc: Polyketide cyclase / dehydrase and lipid transport; InterPro: IPR005031 Members of this family of enzymes from Streptomyces spp | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 92 | ||||
| 2i9y_A | 166 | Solution Structure Of Arabidopsis Thaliana Protein | 5e-20 | ||
| 1vjh_A | 122 | Crystal Structure Of Gene Product Of At1g24000 From | 5e-04 |
| >pdb|2I9Y|A Chain A, Solution Structure Of Arabidopsis Thaliana Protein At1g70830, A Member Of The Major Latex Protein Family Length = 166 | Back alignment and structure |
|
| >pdb|1VJH|A Chain A, Crystal Structure Of Gene Product Of At1g24000 From Arabidopsis Thaliana Length = 122 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 92 | |||
| 1vjh_A | 122 | BET V I allergen family; structural genomics, cent | 4e-31 | |
| 2i9y_A | 166 | Major latex protein-like protein 28 or MLP-like pr | 2e-28 | |
| 2flh_A | 155 | Cytokinin-specific binding protein; zeatin, pathog | 1e-17 | |
| 2vq5_A | 201 | S-norcoclaurine synthase; lyase, S- norcoclaurine | 1e-16 | |
| 3rws_A | 168 | MTN13 protein; zeatin, cytokinin, hormone, lucerne | 6e-15 | |
| 1icx_A | 155 | Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, | 2e-14 | |
| 2vjg_A | 154 | Major allergen DAU C 1; major carrot allergen, pat | 1e-13 | |
| 1e09_A | 159 | PRU AV 1; allergen, major cherry allergen, pathoge | 2e-13 | |
| 4a8u_A | 159 | Major pollen allergen BET V 1-J; PR-10 protein; 1. | 2e-13 | |
| 1tw0_A | 157 | Pathogenesis-related class 10 protein SPE-16; seve | 2e-12 | |
| 2qim_A | 158 | PR10.2B; trans-zeatin, cytokinin, plant hormones, | 2e-12 | |
| 3ie5_A | 165 | Phenolic oxidative coupling protein HYP-1; hyperic | 9e-12 | |
| 3qrz_A | 223 | Abscisic acid receptor PYL5; crystal, hormone rece | 8e-08 | |
| 3f08_A | 146 | Uncharacterized protein Q6HG14; NESG Q6HG14_bachk | 5e-07 | |
| 3p51_A | 160 | Uncharacterized protein; structural genomics, PSI- | 6e-07 | |
| 3kl1_A | 190 | PYL2, putative uncharacterized protein AT2G26040; | 3e-06 | |
| 3rt2_A | 183 | Abscisic acid receptor PYL10; ABA-independent PP2C | 9e-06 | |
| 3jrs_A | 208 | PYL1, putative uncharacterized protein AT5G46790; | 2e-05 | |
| 3k3k_A | 211 | Abscisic acid receptor PYR1; ABA receptor, plant h | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-04 | |
| 3oqu_A | 205 | Abscisic acid receptor PYL9; RCAR1, hormone recept | 8e-04 |
| >1vjh_A BET V I allergen family; structural genomics, center for eukaryotic structural genomics, protein structure initiative, CESG, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.129.3.1 PDB: 2q3q_A Length = 122 | Back alignment and structure |
|---|
Score = 105 bits (262), Expect = 4e-31
Identities = 23/89 (25%), Positives = 44/89 (49%)
Query: 3 PQIAKEIIEAIDNENYITNYKVIEGNLLELYKSFSSTVKVTPKENDDGSLVHWIFEYEKL 62
+ K IEA+D ++ + + +K+ ++ VTP DGS V W F +EK+
Sbjct: 33 EKNGKTEIEAVDLVKKTMTIQMSGSEIQKYFKTLKGSIAVTPIGVGDGSHVVWTFHFEKV 92
Query: 63 NEDVPDPTGKLQILIDVAKDIDAHLLSQQ 91
++D+ DP + + K +D +L+ +
Sbjct: 93 HKDIDDPHSIIDESVKYFKKLDEAILNFK 121
|
| >2i9y_A Major latex protein-like protein 28 or MLP-like protein 28; AT1G70830, BET V1-like, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Length = 166 | Back alignment and structure |
|---|
| >2flh_A Cytokinin-specific binding protein; zeatin, pathogenesis-related proteins, multiple- ligand binding, plant protein; HET: ZEA; 1.20A {Vigna radiata} PDB: 3c0v_A* Length = 155 | Back alignment and structure |
|---|
| >2vq5_A S-norcoclaurine synthase; lyase, S- norcoclaurine biosynthesis, dopamine, hydroxybenzaldehyde; HET: MSE LDP HBA; 2.09A {Thalictrum flavum} PDB: 2vne_A* Length = 201 | Back alignment and structure |
|---|
| >1icx_A Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, C-terminal helix, allergen; 1.95A {Lupinus luteus} SCOP: d.129.3.1 PDB: 1ifv_A Length = 155 | Back alignment and structure |
|---|
| >1e09_A PRU AV 1; allergen, major cherry allergen, pathogenesis-related protein, heteronuclear structure; NMR {Prunus avium} SCOP: d.129.3.1 PDB: 1h2o_A 2lpx_A Length = 159 | Back alignment and structure |
|---|
| >4a8u_A Major pollen allergen BET V 1-J; PR-10 protein; 1.16A {Betula pendula} PDB: 4a8v_A* 4a87_A* 4a81_A* 4a80_A* 4a83_A* 4a86_A* 4a85_A* 4a88_A 4a8g_A* 1b6f_A 1btv_A 1bv1_A 1fsk_A 4a84_A* 1llt_A 1fm4_A* 3k78_A 1qmr_A Length = 159 | Back alignment and structure |
|---|
| >1tw0_A Pathogenesis-related class 10 protein SPE-16; seven antiparallel beta-sheet, plant protein; 2.20A {Pachyrhizus erosus} SCOP: d.129.3.1 PDB: 1txc_A* Length = 157 | Back alignment and structure |
|---|
| >2qim_A PR10.2B; trans-zeatin, cytokinin, plant hormones, plant protein, PR-1 protein, pathogenesis-related protein, allergen; HET: ZEA; 1.35A {Lupinus luteus} PDB: 3e85_A* 1xdf_A* 2k7h_A Length = 158 | Back alignment and structure |
|---|
| >3ie5_A Phenolic oxidative coupling protein HYP-1; hypericin, ST JOHN'S WORT, depression, allergy, PR-10 protein, cytokinin, plant hormones; HET: PGE PG4 PE8 1PE; 1.69A {Hypericum perforatum} Length = 165 | Back alignment and structure |
|---|
| >3f08_A Uncharacterized protein Q6HG14; NESG Q6HG14_bachk Q6HG14 BUR153, structural genomics, PSI-2; 2.20A {Bacillus thuringiensis serovar konkukiorganism_taxid} PDB: 3cnw_A Length = 146 | Back alignment and structure |
|---|
| >3p51_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 2.06A {Nitrosospira multiformis} Length = 160 | Back alignment and structure |
|---|
| >3kl1_A PYL2, putative uncharacterized protein AT2G26040; abscisic acid receptor, crystal, high resolution, PP2C, HORM receptor; 1.55A {Arabidopsis thaliana} PDB: 3kdi_A* 3kdh_A 3nr4_A* 3ns2_A* 3nj0_A* 3nj1_A* 3nmh_A* 3kaz_A 3kb0_A* 3kb3_A* 3ujl_A* 3nmp_A* 3nmt_A* 3nmv_A* Length = 190 | Back alignment and structure |
|---|
| >3rt2_A Abscisic acid receptor PYL10; ABA-independent PP2C inhibitor, PP2CS, hydrolase inhibitor; 1.50A {Arabidopsis thaliana} PDB: 3r6p_A* 3qtj_A* 3uqh_A 3rt0_C Length = 183 | Back alignment and structure |
|---|
| >3jrs_A PYL1, putative uncharacterized protein AT5G46790; plant hormone receptor, abscisic acid, hormone recepto; HET: A8S; 2.05A {Arabidopsis thaliana} Length = 208 | Back alignment and structure |
|---|
| >3k3k_A Abscisic acid receptor PYR1; ABA receptor, plant hormone receptor, A sensor, drought tolerance, plant development; HET: A8S; 1.70A {Arabidopsis thaliana} PDB: 3njo_A* 3qn1_A* 3k90_A* 3jrq_B* 3kdj_A* 3nef_A* 3neg_A* 3nmn_A* 3kay_A* Length = 211 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3oqu_A Abscisic acid receptor PYL9; RCAR1, hormone receptor; HET: A8S; 2.68A {Arabidopsis thaliana} Length = 205 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 92 | |||
| 4a8u_A | 159 | Major pollen allergen BET V 1-J; PR-10 protein; 1. | 99.96 | |
| 2wql_A | 154 | Major allergen DAU C 1; pathogenesis-related prote | 99.96 | |
| 2vjg_A | 154 | Major allergen DAU C 1; major carrot allergen, pat | 99.96 | |
| 3rws_A | 168 | MTN13 protein; zeatin, cytokinin, hormone, lucerne | 99.95 | |
| 3ie5_A | 165 | Phenolic oxidative coupling protein HYP-1; hyperic | 99.95 | |
| 1vjh_A | 122 | BET V I allergen family; structural genomics, cent | 99.95 | |
| 2i9y_A | 166 | Major latex protein-like protein 28 or MLP-like pr | 99.95 | |
| 1tw0_A | 157 | Pathogenesis-related class 10 protein SPE-16; seve | 99.95 | |
| 2qim_A | 158 | PR10.2B; trans-zeatin, cytokinin, plant hormones, | 99.94 | |
| 1e09_A | 159 | PRU AV 1; allergen, major cherry allergen, pathoge | 99.94 | |
| 2flh_A | 155 | Cytokinin-specific binding protein; zeatin, pathog | 99.94 | |
| 1icx_A | 155 | Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, | 99.94 | |
| 2vq5_A | 201 | S-norcoclaurine synthase; lyase, S- norcoclaurine | 99.94 | |
| 3rt2_A | 183 | Abscisic acid receptor PYL10; ABA-independent PP2C | 99.73 | |
| 3jrs_A | 208 | PYL1, putative uncharacterized protein AT5G46790; | 99.73 | |
| 3p51_A | 160 | Uncharacterized protein; structural genomics, PSI- | 99.68 | |
| 3f08_A | 146 | Uncharacterized protein Q6HG14; NESG Q6HG14_bachk | 99.68 | |
| 3k3k_A | 211 | Abscisic acid receptor PYR1; ABA receptor, plant h | 99.67 | |
| 3kl1_A | 190 | PYL2, putative uncharacterized protein AT2G26040; | 99.66 | |
| 3oqu_A | 205 | Abscisic acid receptor PYL9; RCAR1, hormone recept | 99.61 | |
| 3oji_A | 189 | Abscisic acid receptor PYL3; crystal, PP2C, pyraba | 99.58 | |
| 3qrz_A | 223 | Abscisic acid receptor PYL5; crystal, hormone rece | 99.58 | |
| 2le1_A | 151 | Uncharacterized protein; structural genomics, nort | 99.32 | |
| 3tl1_A | 159 | WHIE ORF VI, polyketide cyclase; helix-GRIP fold, | 98.25 | |
| 3tvq_A | 169 | Multifunctional cyclase-dehydratase-3-O-methyl TR | 98.21 | |
| 3tfz_A | 172 | Cyclase; helix-GRIP, BET V1-like superfamily, bios | 98.16 | |
| 2d4r_A | 147 | Hypothetical protein TTHA0849; start domain, struc | 97.92 | |
| 3p9v_A | 161 | Uncharacterized protein; structural genomics, PSI- | 97.89 | |
| 1t17_A | 148 | Conserved hypothetical protein; beta-alpha-beta-BE | 97.0 | |
| 2pcs_A | 162 | Conserved protein; structural genomics, unknown fu | 96.98 | |
| 3ijt_A | 155 | SMU.440, putative uncharacterized protein; hypothe | 96.89 | |
| 3ggn_A | 155 | Uncharacterized protein DR_A0006; structural genom | 96.66 | |
| 2ns9_A | 157 | Hypothetical protein APE2225; uncharacterized cons | 96.5 | |
| 1z94_A | 147 | Conserved hypothetical protein; NESG, CV1439, stru | 94.8 | |
| 1xn6_A | 143 | Hypothetical protein BC4709; structural genomics, | 94.69 | |
| 1xuv_A | 178 | Hypothetical protein MM0500; alpha-beta protein, n | 94.57 | |
| 2il5_A | 171 | Hypothetical protein; structural genomics, APC2365 | 94.28 | |
| 2leq_A | 146 | Uncharacterized protein; start domains, structural | 93.89 | |
| 3put_A | 166 | Hypothetical conserved protein; structural genomic | 92.97 | |
| 3rd6_A | 161 | MLL3558 protein; structural genomics, PSI-biology, | 90.17 | |
| 2lak_A | 160 | AHSA1-like protein RHE_CH02687; NESG, structural g | 89.47 | |
| 3q64_A | 162 | MLL3774 protein; structural genomics, PSI-biology, | 89.39 | |
| 2lcg_A | 142 | Uncharacterized protein; start domain, structural | 88.31 | |
| 3qsz_A | 189 | STAR-related lipid transfer protein; structural ge | 87.49 | |
| 3q6a_A | 135 | Uncharacterized protein; structural genomics, PSI- | 86.58 | |
| 3pu2_A | 164 | Uncharacterized protein; SRPBCC superfamily, PSI-b | 83.65 | |
| 2l8o_A | 144 | Uncharacterized protein; mixed alpha-beta protein, | 83.0 | |
| 3uid_A | 168 | Putative uncharacterized protein; SRPBCC superfami | 82.41 |
| >4a8u_A Major pollen allergen BET V 1-J; PR-10 protein; 1.16A {Betula pendula} PDB: 4a8v_A* 4a87_A* 4a81_A* 4a80_A* 4a83_A* 4a86_A* 4a85_A* 4a88_A 4a8g_A* 1b6f_A 1btv_A 1bv1_A 1fsk_A 4a84_A* 1llt_A 1fm4_A* 3k78_A 1qmr_A | Back alignment and structure |
|---|
Probab=99.96 E-value=2.8e-28 Score=161.56 Aligned_cols=91 Identities=18% Similarity=0.314 Sum_probs=82.9
Q ss_pred CCceeEEEEEEEeeCCCCEEEEEEEecccc-cceeEEEEEEEEEeeCCCCceEEEEEEEEEEcCCCCCChhhH---HHHH
Q 039477 1 GSPQIAKEIIEAIDNENYITNYKVIEGNLL-ELYKSFSSTVKVTPKENDDGSLVHWIFEYEKLNEDVPDPTGK---LQIL 76 (92)
Q Consensus 1 g~~~~~kErl~~~D~~~~~~~y~i~eg~~~-~~~~~~~~ti~v~p~~~g~~~~v~W~~~ye~~~~~~~~~~~~---~~~~ 76 (92)
|+++++||||+++|+++|+++|+++||+++ .+|++|+++++|+|.++| ||+|+|+++|++.++..++|+.+ ++.+
T Consensus 62 ~~~~~~kErl~~iD~~~~~~~y~iiegd~l~~~~~~y~~ti~v~p~~~g-gs~v~wt~~y~~~~~~~~~~~~~k~~~~~~ 140 (159)
T 4a8u_A 62 FPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNG-GSILKINNKYHTKGDHEVKAEQIKASKEMG 140 (159)
T ss_dssp SSCSEEEEEEEEEETTTTEEEEEEEEETTCBTTEEEEEEEEEEEECTTS-CEEEEEEEEEEESSSCCC-CHHHHHHHHHH
T ss_pred CCccEEEEEEEEEccccCEEEEEEeeCCCCccceEEEEEEEEEEECCCC-ceEEEEEEEEEECCCCcCCHHHHHHHHHHH
Confidence 356799999999999999999999999987 779999999999998877 89999999999999988888765 7788
Q ss_pred HHHHHHHHHHHhcCCC
Q 039477 77 IDVAKDIDAHLLSQQP 92 (92)
Q Consensus 77 ~~~~k~ie~~l~~~~~ 92 (92)
.+|||+||+||++||.
T Consensus 141 ~~~~k~ie~yll~np~ 156 (159)
T 4a8u_A 141 ETLLRAVESYLLAHSD 156 (159)
T ss_dssp HHHHHHHHHHHHHCTT
T ss_pred HHHHHHHHHHHhhChh
Confidence 9999999999999994
|
| >2wql_A Major allergen DAU C 1; pathogenesis-related protein, plant defense; HET: P4C; 2.70A {Daucus carota} PDB: 2bk0_A | Back alignment and structure |
|---|
| >3ie5_A Phenolic oxidative coupling protein HYP-1; hypericin, ST JOHN'S WORT, depression, allergy, PR-10 protein, cytokinin, plant hormones; HET: PGE PG4 PE8 1PE; 1.69A {Hypericum perforatum} SCOP: d.129.3.0 | Back alignment and structure |
|---|
| >1vjh_A BET V I allergen family; structural genomics, center for eukaryotic structural genomics, protein structure initiative, CESG, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.129.3.1 PDB: 2q3q_A | Back alignment and structure |
|---|
| >2i9y_A Major latex protein-like protein 28 or MLP-like protein 28; AT1G70830, BET V1-like, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1tw0_A Pathogenesis-related class 10 protein SPE-16; seven antiparallel beta-sheet, plant protein; 2.20A {Pachyrhizus erosus} SCOP: d.129.3.1 PDB: 1txc_A* | Back alignment and structure |
|---|
| >2qim_A PR10.2B; trans-zeatin, cytokinin, plant hormones, plant protein, PR-1 protein, pathogenesis-related protein, allergen; HET: ZEA; 1.35A {Lupinus luteus} PDB: 3e85_A* 1xdf_A* 2k7h_A | Back alignment and structure |
|---|
| >1e09_A PRU AV 1; allergen, major cherry allergen, pathogenesis-related protein, heteronuclear structure; NMR {Prunus avium} SCOP: d.129.3.1 PDB: 1h2o_A 2lpx_A | Back alignment and structure |
|---|
| >2flh_A Cytokinin-specific binding protein; zeatin, pathogenesis-related proteins, multiple- ligand binding, plant protein; HET: ZEA; 1.20A {Vigna radiata} PDB: 3c0v_A* | Back alignment and structure |
|---|
| >1icx_A Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, C-terminal helix, allergen; 1.95A {Lupinus luteus} SCOP: d.129.3.1 PDB: 1ifv_A | Back alignment and structure |
|---|
| >2vq5_A S-norcoclaurine synthase; lyase, S- norcoclaurine biosynthesis, dopamine, hydroxybenzaldehyde; HET: MSE LDP HBA; 2.09A {Thalictrum flavum} PDB: 2vne_A* | Back alignment and structure |
|---|
| >3rt2_A Abscisic acid receptor PYL10; ABA-independent PP2C inhibitor, PP2CS, hydrolase inhibitor; 1.50A {Arabidopsis thaliana} PDB: 3r6p_A* 3qtj_A* 3uqh_A 3rt0_C | Back alignment and structure |
|---|
| >3jrs_A PYL1, putative uncharacterized protein AT5G46790; plant hormone receptor, abscisic acid, hormone recepto; HET: A8S; 2.05A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3p51_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 2.06A {Nitrosospira multiformis} | Back alignment and structure |
|---|
| >3f08_A Uncharacterized protein Q6HG14; NESG Q6HG14_bachk Q6HG14 BUR153, structural genomics, PSI-2; 2.20A {Bacillus thuringiensis serovar konkukiorganism_taxid} SCOP: d.129.3.8 PDB: 3cnw_A | Back alignment and structure |
|---|
| >3k3k_A Abscisic acid receptor PYR1; ABA receptor, plant hormone receptor, A sensor, drought tolerance, plant development; HET: A8S; 1.70A {Arabidopsis thaliana} PDB: 3njo_A* 3qn1_A* 3k90_A* 3zvu_A* 3jrq_B* 3kdj_A* 3nef_A* 3neg_A* 3nmn_A* 3kay_A* | Back alignment and structure |
|---|
| >3kl1_A PYL2, putative uncharacterized protein AT2G26040; abscisic acid receptor, crystal, high resolution, PP2C, HORM receptor; 1.55A {Arabidopsis thaliana} PDB: 3kdi_A* 3kdh_A 3nr4_A* 3ns2_A* 3nj0_A* 3nj1_A* 3nmh_A* 3kaz_A 3kb0_A* 3kb3_A* 3ujl_A* 3nmp_A* 3nmt_A* 3nmv_A* | Back alignment and structure |
|---|
| >3oqu_A Abscisic acid receptor PYL9; RCAR1, hormone receptor; HET: A8S; 2.68A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3oji_A Abscisic acid receptor PYL3; crystal, PP2C, pyrabactin, HOR receptor; HET: PYV; 1.84A {Arabidopsis thaliana} PDB: 4ds8_A* 3klx_A* 4dsb_A* 4dsc_A* | Back alignment and structure |
|---|
| >2le1_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, unknown function; NMR {Thermobifida fusca} | Back alignment and structure |
|---|
| >3tl1_A WHIE ORF VI, polyketide cyclase; helix-GRIP fold, polyketide C9-C14 aromatase/cyclase, linear beta-ketone intermediate; HET: JRO; 1.80A {Streptomyces coelicolor} PDB: 3tvr_A 2kf2_A | Back alignment and structure |
|---|
| >3tvq_A Multifunctional cyclase-dehydratase-3-O-methyl TR TCMN; tetracenomycin, aromatase, taxifolin, dihyroquercet helix-GRIP fold; HET: DQH; 1.67A {Streptomyces glaucescens} PDB: 2rer_A 2res_A 2rez_A | Back alignment and structure |
|---|
| >3tfz_A Cyclase; helix-GRIP, BET V1-like superfamily, biosynthetic protein; HET: CXS; 2.39A {Streptomyces SP} | Back alignment and structure |
|---|
| >2d4r_A Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.40A {Thermus thermophilus} SCOP: d.129.3.6 | Back alignment and structure |
|---|
| >3p9v_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.78A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >1t17_A Conserved hypothetical protein; beta-alpha-beta-BETA-beta-BETA-beta-BETA-helix, structural G protein structure initiative, PSI, NESG; NMR {Caulobacter crescentus} SCOP: d.129.3.6 | Back alignment and structure |
|---|
| >2pcs_A Conserved protein; structural genomics, unknown function, ligand binding, PSI-2 structure initiative; HET: UNL; 2.40A {Geobacillus kaustophilus} SCOP: d.129.3.10 | Back alignment and structure |
|---|
| >3ijt_A SMU.440, putative uncharacterized protein; hypothetical protein, unknown function; 2.38A {Streptococcus mutans} SCOP: d.129.3.9 PDB: 2b79_A | Back alignment and structure |
|---|
| >3ggn_A Uncharacterized protein DR_A0006; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Deinococcus radiodurans R1} PDB: 2kcz_A | Back alignment and structure |
|---|
| >2ns9_A Hypothetical protein APE2225; uncharacterized conserved protein, structural genomics, PSI, structure initiative; 1.80A {Aeropyrum pernix} SCOP: d.129.3.10 | Back alignment and structure |
|---|
| >1z94_A Conserved hypothetical protein; NESG, CV1439, structural genomics, PSI structure initiative; 2.10A {Chromobacterium violaceum} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >1xn6_A Hypothetical protein BC4709; structural genomics, protein structure initiative, PSI, NESG target protein BCR68, alpha + beta; NMR {Bacillus cereus} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >1xuv_A Hypothetical protein MM0500; alpha-beta protein, northeast structural genomics consortium, NESG, structural genomics; 2.10A {Methanosarcina mazei GO1} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >2il5_A Hypothetical protein; structural genomics, APC23650, PSI-2, structure initiative; 2.30A {Staphylococcus aureus subsp} SCOP: d.129.3.5 | Back alignment and structure |
|---|
| >2leq_A Uncharacterized protein; start domains, structural genomics, PSI-biology, protein STR initiative; NMR {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3put_A Hypothetical conserved protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.83A {Rhizobium etli cfn 42} PDB: 3otl_A* | Back alignment and structure |
|---|
| >3rd6_A MLL3558 protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 2.80A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2lak_A AHSA1-like protein RHE_CH02687; NESG, structural genomics, northeast structural genomics CON PSI-biology, structure genomics, unknown function; NMR {Rhizobium etli} | Back alignment and structure |
|---|
| >3q64_A MLL3774 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.50A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2lcg_A Uncharacterized protein; start domain, structural genomics, northeast structural GENO consortium, NESG, unknown function, AHSA1; NMR {Ralstonia metallidurans} | Back alignment and structure |
|---|
| >3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} | Back alignment and structure |
|---|
| >3q6a_A Uncharacterized protein; structural genomics, PSI-biology; 1.80A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >3pu2_A Uncharacterized protein; SRPBCC superfamily, PSI-biology, NESG, RHR263, structural GE protein structure initiative; HET: MSE; 2.61A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2l8o_A Uncharacterized protein; mixed alpha-beta protein, PSI-biology, structural genomics, structure initiative; NMR {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3uid_A Putative uncharacterized protein; SRPBCC superfamily, beta sandwich, function, structural genomics, TB structural genomics conso TBSGC; 1.57A {Mycobacterium smegmatis} SCOP: d.129.3.0 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 92 | ||||
| d1vjha_ | 120 | d.129.3.1 (A:) Hypothetical protein At1G24000 {Tha | 5e-30 | |
| d1e09a_ | 159 | d.129.3.1 (A:) Major tree pollen allergen {Sweet c | 1e-16 | |
| d2bk0a1 | 153 | d.129.3.1 (A:2-154) Major allergen api g 1 {Celery | 2e-16 | |
| d1fm4a_ | 159 | d.129.3.1 (A:) Major tree pollen allergen {Europea | 5e-16 | |
| d1icxa_ | 155 | d.129.3.1 (A:) Plant pathogenesis-related protein | 1e-15 | |
| d1xdfa1 | 157 | d.129.3.1 (A:1-157) Plant pathogenesis-related pro | 9e-15 | |
| d1txca1 | 147 | d.129.3.1 (A:1-147) Plant pathogenesis-related pro | 7e-13 | |
| d3cnwa1 | 138 | d.129.3.8 (A:3-140) Uncharacterized protein XoxI { | 7e-06 |
| >d1vjha_ d.129.3.1 (A:) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 120 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: TBP-like superfamily: Bet v1-like family: Pathogenesis-related protein 10 (PR10)-like domain: Hypothetical protein At1G24000 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 100 bits (252), Expect = 5e-30
Identities = 23/84 (27%), Positives = 42/84 (50%)
Query: 6 AKEIIEAIDNENYITNYKVIEGNLLELYKSFSSTVKVTPKENDDGSLVHWIFEYEKLNED 65
K IEA+D ++ + + +K+ ++ VTP DGS V W F +EK+++D
Sbjct: 36 GKTEIEAVDLVKKTMTIQMSGSEIQKYFKTLKGSIAVTPIGVGDGSHVVWTFHFEKVHKD 95
Query: 66 VPDPTGKLQILIDVAKDIDAHLLS 89
+ DP + + K +D +L+
Sbjct: 96 IDDPHSIIDESVKYFKKLDEAILN 119
|
| >d1e09a_ d.129.3.1 (A:) Major tree pollen allergen {Sweet cherry (Prunus avium), pru av 1 [TaxId: 42229]} Length = 159 | Back information, alignment and structure |
|---|
| >d2bk0a1 d.129.3.1 (A:2-154) Major allergen api g 1 {Celery (Apium graveolens) [TaxId: 4045]} Length = 153 | Back information, alignment and structure |
|---|
| >d1fm4a_ d.129.3.1 (A:) Major tree pollen allergen {European white birch (Betula pendula), Bet v 1-l [TaxId: 3505]} Length = 159 | Back information, alignment and structure |
|---|
| >d1icxa_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} Length = 155 | Back information, alignment and structure |
|---|
| >d1xdfa1 d.129.3.1 (A:1-157) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} Length = 157 | Back information, alignment and structure |
|---|
| >d1txca1 d.129.3.1 (A:1-147) Plant pathogenesis-related protein PR10 {Jicama (Pachyrhizus erosus), SPE-16 [TaxId: 109171]} Length = 147 | Back information, alignment and structure |
|---|
| >d3cnwa1 d.129.3.8 (A:3-140) Uncharacterized protein XoxI {Bacillus cereus [TaxId: 1396]} Length = 138 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 92 | |||
| d1vjha_ | 120 | Hypothetical protein At1G24000 {Thale cress (Arabi | 99.96 | |
| d1fm4a_ | 159 | Major tree pollen allergen {European white birch ( | 99.96 | |
| d1e09a_ | 159 | Major tree pollen allergen {Sweet cherry (Prunus a | 99.96 | |
| d2bk0a1 | 153 | Major allergen api g 1 {Celery (Apium graveolens) | 99.96 | |
| d1xdfa1 | 157 | Plant pathogenesis-related protein PR10 {Yellow lu | 99.95 | |
| d1icxa_ | 155 | Plant pathogenesis-related protein PR10 {Yellow lu | 99.95 | |
| d1txca1 | 147 | Plant pathogenesis-related protein PR10 {Jicama (P | 99.91 | |
| d3cnwa1 | 138 | Uncharacterized protein XoxI {Bacillus cereus [Tax | 99.63 | |
| d2d4ra1 | 146 | Hypothetical protein TTHA0849 {Thermus thermophilu | 98.02 | |
| d2rera1 | 155 | Multifunctional enzyme TcmN, cyclase/aromatase dom | 96.41 | |
| d1xuva_ | 163 | Hypothetical protein MM0500 {Methanosarcina mazei | 95.77 | |
| d2b79a1 | 137 | Hypothetical protein SMU440 {Streptococcus mutans | 95.63 | |
| d1t17a_ | 148 | Hypothetical protein CC1736 {Caulobacter crescentu | 95.5 | |
| d2qpva1 | 133 | Uncharacterized protein Atu1531 {Agrobacterium tum | 93.57 | |
| d2ns9a1 | 147 | Hypothetical protein APE2225 {Aeropyrum pernix [Ta | 93.11 | |
| d2pcsa1 | 147 | Hypothetical protein GKP20 {Geobacillus kaustophil | 91.05 | |
| d3elia1 | 143 | Uncharacterized protein SPO3351 {Silicibacter pome | 88.58 | |
| d2il5a1 | 164 | Hypothetical protein SA2116 {Staphylococcus aureus | 86.07 | |
| d1xfsa_ | 165 | Hypothetical protein NE0264 {Nitrosomonas europaea | 84.68 |
| >d1vjha_ d.129.3.1 (A:) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: TBP-like superfamily: Bet v1-like family: Pathogenesis-related protein 10 (PR10)-like domain: Hypothetical protein At1G24000 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.96 E-value=2e-29 Score=159.32 Aligned_cols=86 Identities=27% Similarity=0.480 Sum_probs=82.4
Q ss_pred eeEEEEEEEeeCCCCEEEEEEEecccccceeEEEEEEEEEeeCCCCceEEEEEEEEEEcCCCCCChhhHHHHHHHHHHHH
Q 039477 4 QIAKEIIEAIDNENYITNYKVIEGNLLELYKSFSSTVKVTPKENDDGSLVHWIFEYEKLNEDVPDPTGKLQILIDVAKDI 83 (92)
Q Consensus 4 ~~~kErl~~~D~~~~~~~y~i~eg~~~~~~~~~~~ti~v~p~~~g~~~~v~W~~~ye~~~~~~~~~~~~~~~~~~~~k~i 83 (92)
+..|||++++|++|++++|+++||+++..|++|+++++|+|.++|+||+++|+++|++.++..++|+.+++++.+|+|+|
T Consensus 34 ~~~KerVe~vD~en~sity~vieGdvl~~yksf~~~i~~~p~~~g~gsi~kwt~eYek~~~~~p~p~~~~e~~~~~~K~i 113 (120)
T d1vjha_ 34 KNGKTEIEAVDLVKKTMTIQMSGSEIQKYFKTLKGSIAVTPIGVGDGSHVVWTFHFEKVHKDIDDPHSIIDESVKYFKKL 113 (120)
T ss_dssp TTCEEEEEEEETTTTEEEEEEECTTGGGTEEEEEEEEEEEECSSSSCEEEEEEEEEEESSTTSCCSHHHHHHHHHHHHHH
T ss_pred cccEEEEEEEcCCCCEEEEEEEeeccccceeEEEEEEEEEecCCCCceEEEEEEEEEeCCCCCCCHHHHHHHHHHHHHHH
Confidence 45699999999999999999999999889999999999999988879999999999999999999999999999999999
Q ss_pred HHHHhc
Q 039477 84 DAHLLS 89 (92)
Q Consensus 84 e~~l~~ 89 (92)
|+|||+
T Consensus 114 d~yLL~ 119 (120)
T d1vjha_ 114 DEAILN 119 (120)
T ss_dssp HHHHHH
T ss_pred HHHHhc
Confidence 999996
|
| >d1fm4a_ d.129.3.1 (A:) Major tree pollen allergen {European white birch (Betula pendula), Bet v 1-l [TaxId: 3505]} | Back information, alignment and structure |
|---|
| >d1e09a_ d.129.3.1 (A:) Major tree pollen allergen {Sweet cherry (Prunus avium), pru av 1 [TaxId: 42229]} | Back information, alignment and structure |
|---|
| >d2bk0a1 d.129.3.1 (A:2-154) Major allergen api g 1 {Celery (Apium graveolens) [TaxId: 4045]} | Back information, alignment and structure |
|---|
| >d1xdfa1 d.129.3.1 (A:1-157) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} | Back information, alignment and structure |
|---|
| >d1icxa_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} | Back information, alignment and structure |
|---|
| >d1txca1 d.129.3.1 (A:1-147) Plant pathogenesis-related protein PR10 {Jicama (Pachyrhizus erosus), SPE-16 [TaxId: 109171]} | Back information, alignment and structure |
|---|
| >d3cnwa1 d.129.3.8 (A:3-140) Uncharacterized protein XoxI {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2rera1 d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]} | Back information, alignment and structure |
|---|
| >d1xuva_ d.129.3.5 (A:) Hypothetical protein MM0500 {Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d2b79a1 d.129.3.9 (A:1-137) Hypothetical protein SMU440 {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1t17a_ d.129.3.6 (A:) Hypothetical protein CC1736 {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d2qpva1 d.129.3.8 (A:1-133) Uncharacterized protein Atu1531 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2ns9a1 d.129.3.10 (A:10-156) Hypothetical protein APE2225 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2pcsa1 d.129.3.10 (A:1-147) Hypothetical protein GKP20 {Geobacillus kaustophilus [TaxId: 1462]} | Back information, alignment and structure |
|---|
| >d3elia1 d.129.3.5 (A:2-144) Uncharacterized protein SPO3351 {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d2il5a1 d.129.3.5 (A:5-168) Hypothetical protein SA2116 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1xfsa_ d.129.3.5 (A:) Hypothetical protein NE0264 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|