Citrus Sinensis ID: 039518

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------
TTAFAFLTSSSSCCLGKEKKMGGYKLGSAFDLKSGRAIMVGLLLMVGSFYLGTLFGGNAPIYVSRTSPNSSSSGTTTFMNKVTLTYRKTPLVIPESGMNVCPLTFNEYIPCHDPSYVKKLLPSLDLSRKEELERHCPPLEKRLFCLVPPPKDYKIPIRWPTSRDYVWQSNVNHTRLAEVKGGQNWVHEKGQLWWFPGGGTHFKHGAPEYIQRLGNMMTNETGNLRSAGVFQVLDVGCGVASFSAFLLPLDIQTMSFAPKDGHENQIQFALERGIGAMISALSTKQLPYPSSSFEMVHCSRCRVDWHANDGILLKEVDRVLRPNGYFVYSAPPAYRKDKDYPLIWDKLVNLTTAMCWKLIARKIQTAIWIKEENQSCLLHNADLKLIDVCDAVDEFKPSWNTPLGNCVQISSAQTNSQKLPPRPERLSVYSESLSRIGITQEEFTTDTSFWQDQVRHYWQLMNVNETEIRNAMDMNAYCGGFAVALNSLPVWVMNIVPISMKNTLSAIYNRGILGAFHDWCEPFSTYPRTYDLLHANHLFSHYKNRGEVCSLEDIMLEMDLIIRPQGFIIIRDEKSLITRIRDLAPKFLWDVELHSLENREKKMESVLICRKKFWAIV
cccccEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccEEEEccEEEEcccccccccccHHHHHHHHccccccccccccccccEEEEEcccccHHHHHHcccccEEEEEccccccHHHHHHHHHcccccEEEcccccccccccccEEEEEEcccccccccccHHHHHHHccccccccEEEEEcccccccccccHHHHHHHHHHHHHHccEEEEEcccEEEEEEccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccccHHHHccccccEEEEEEccccccccHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccEEEEEccHHHHHHHHHHccccccEEEEEEEcccccccEEEEEEEEccEEEc
ccEEEEEcccccHHHHHHHHcccccccccccccccHEEEEEEEEEEEEEEHHccccccccccccccccccccccccccccccHHccccccccccccccccccccHccccccccHHHHHHccccccHHHHHHHHcccccccccccccccccccccccccccccccHHHHcccccHHHEEEEccccEEEEcccEEEcccccccccccHHHHHHHHHHHccccccccccccEEEEEEcccccccHHHHHccccEEEEEcccccHHHHHHHHHHHccccEEEEEHcccccccccccEEEHHHccccccccccccEEEEEHHHEcccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHccccccccccccccccccccHcccHHHccccccHcccccccccccHHHccccccHccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEHHcHHHcccHHHHHHccccEEEEEEEcccccccccEEEcccEEEEEcccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHcccEEEEEEcccccccccEEEEEEEEEEEEc
TTAFAFLTsssscclgkekkmggyklgsafdlkSGRAIMVGLLLMVGSFYlgtlfggnapiyvsrtspnssssgtttfMNKVTLtyrktplvipesgmnvcpltfneyipchdpsyvkkllpsldlsrkeelerhcpplekrlfclvpppkdykipirwptsrdyvwqsnvNHTRLAEvkggqnwvhekgqlwwfpgggthfkhgaPEYIQRLGNmmtnetgnlrsagVFQVLDVGCgvasfsafllpldiqtmsfapkdgheNQIQFALERGIGAMISALstkqlpypsssfemvhcsrcrvdwhandgilLKEVdrvlrpngyfvysappayrkdkdyplIWDKLVNLTTAMCWKLIARKIQTAIWIKEenqscllhnadlKLIDVCDavdefkpswntplgncvqissaqtnsqklpprperlsvySESLsrigitqeefttdtsfWQDQVRHYWQLMNVNETEIRNAMDMNAYCGGFAVALNSLPVWVMNIVPISMKNTLSAIYNRGIlgafhdwcepfstyprtydLLHANHLFShyknrgevcsledIMLEMDLIIRPQGFIIIRDEKSLITRIRDLAPKFLWDVELHSLENREKKMESVLICRKKFWAIV
ttafafltsssscclgkekkmggYKLGSAFDLKSGRAIMVGLLLMVGSFYLGTLFGGNAPIYVSrtspnssssgtttfmnkVTLTYRKTPLVIPESGMNVCPLTFNEYIPCHDPSYVKKLLPSLDLSRKEELErhcpplekrlfclvpppkDYKIPIRWPTSRDYVWQSNVNHTRLAEVKGGQNWVHEKGQLWWFPGGGTHFKHGAPEYIQRLGNMMTNETGNLRSAGVFQVLDVGCGVASFSAFLLPLDIQTMSFAPKDGHENQIQFALERGIGAMISALSTKQLPYPSSSFEMVHCSRCRVDWHANDGILLKEVDRVLRPNGYfvysappayrkdkdypLIWDKLVNLTTAMCWKLIARKIQTAIWIKEENQSCLLHNADLKLIDVCDAVDEFKPSWNTPLGNCVQISsaqtnsqklpprpERLSVYSESLSRIGItqeefttdtsFWQDQVRHYWQLMNVNETEIRNAMDMNAYCGGFAVALNSLPVWVMNIVPISMKNTLSAIYNRGILGAFHDWCEPFSTYPRTYDLLHANHLFSHYKNRGEVCSLEDIMLEMDLIIRPQGFIIIRDEKSLITRIRDLAPKFLWDVELHslenrekkmesvlicrKKFWAIV
TtafafltsssscclGKEKKMGGYKLGSAFDLKSGRAIMVGLLLMVGSFYLGTLFGGNAPIYVsrtspnssssgtttFMNKVTLTYRKTPLVIPESGMNVCPLTFNEYIPCHDPSYVKKLLPSLDLSRKEELERHCPPLEKRLFCLVPPPKDYKIPIRWPTSRDYVWQSNVNHTRLAEVKGGQNWVHEKGQLWWFPGGGTHFKHGAPEYIQRLGNMMTNETGNLRSAGVFQVLDVGCGVASFSAFLLPLDIQTMSFAPKDGHENQIQFALERGIGAMISALSTKQLPYPSSSFEMVHCSRCRVDWHANDGILLKEVDRVLRPNGYFVYSAPPAYRKDKDYPLIWDKLVNLTTAMCWKLIARKIQTAIWIKEENQSCLLHNADLKLIDVCDAVDEFKPSWNTPLGNCVQISSAQTNSQKLPPRPERLSVYSESLSRIGITQEEFTTDTSFWQDQVRHYWQLMNVNETEIRNAMDMNAYCGGFAVALNSLPVWVMNIVPISMKNTLSAIYNRGILGAFHDWCEPFSTYPRTYDLLHANHLFSHYKNRGEVCSLEDIMLEMDLIIRPQGFIIIRDEKSLITRIRDLAPKFLWDVELHSLENREKKMESVLICRKKFWAIV
*****FLTSSSSCCLGKEKKMGGYKLGSAFDLKSGRAIMVGLLLMVGSFYLGTLFGGNAPIYV**************FMNKVTLTYRKTPLVIPESGMNVCPLTFNEYIPCHDPSYVKKLLPSLDLSR**ELERHCPPLEKRLFCLVPPPKDYKIPIRWPTSRDYVWQSNVNHTRLAEVKGGQNWVHEKGQLWWFPGGGTHFKHGAPEYIQRLGNMMTNETGNLRSAGVFQVLDVGCGVASFSAFLLPLDIQTMSFAPKDGHENQIQFALERGIGAMISALSTKQLPYPSSSFEMVHCSRCRVDWHANDGILLKEVDRVLRPNGYFVYSAPPAYRKDKDYPLIWDKLVNLTTAMCWKLIARKIQTAIWIKEENQSCLLHNADLKLIDVCDAVDEFKPSWNTPLGNCVQI***********************LSRIGITQEEFTTDTSFWQDQVRHYWQLMNVNETEIRNAMDMNAYCGGFAVALNSLPVWVMNIVPISMKNTLSAIYNRGILGAFHDWCEPFSTYPRTYDLLHANHLFSHYKNRGEVCSLEDIMLEMDLIIRPQGFIIIRDEKSLITRIRDLAPKFLWDVELHSLENREKKMESVLICRKKFWAI*
***FAFLTSS**************************AIMVGLLLMVGSFYLGTLFG*****************************************MNVCPLTFNEYIPCHDPSYVKKLLPSLDLSRKEELERHCPPLEKRLFCLVPPPKDYKIPIRWPTSRDYVWQSNVNHTRLAEVKGGQNWVHEKGQLWWFPGGGTHFKHGAPEYIQRLGNMMTNETGNLRSAGVFQVLDVGCGVASFSAFLLPLDIQTMSFAPKDGHENQIQFALERGIGAMISALSTKQLPYPSSSFEMVHCSRCRVDWHANDGILLKEVDRVLRPNGYFVYSAPPAYRKDKDYPLIWDKLVNLTTAMCWKLIARKIQTAIWIKEENQSC***************VDEFKPSWNTPLGNC******************RLSVYS*******I*QEEFTTDTSFWQDQVRHYWQLMNVNETEIRNAMDMNAYCGGFAVALNSLPVWVMNIVPISMKNTLSAIYNRGILGAFHDWCEPFSTYPRTYDLLHANHLFSHYKNRGEVCSLEDIMLEMDLIIRPQGFIIIRDEKSLITRIRDLAPKFLWDVELHSL****KKMESVLICRKKFWAIV
********SSSSCCLGKEKKMGGYKLGSAFDLKSGRAIMVGLLLMVGSFYLGTLFGGNAPIYVSR**********TTFMNKVTLTYRKTPLVIPESGMNVCPLTFNEYIPCHDPSYVKKLLPSLDLSRKEELERHCPPLEKRLFCLVPPPKDYKIPIRWPTSRDYVWQSNVNHTRLAEVKGGQNWVHEKGQLWWFPGGGTHFKHGAPEYIQRLGNMMTNETGNLRSAGVFQVLDVGCGVASFSAFLLPLDIQTMSFAPKDGHENQIQFALERGIGAMISALSTKQLPYPSSSFEMVHCSRCRVDWHANDGILLKEVDRVLRPNGYFVYSAPPAYRKDKDYPLIWDKLVNLTTAMCWKLIARKIQTAIWIKEENQSCLLHNADLKLIDVCDAVDEFKPSWNTPLGNCVQISSAQTNSQKLPPRPERLSVYSESLSRIGITQEEFTTDTSFWQDQVRHYWQLMNVNETEIRNAMDMNAYCGGFAVALNSLPVWVMNIVPISMKNTLSAIYNRGILGAFHDWCEPFSTYPRTYDLLHANHLFSHYKNRGEVCSLEDIMLEMDLIIRPQGFIIIRDEKSLITRIRDLAPKFLWDVELHSLENREKKMESVLICRKKFWAIV
TTAFAFLTSSSSCCLGKEKKMGGYK******LKSGRAIMVGLLLMVGSFYLGTLFGG*************************************ESGMNVCPLTFNEYIPCHDPSYVKKLLPSLDLSRKEELERHCPPLEKRLFCLVPPPKDYKIPIRWPTSRDYVWQSNVNHTRLAEVKGGQNWVHEKGQLWWFPGGGTHFKHGAPEYIQRLGNMMTNETGNLRSAGVFQVLDVGCGVASFSAFLLPLDIQTMSFAPKDGHENQIQFALERGIGAMISALSTKQLPYPSSSFEMVHCSRCRVDWHANDGILLKEVDRVLRPNGYFVYSAPPAYRKDKDYPLIWDKLVNLTTAMCWKLIARKIQTAIWIKEENQSCLLHNADLKLIDVCDAVDEFKPSWNTPLGNCVQISSAQTNSQKLPPRPERLSVYSESLSRIGITQEEFTTDTSFWQDQVRHYWQLMNVNETEIRNAMDMNAYCGGFAVALNSLPVWVMNIVPISMKNTLSAIYNRGILGAFHDWCEPFSTYPRTYDLLHANHLFSHYKNRGEVCSLEDIMLEMDLIIRPQGFIIIRDEKSLITRIRDLAPKFLWDVELHSLENREKKMESVLICRKKFWAIV
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TTAFAFLTSSSSCCLGKEKKMGGYKLGSAFDLKSGRAIMVGLLLMVGSFYLGTLFGGNAPIYVSRTSPNSSSSGTTTFMNKVTLTYRKTPLVIPESGMNVCPLTFNEYIPCHDPSYVKKLLPSLDLSRKEELERHCPPLEKRLFCLVPPPKDYKIPIRWPTSRDYVWQSNVNHTRLAEVKGGQNWVHEKGQLWWFPGGGTHFKHGAPEYIQRLGNMMTNETGNLRSAGVFQVLDVGCGVASFSAFLLPLDIQTMSFAPKDGHENQIQFALERGIGAMISALSTKQLPYPSSSFEMVHCSRCRVDWHANDGILLKEVDRVLRPNGYFVYSAPPAYRKDKDYPLIWDKLVNLTTAMCWKLIARKIQTAIWIKEENQSCLLHNADLKLIDVCDAVDEFKPSWNTPLGNCVQISSAQTNSQKLPPRPERLSVYSESLSRIGITQEEFTTDTSFWQDQVRHYWQLMNVNETEIRNAMDMNAYCGGFAVALNSLPVWVMNIVPISMKNTLSAIYNRGILGAFHDWCEPFSTYPRTYDLLHANHLFSHYKNRGEVCSLEDIMLEMDLIIRPQGFIIIRDEKSLITRIRDLAPKFLWDVELHSLENREKKMESVLICRKKFWAIV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query617 2.2.26 [Sep-21-2011]
Q84TJ0591 Probable methyltransferas yes no 0.954 0.996 0.734 0.0
Q9LZA4600 Probable methyltransferas no no 0.957 0.985 0.719 0.0
Q940J9623 Probable methyltransferas no no 0.836 0.828 0.455 1e-134
Q8H118611 Probable methyltransferas no no 0.831 0.839 0.466 1e-133
Q8VZV7612 Probable methyltransferas no no 0.928 0.936 0.442 1e-132
Q93YV7608 Probable methyltransferas no no 0.824 0.837 0.462 1e-131
O22285694 Probable methyltransferas no no 0.833 0.740 0.435 1e-124
Q9FG39682 Probable methyltransferas no no 0.818 0.740 0.429 1e-122
Q94KE1655 Probable methyltransferas no no 0.826 0.778 0.434 1e-121
Q6NPR7770 Probable methyltransferas no no 0.855 0.685 0.418 1e-116
>sp|Q84TJ0|PMT6_ARATH Probable methyltransferase PMT6 OS=Arabidopsis thaliana GN=At3g10200 PE=2 SV=1 Back     alignment and function desciption
 Score =  935 bits (2417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/599 (73%), Positives = 515/599 (85%), Gaps = 10/599 (1%)

Query: 21  MGGYKLGSAFDLKSGRAIMVGLLLMVGSFYLGTLFGGNAPIYVSRTSPNSSSSGTTTFMN 80
           M G  +G+    +SG+ IMV L+LMVGSFY G+LFG N PIYVS  S   S S ++ F N
Sbjct: 1   MRGSVIGAE---RSGQTIMVALVLMVGSFYTGSLFGTNQPIYVSHPS---SHSASSKFAN 54

Query: 81  KVTLTYRKTPLVIPESGMNVCPLTFNEYIPCHDPSYVKKLLPSLDLSRKEELERHCPPLE 140
           K+ LTYR+ PLVIPESGMNVCPL FNEYIPCH+ +YV +LLPSL+LSR+E+LERHCPPLE
Sbjct: 55  KIELTYRRLPLVIPESGMNVCPLEFNEYIPCHNVTYVHQLLPSLNLSRREDLERHCPPLE 114

Query: 141 KRLFCLVPPPKDYKIPIRWPTSRDYVWQSNVNHTRLAEVKGGQNWVHEKGQLWWFPGGGT 200
            RLFCLVPPP DYKIPIRWPTSRDYVW+SNVNHT LA+VKGGQNWVHE+GQ WWFPGGGT
Sbjct: 115 HRLFCLVPPPNDYKIPIRWPTSRDYVWRSNVNHTHLAQVKGGQNWVHEQGQFWWFPGGGT 174

Query: 201 HFKHGAPEYIQRLGNMMTNETGNLRSAGVFQVLDVGCGVASFSAFLLPLDIQTMSFAPKD 260
           HFKHGA EYIQRLGNMMTNETG+LRSAGV QVLDVGCGVASF+A+LLPL IQT+SFAPKD
Sbjct: 175 HFKHGAAEYIQRLGNMMTNETGDLRSAGVVQVLDVGCGVASFAAYLLPLGIQTISFAPKD 234

Query: 261 GHENQIQFALERGIGAMISALSTKQLPYPSSSFEMVHCSRCRVDWHANDGILLKEVDRVL 320
           GHENQIQFALERGIGAMISA++TKQLPYP++SFEMVHCSRCRVDWH NDGILLKEV R+L
Sbjct: 235 GHENQIQFALERGIGAMISAVATKQLPYPAASFEMVHCSRCRVDWHTNDGILLKEVHRLL 294

Query: 321 RPNGYFVYSAPPAYRKDKDYPLIWDKLVNLTTAMCWKLIARKIQTAIWIKEENQSCLLHN 380
           RPNG+FVYS+PPAYRKDK+YP+IWDKLVNLT+AMCWKLI+RK+QTAIWIKEE + CL   
Sbjct: 295 RPNGFFVYSSPPAYRKDKEYPMIWDKLVNLTSAMCWKLISRKVQTAIWIKEEKEVCLKQK 354

Query: 381 ADLKLIDVCDAVDEFKPSWNTPLGNCVQISSAQTNSQKLPPRPERLSVYSESLSRIGITQ 440
           A+LKLI +CD  D  KPSW  PL +CVQI S QT  ++     ERLS Y  +L +IGI++
Sbjct: 355 AELKLISLCDVEDVLKPSWKVPLKDCVQI-SGQT-EERPSSLAERLSAYPATLRKIGISE 412

Query: 441 EEFTTDTSFWQDQVRHYWQLMNVNETEIRNAMDMNAYCGGFAVALNSLPVWVMNIVPISM 500
           +E+T+DT FW++QV HYW+LMNVNETE+RN MDMNA+ GGFA A+NS PVWVMNIVP +M
Sbjct: 413 DEYTSDTVFWREQVNHYWRLMNVNETEVRNVMDMNAFIGGFAAAMNSYPVWVMNIVPATM 472

Query: 501 KNTLSAIYNRGILGAFHDWCEPFSTYPRTYDLLHANHLFSHY-KNRGEVCSLEDIMLEMD 559
            +TLS I+ RG+ GAFHDWCE FSTYPRTYDL+H++H+FSHY K+ G+ C LEDIMLEMD
Sbjct: 473 NDTLSGIFERGLNGAFHDWCEAFSTYPRTYDLVHSDHVFSHYNKSYGDGCLLEDIMLEMD 532

Query: 560 LIIRPQGFIIIRDEKSLITRIRDLAPKFLWDVELHSLENREKKM-ESVLICRKKFWAIV 617
            I+RPQGF+IIRDE+ +I+RIR LAPKFLW+VE H LEN++KK+ ESVL CRK+FWAI+
Sbjct: 533 RIVRPQGFVIIRDEEYIISRIRGLAPKFLWEVETHELENKDKKITESVLFCRKRFWAII 591

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q9LZA4|PMT7_ARATH Probable methyltransferase PMT7 OS=Arabidopsis thaliana GN=At5g04060 PE=1 SV=1 Back     alignment and function description
>sp|Q940J9|PMT8_ARATH Probable methyltransferase PMT8 OS=Arabidopsis thaliana GN=At1g04430 PE=1 SV=1 Back     alignment and function description
>sp|Q8H118|PMT1_ARATH Probable methyltransferase PMT1 OS=Arabidopsis thaliana GN=At3g23300 PE=1 SV=2 Back     alignment and function description
>sp|Q8VZV7|PMT9_ARATH Probable methyltransferase PMT9 OS=Arabidopsis thaliana GN=At5g14430 PE=1 SV=1 Back     alignment and function description
>sp|Q93YV7|PMT3_ARATH Probable methyltransferase PMT3 OS=Arabidopsis thaliana GN=At4g14360 PE=1 SV=1 Back     alignment and function description
>sp|O22285|PMTB_ARATH Probable methyltransferase PMT11 OS=Arabidopsis thaliana GN=At2g39750 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG39|PMTC_ARATH Probable methyltransferase PMT12 OS=Arabidopsis thaliana GN=At5g06050 PE=2 SV=1 Back     alignment and function description
>sp|Q94KE1|PMTA_ARATH Probable methyltransferase PMT10 OS=Arabidopsis thaliana GN=At1g77260 PE=2 SV=1 Back     alignment and function description
>sp|Q6NPR7|PMTO_ARATH Probable methyltransferase PMT24 OS=Arabidopsis thaliana GN=At1g29470 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query617
224090013600 predicted protein [Populus trichocarpa] 0.965 0.993 0.798 0.0
255586012600 ATP binding protein, putative [Ricinus c 0.959 0.986 0.782 0.0
356500551603 PREDICTED: probable methyltransferase PM 0.967 0.990 0.764 0.0
359481900601 PREDICTED: probable methyltransferase PM 0.959 0.985 0.77 0.0
356577676606 PREDICTED: probable methyltransferase PM 0.965 0.983 0.759 0.0
449521375621 PREDICTED: probable methyltransferase PM 0.980 0.974 0.745 0.0
449437747600 PREDICTED: probable methyltransferase PM 0.959 0.986 0.756 0.0
30681189591 putative methyltransferase PMT6 [Arabido 0.954 0.996 0.734 0.0
15237607600 putative methyltransferase PMT7 [Arabido 0.957 0.985 0.719 0.0
297806377600 hypothetical protein ARALYDRAFT_487185 [ 0.956 0.983 0.721 0.0
>gi|224090013|ref|XP_002308906.1| predicted protein [Populus trichocarpa] gi|118481871|gb|ABK92872.1| unknown [Populus trichocarpa] gi|222854882|gb|EEE92429.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1019 bits (2634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/601 (79%), Positives = 542/601 (90%), Gaps = 5/601 (0%)

Query: 21  MGGYKLGSAFDLKSGRAIMVGLLLMVGSFYLGTLFGGN-APIYVSRTSPNSSSS---GTT 76
           MGGY  GSAFD KSG+ IMV LLLMVGSFY GTLFG N A IYVS+ S +S+SS   G  
Sbjct: 1   MGGYSWGSAFDSKSGQMIMVALLLMVGSFYTGTLFGNNNASIYVSQLSSSSNSSSSHGIY 60

Query: 77  TFMNKVTLTYRKTPLVIPESGMNVCPLTFNEYIPCHDPSYVKKLLPSLDLSRKEELERHC 136
           TF NKV L YR+TP+VIPESGMNVCPL FNEYIPCHD +YVK L PSLDLSR+EELERHC
Sbjct: 61  TFTNKVALAYRQTPIVIPESGMNVCPLKFNEYIPCHDVAYVKTLFPSLDLSRREELERHC 120

Query: 137 PPLEKRLFCLVPPPKDYKIPIRWPTSRDYVWQSNVNHTRLAEVKGGQNWVHEKGQLWWFP 196
           PPLEKRLFCLVPPP+DYK+PI+WPTSRDYVW+SNVNHT LAEVKGGQNWVHEK QLWWFP
Sbjct: 121 PPLEKRLFCLVPPPEDYKLPIKWPTSRDYVWRSNVNHTHLAEVKGGQNWVHEKDQLWWFP 180

Query: 197 GGGTHFKHGAPEYIQRLGNMMTNETGNLRSAGVFQVLDVGCGVASFSAFLLPLDIQTMSF 256
           GGGTHFKHGA +YI+RLGNM+T++TG+LRSAGV QVLDVGCGVASFSA+LLPLDIQTMSF
Sbjct: 181 GGGTHFKHGAADYIERLGNMITDDTGDLRSAGVVQVLDVGCGVASFSAYLLPLDIQTMSF 240

Query: 257 APKDGHENQIQFALERGIGAMISALSTKQLPYPSSSFEMVHCSRCRVDWHANDGILLKEV 316
           AP+DGHENQIQFALERGIGAM +A+STKQLPYPSSSFEMVHCSRCRVDWH N GIL+KEV
Sbjct: 241 APRDGHENQIQFALERGIGAMTAAISTKQLPYPSSSFEMVHCSRCRVDWHENGGILIKEV 300

Query: 317 DRVLRPNGYFVYSAPPAYRKDKDYPLIWDKLVNLTTAMCWKLIARKIQTAIWIKEENQSC 376
           +R+LR NGYFVYS+PPAYRKDKDYPLIWDKLVNLT+AMCWKLIARK+QTAIW+K+EN+SC
Sbjct: 301 NRLLRDNGYFVYSSPPAYRKDKDYPLIWDKLVNLTSAMCWKLIARKVQTAIWVKQENESC 360

Query: 377 LLHNADLKLIDVCDAVDEFKPSWNTPLGNCVQISSAQTNSQKLPPRPERLSVYSESLSRI 436
           LLHNA++K I++CD VD+ KPSW TPL NC+   SA TN QKLPPRPERLSVYS+SLS+I
Sbjct: 361 LLHNAEMKQINICDTVDDMKPSWKTPLRNCIP-RSAPTNPQKLPPRPERLSVYSKSLSKI 419

Query: 437 GITQEEFTTDTSFWQDQVRHYWQLMNVNETEIRNAMDMNAYCGGFAVALNSLPVWVMNIV 496
           GIT+EEF++D  FW++Q  HYW+LMN+NET+IRN MDMNA+ GGFAVALNSLPVWVMNIV
Sbjct: 420 GITEEEFSSDAIFWKNQAGHYWKLMNINETDIRNVMDMNAFIGGFAVALNSLPVWVMNIV 479

Query: 497 PISMKNTLSAIYNRGILGAFHDWCEPFSTYPRTYDLLHANHLFSHYKNRGEVCSLEDIML 556
           P+SM NTLSAIY+RG++GAFHDWCEPFSTYPRTYDLLHANHLF+HYK+ GE C LEDIML
Sbjct: 480 PMSMNNTLSAIYDRGLIGAFHDWCEPFSTYPRTYDLLHANHLFTHYKDHGEGCLLEDIML 539

Query: 557 EMDLIIRPQGFIIIRDEKSLITRIRDLAPKFLWDVELHSLENREKKMESVLICRKKFWAI 616
           EMD IIRPQGFIIIRDE+S  +R++ LAPKFLW+VE H LEN+ KK E+VLICRKKFWA+
Sbjct: 540 EMDRIIRPQGFIIIRDEESFTSRVQHLAPKFLWEVESHVLENKGKKTETVLICRKKFWAL 599

Query: 617 V 617
           V
Sbjct: 600 V 600

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255586012|ref|XP_002533675.1| ATP binding protein, putative [Ricinus communis] gi|223526426|gb|EEF28705.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356500551|ref|XP_003519095.1| PREDICTED: probable methyltransferase PMT7-like [Glycine max] Back     alignment and taxonomy information
>gi|359481900|ref|XP_002274283.2| PREDICTED: probable methyltransferase PMT7-like [Vitis vinifera] gi|297739895|emb|CBI30077.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356577676|ref|XP_003556950.1| PREDICTED: probable methyltransferase PMT7-like [Glycine max] Back     alignment and taxonomy information
>gi|449521375|ref|XP_004167705.1| PREDICTED: probable methyltransferase PMT7-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|449437747|ref|XP_004136652.1| PREDICTED: probable methyltransferase PMT7-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|30681189|ref|NP_187631.2| putative methyltransferase PMT6 [Arabidopsis thaliana] gi|75243292|sp|Q84TJ0.1|PMT6_ARATH RecName: Full=Probable methyltransferase PMT6 gi|28973663|gb|AAO64151.1| unknown protein [Arabidopsis thaliana] gi|110737121|dbj|BAF00512.1| hypothetical protein [Arabidopsis thaliana] gi|332641350|gb|AEE74871.1| putative methyltransferase PMT6 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15237607|ref|NP_196026.1| putative methyltransferase PMT7 [Arabidopsis thaliana] gi|75181220|sp|Q9LZA4.1|PMT7_ARATH RecName: Full=Probable methyltransferase PMT7 gi|7406416|emb|CAB85526.1| putative protein [Arabidopsis thaliana] gi|18086557|gb|AAL57703.1| AT5g04060/F8F6_270 [Arabidopsis thaliana] gi|332003309|gb|AED90692.1| putative methyltransferase PMT7 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297806377|ref|XP_002871072.1| hypothetical protein ARALYDRAFT_487185 [Arabidopsis lyrata subsp. lyrata] gi|297316909|gb|EFH47331.1| hypothetical protein ARALYDRAFT_487185 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query617
TAIR|locus:2076264591 AT3G10200 [Arabidopsis thalian 0.940 0.981 0.737 2.7e-249
TAIR|locus:2150670600 AT5G04060 [Arabidopsis thalian 0.957 0.985 0.711 1.4e-247
TAIR|locus:2145658612 AT5G14430 [Arabidopsis thalian 0.841 0.848 0.470 1.7e-128
TAIR|locus:2018329623 AT1G04430 [Arabidopsis thalian 0.844 0.836 0.456 1.4e-126
TAIR|locus:2090935611 AT3G23300 [Arabidopsis thalian 0.831 0.839 0.468 1.3e-125
TAIR|locus:2129660608 AT4G14360 [Arabidopsis thalian 0.829 0.842 0.463 3e-124
TAIR|locus:2063947694 AT2G39750 [Arabidopsis thalian 0.831 0.739 0.440 2.7e-116
TAIR|locus:2195955655 AT1G77260 [Arabidopsis thalian 0.811 0.764 0.441 4.5e-114
TAIR|locus:2153704682 AT5G06050 [Arabidopsis thalian 0.818 0.740 0.429 4.5e-114
TAIR|locus:2013628770 AT1G29470 [Arabidopsis thalian 0.808 0.648 0.436 1e-109
TAIR|locus:2076264 AT3G10200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2401 (850.3 bits), Expect = 2.7e-249, P = 2.7e-249
 Identities = 433/587 (73%), Positives = 504/587 (85%)

Query:    33 KSGRAIMVGLLLMVGSFYLGTLFGGNAPIYVXXXXXXXXXXXXXXFMNKVTLTYRKTPLV 92
             +SG+ IMV L+LMVGSFY G+LFG N PIYV              F NK+ LTYR+ PLV
Sbjct:    10 RSGQTIMVALVLMVGSFYTGSLFGTNQPIYVSHPSSHSASSK---FANKIELTYRRLPLV 66

Query:    93 IPESGMNVCPLTFNEYIPCHDPSYVKKLLPSLDLSRKEELERHCPPLEKRLFCLVPPPKD 152
             IPESGMNVCPL FNEYIPCH+ +YV +LLPSL+LSR+E+LERHCPPLE RLFCLVPPP D
Sbjct:    67 IPESGMNVCPLEFNEYIPCHNVTYVHQLLPSLNLSRREDLERHCPPLEHRLFCLVPPPND 126

Query:   153 YKIPIRWPTSRDYVWQSNVNHTRLAEVKGGQNWVHEKGQLWWFPGGGTHFKHGAPEYIQR 212
             YKIPIRWPTSRDYVW+SNVNHT LA+VKGGQNWVHE+GQ WWFPGGGTHFKHGA EYIQR
Sbjct:   127 YKIPIRWPTSRDYVWRSNVNHTHLAQVKGGQNWVHEQGQFWWFPGGGTHFKHGAAEYIQR 186

Query:   213 LGNMMTNETGNLRSAGVFQVLDVGCGVASFSAFLLPLDIQTMSFAPKDGHENQIQFALER 272
             LGNMMTNETG+LRSAGV QVLDVGCGVASF+A+LLPL IQT+SFAPKDGHENQIQFALER
Sbjct:   187 LGNMMTNETGDLRSAGVVQVLDVGCGVASFAAYLLPLGIQTISFAPKDGHENQIQFALER 246

Query:   273 GIGAMISALSTKQLPYPSSSFEMVHCSRCRVDWHANDGILLKEVDRVLRPNGYFVYSAPP 332
             GIGAMISA++TKQLPYP++SFEMVHCSRCRVDWH NDGILLKEV R+LRPNG+FVYS+PP
Sbjct:   247 GIGAMISAVATKQLPYPAASFEMVHCSRCRVDWHTNDGILLKEVHRLLRPNGFFVYSSPP 306

Query:   333 AYRKDKDYPLIWDKLVNLTTAMCWKLIARKIQTAIWIKEENQSCLLHNADLKLIDVCDAV 392
             AYRKDK+YP+IWDKLVNLT+AMCWKLI+RK+QTAIWIKEE + CL   A+LKLI +CD  
Sbjct:   307 AYRKDKEYPMIWDKLVNLTSAMCWKLISRKVQTAIWIKEEKEVCLKQKAELKLISLCDVE 366

Query:   393 DEFKPSWNTPLGNCVQISSAQTNSQKLPPRPERLSVYSESLSRIGITQEEFTTDTSFWQD 452
             D  KPSW  PL +CVQIS  QT  ++     ERLS Y  +L +IGI+++E+T+DT FW++
Sbjct:   367 DVLKPSWKVPLKDCVQISG-QTE-ERPSSLAERLSAYPATLRKIGISEDEYTSDTVFWRE 424

Query:   453 QVRHYWQLMNVNETEIRNAMDMNAYCGGFAVALNSLPVWVMNIVPISMKNTLSAIYNRGI 512
             QV HYW+LMNVNETE+RN MDMNA+ GGFA A+NS PVWVMNIVP +M +TLS I+ RG+
Sbjct:   425 QVNHYWRLMNVNETEVRNVMDMNAFIGGFAAAMNSYPVWVMNIVPATMNDTLSGIFERGL 484

Query:   513 LGAFHDWCEPFSTYPRTYDLLHANHLFSHY-KNRGEVCSLEDIMLEMDLIIRPQGFIIIR 571
              GAFHDWCE FSTYPRTYDL+H++H+FSHY K+ G+ C LEDIMLEMD I+RPQGF+IIR
Sbjct:   485 NGAFHDWCEAFSTYPRTYDLVHSDHVFSHYNKSYGDGCLLEDIMLEMDRIVRPQGFVIIR 544

Query:   572 DEKSLITRIRDLAPKFLWDVELHSLENREKKM-ESVLICRKKFWAIV 617
             DE+ +I+RIR LAPKFLW+VE H LEN++KK+ ESVL CRK+FWAI+
Sbjct:   545 DEEYIISRIRGLAPKFLWEVETHELENKDKKITESVLFCRKRFWAII 591
GO:0005794 "Golgi apparatus" evidence=ISM
GO:0008168 "methyltransferase activity" evidence=IEA
TAIR|locus:2150670 AT5G04060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2145658 AT5G14430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018329 AT1G04430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090935 AT3G23300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129660 AT4G14360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2063947 AT2G39750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195955 AT1G77260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153704 AT5G06050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013628 AT1G29470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q84TJ0PMT6_ARATH2, ., 1, ., 1, ., -0.73450.95460.9966yesno
Q9LZA4PMT7_ARATH2, ., 1, ., 1, ., -0.71970.95780.985nono

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query617
pfam03141506 pfam03141, Methyltransf_29, Putative S-adenosyl-L- 0.0
pfam0824192 pfam08241, Methyltransf_11, Methyltransferase doma 1e-09
pfam13847151 pfam13847, Methyltransf_31, Methyltransferase doma 6e-04
COG0500257 COG0500, SmtA, SAM-dependent methyltransferases [S 0.001
>gnl|CDD|217386 pfam03141, Methyltransf_29, Putative S-adenosyl-L-methionine-dependent methyltransferase Back     alignment and domain information 
 Score =  750 bits (1939), Expect = 0.0
 Identities = 258/516 (50%), Positives = 327/516 (63%), Gaps = 21/516 (4%)

Query: 107 EYIPCHDPSYVKKLLPSLDLSRKEELERHCPPLEKRLFCLVPPPKDYKIPIRWPTSRDYV 166
           +YIPC D     K L S +  R E  ERHCPP E++L CLVPPP  YK PI WP SRD V
Sbjct: 1   DYIPCLDNDRAIKFLLSRE--RMEHRERHCPPSEEKLRCLVPPPDGYKTPIPWPKSRDKV 58

Query: 167 WQSNVNHTRLAEVKGGQNWVHEKGQLWWFPGGGTHFKHGAPEYIQRLGNMMTNET--GNL 224
           W +NV HT+LAE KGGQNWV  +G  + FPGGGT F HGA  YI  L  M+ +    G +
Sbjct: 59  WYANVPHTKLAEEKGGQNWVKVEGDKFRFPGGGTQFPHGADAYIDFLAQMIPDIAWGGRV 118

Query: 225 RSAGVFQVLDVGCGVASFSAFLLPLDIQTMSFAPKDGHENQIQFALERGIGAMISALSTK 284
           R       LDVGCGVASF A+LL  D+ TMSFAPKD HE Q+QFALERG+ AM+  L T+
Sbjct: 119 R-----TALDVGCGVASFGAYLLSRDVLTMSFAPKDVHEAQVQFALERGVPAMLGVLGTR 173

Query: 285 QLPYPSSSFEMVHCSRCRVDWHANDGILLKEVDRVLRPNGYFVYSAPPAY-RKDKDYPLI 343
           +LPYPS SF+M HCSRC + WHANDGILL EVDRVLRP GYFV S PP Y R ++D    
Sbjct: 174 RLPYPSRSFDMAHCSRCLIPWHANDGILLLEVDRVLRPGGYFVLSGPPVYARDEEDLQEE 233

Query: 344 WDKLVNLTTAMCWKLIARKIQTAIWIKEENQSCLLHNADLKLIDVCDAVDEFKPSWNTPL 403
           W  +  L  ++CWKL+A+K   AIW K  N SC       K   +C   D+   +W  P+
Sbjct: 234 WKAMEALAKSLCWKLVAKKGDIAIWQKPVNNSCYNKREPGKKPPLCKDSDDPDAAWYVPM 293

Query: 404 GNCV---QISSAQTNSQKLPPRPERLSVYSESLSRI---GITQEEFTTDTSFWQDQVRHY 457
             C+      S +     L   PERL+     L+     G++ E F  DT  W+ +V  Y
Sbjct: 294 EACITPLPEVSHEVGGGWLEKWPERLTAVPPRLASGQIGGVSAEAFKADTELWKRRVSKY 353

Query: 458 WQLMN--VNETEIRNAMDMNAYCGGFAVALNSLPVWVMNIVPISMKNTLSAIYNRGILGA 515
            +L+   +++  +RN MDMNA  GGFA AL   PVWVMN+VP+   +TL  IY+RG++G 
Sbjct: 354 KRLLKLLIDKGRVRNVMDMNAGFGGFAAALIDDPVWVMNVVPVDSPDTLPVIYDRGLIGI 413

Query: 516 FHDWCEPFSTYPRTYDLLHANHLFSHYKNRGEVCSLEDIMLEMDLIIRPQGFIIIRDEKS 575
           +HDWCEPFSTYPRTYDLLHA+HLFS YK R   C+LEDI+LEMD I+RP G +IIRD+  
Sbjct: 414 YHDWCEPFSTYPRTYDLLHADHLFSLYKKR---CNLEDILLEMDRILRPGGAVIIRDDVD 470

Query: 576 LITRIRDLAPKFLWDVELHSLENREKKMESVLICRK 611
           ++ +++ +A    W+V +   E+     E +LI +K
Sbjct: 471 VLDKVKKIAKAMRWEVRITDTEDGPHDPEKILIAQK 506

This family is a putative S-adenosyl-L-methionine (SAM)-dependent methyltransferase. Length = 506
>gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|223574 COG0500, SmtA, SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 617
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 100.0
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 100.0
PLN02336475 phosphoethanolamine N-methyltransferase 99.79
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.66
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.63
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.62
PLN02233261 ubiquinone biosynthesis methyltransferase 99.61
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.61
PLN02244340 tocopherol O-methyltransferase 99.54
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 99.53
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.52
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 99.49
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.48
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 99.48
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.48
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.45
PLN02336475 phosphoethanolamine N-methyltransferase 99.45
PRK11207197 tellurite resistance protein TehB; Provisional 99.43
PLN02490340 MPBQ/MSBQ methyltransferase 99.43
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.42
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 99.42
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 99.4
PRK08317241 hypothetical protein; Provisional 99.4
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.4
TIGR00452314 methyltransferase, putative. Known examples to dat 99.39
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.38
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.37
PRK05785226 hypothetical protein; Provisional 99.37
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.36
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.36
COG4106257 Tam Trans-aconitate methyltransferase [General fun 99.36
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 99.36
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 99.36
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.34
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 99.34
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 99.32
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.31
KOG1270282 consensus Methyltransferases [Coenzyme transport a 99.3
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.3
PRK12335287 tellurite resistance protein TehB; Provisional 99.3
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.29
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 99.29
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 99.27
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 99.27
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 99.26
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.24
KOG4300252 consensus Predicted methyltransferase [General fun 99.23
PRK06922677 hypothetical protein; Provisional 99.22
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 99.21
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 99.2
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 99.19
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 99.16
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.16
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.16
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 99.15
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.15
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 99.14
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 99.12
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 99.12
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 99.1
PRK06202232 hypothetical protein; Provisional 99.1
PRK04266226 fibrillarin; Provisional 99.09
COG4976287 Predicted methyltransferase (contains TPR repeat) 99.09
PLN02585315 magnesium protoporphyrin IX methyltransferase 99.09
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 99.08
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.07
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 99.06
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.06
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.05
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 99.04
PRK13255218 thiopurine S-methyltransferase; Reviewed 99.04
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 99.04
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.03
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.03
PRK14967223 putative methyltransferase; Provisional 99.02
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 99.01
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.01
KOG3010261 consensus Methyltransferase [General function pred 99.0
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 99.0
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 98.99
PRK14968188 putative methyltransferase; Provisional 98.98
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 98.98
PTZ00146293 fibrillarin; Provisional 98.98
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 98.97
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 98.97
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 98.96
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 98.96
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.96
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 98.96
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 98.95
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 98.95
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 98.95
KOG1271227 consensus Methyltransferases [General function pre 98.93
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 98.93
PLN02232160 ubiquinone biosynthesis methyltransferase 98.92
COG4123248 Predicted O-methyltransferase [General function pr 98.89
PLN03075296 nicotianamine synthase; Provisional 98.89
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 98.88
TIGR03438301 probable methyltransferase. This model represents 98.84
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.84
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.83
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 98.8
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 98.78
TIGR00438188 rrmJ cell division protein FtsJ. 98.77
PRK13256226 thiopurine S-methyltransferase; Reviewed 98.76
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 98.76
PRK10901427 16S rRNA methyltransferase B; Provisional 98.74
TIGR00536284 hemK_fam HemK family putative methylases. The gene 98.73
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 98.73
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 98.72
PHA03411279 putative methyltransferase; Provisional 98.71
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 98.71
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 98.71
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 98.69
PRK07402196 precorrin-6B methylase; Provisional 98.69
PRK14901434 16S rRNA methyltransferase B; Provisional 98.67
PRK14904445 16S rRNA methyltransferase B; Provisional 98.66
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 98.64
KOG2940325 consensus Predicted methyltransferase [General fun 98.63
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 98.61
KOG1975389 consensus mRNA cap methyltransferase [RNA processi 98.6
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 98.59
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 98.59
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 98.58
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 98.57
PRK14903431 16S rRNA methyltransferase B; Provisional 98.56
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 98.54
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.53
KOG2361264 consensus Predicted methyltransferase [General fun 98.52
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 98.52
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 98.51
PRK14902444 16S rRNA methyltransferase B; Provisional 98.51
KOG3045325 consensus Predicted RNA methylase involved in rRNA 98.5
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 98.5
PRK00811283 spermidine synthase; Provisional 98.49
PHA03412241 putative methyltransferase; Provisional 98.48
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 98.46
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 98.45
COG2890280 HemK Methylase of polypeptide chain release factor 98.44
PRK04457262 spermidine synthase; Provisional 98.41
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.4
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 98.39
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.36
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 98.34
PRK01581374 speE spermidine synthase; Validated 98.34
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 98.32
PRK03612521 spermidine synthase; Provisional 98.32
PRK10611287 chemotaxis methyltransferase CheR; Provisional 98.3
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 98.28
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 98.25
PLN02366308 spermidine synthase 98.25
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 98.2
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.19
PLN02672 1082 methionine S-methyltransferase 98.17
KOG2899288 consensus Predicted methyltransferase [General fun 98.17
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 98.17
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 98.17
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 98.1
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 98.09
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 98.09
KOG3987288 consensus Uncharacterized conserved protein DREV/C 98.09
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 98.06
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 98.05
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 98.05
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.02
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 98.01
COG2521287 Predicted archaeal methyltransferase [General func 98.01
COG1041347 Predicted DNA modification methylase [DNA replicat 98.0
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 98.0
COG4122219 Predicted O-methyltransferase [General function pr 97.96
PLN02476278 O-methyltransferase 97.93
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 97.9
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 97.88
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 97.86
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 97.84
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 97.83
KOG1499346 consensus Protein arginine N-methyltransferase PRM 97.83
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 97.83
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 97.82
KOG2904328 consensus Predicted methyltransferase [General fun 97.82
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 97.81
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 97.78
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 97.78
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 97.76
PLN02233261 ubiquinone biosynthesis methyltransferase 97.75
KOG1269364 consensus SAM-dependent methyltransferases [Lipid 97.74
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 97.73
PRK10258251 biotin biosynthesis protein BioC; Provisional 97.73
KOG1331293 consensus Predicted methyltransferase [General fun 97.72
PLN02244340 tocopherol O-methyltransferase 97.7
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 97.68
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 97.67
PRK12335287 tellurite resistance protein TehB; Provisional 97.66
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 97.66
COG2263198 Predicted RNA methylase [Translation, ribosomal st 97.66
PRK04148134 hypothetical protein; Provisional 97.65
PRK11933470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 97.64
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 97.62
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 97.58
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 97.56
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 97.55
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 97.52
PLN02589247 caffeoyl-CoA O-methyltransferase 97.51
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 97.46
PLN02823336 spermine synthase 97.46
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 97.45
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 97.44
PTZ00338294 dimethyladenosine transferase-like protein; Provis 97.43
PRK04338382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.43
TIGR00452314 methyltransferase, putative. Known examples to dat 97.41
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 97.39
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 97.38
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 97.38
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 97.38
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 97.36
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 97.35
PRK11207197 tellurite resistance protein TehB; Provisional 97.34
PRK08317241 hypothetical protein; Provisional 97.34
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 97.34
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 97.34
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 97.33
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 97.33
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 97.29
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 97.24
PRK14968188 putative methyltransferase; Provisional 97.24
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 97.22
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 97.21
PTZ00146293 fibrillarin; Provisional 97.21
KOG3201201 consensus Uncharacterized conserved protein [Funct 97.21
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 97.19
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 97.16
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 97.15
KOG1500517 consensus Protein arginine N-methyltransferase CAR 97.13
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 97.09
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 97.08
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 97.06
PRK00536262 speE spermidine synthase; Provisional 97.04
COG1092393 Predicted SAM-dependent methyltransferases [Genera 97.03
KOG2798369 consensus Putative trehalase [Carbohydrate transpo 97.03
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 96.96
PRK04266226 fibrillarin; Provisional 96.96
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 96.92
COG0421282 SpeE Spermidine synthase [Amino acid transport and 96.92
TIGR00740239 methyltransferase, putative. A simple BLAST search 96.91
KOG2352482 consensus Predicted spermine/spermidine synthase [ 96.89
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 96.86
PRK05785226 hypothetical protein; Provisional 96.85
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 96.83
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 96.83
TIGR02987524 met_A_Alw26 type II restriction m6 adenine DNA met 96.79
COG4627185 Uncharacterized protein conserved in bacteria [Fun 96.74
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 96.73
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 96.71
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 96.71
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 96.69
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 96.69
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 96.69
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 96.68
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 96.66
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 96.66
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 96.65
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 96.64
TIGR00438188 rrmJ cell division protein FtsJ. 96.63
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 96.61
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 96.6
KOG1663237 consensus O-methyltransferase [Secondary metabolit 96.59
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 96.58
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 96.57
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 96.55
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 96.54
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 96.53
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 96.52
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 96.51
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 96.48
COG2520341 Predicted methyltransferase [General function pred 96.48
KOG3420185 consensus Predicted RNA methylase [Translation, ri 96.48
KOG0820315 consensus Ribosomal RNA adenine dimethylase [RNA p 96.47
TIGR00308374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 96.47
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 96.47
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 96.45
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 96.45
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 96.42
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 96.4
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 96.4
COG2265432 TrmA SAM-dependent methyltransferases related to t 96.39
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 96.37
COG3897218 Predicted methyltransferase [General function pred 96.36
PRK06922677 hypothetical protein; Provisional 96.34
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 96.32
COG0742187 N6-adenine-specific methylase [DNA replication, re 96.19
PRK14967223 putative methyltransferase; Provisional 96.17
KOG3010261 consensus Methyltransferase [General function pred 96.17
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 96.16
KOG1709271 consensus Guanidinoacetate methyltransferase and r 96.07
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 96.07
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 96.04
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 96.0
PRK06202232 hypothetical protein; Provisional 95.96
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 95.94
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 95.93
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 95.86
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 95.81
PRK07402196 precorrin-6B methylase; Provisional 95.8
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 95.79
PLN02490340 MPBQ/MSBQ methyltransferase 95.75
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 95.74
COG2890280 HemK Methylase of polypeptide chain release factor 95.7
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 95.67
COG4798238 Predicted methyltransferase [General function pred 95.66
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 95.58
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 95.5
COG4976287 Predicted methyltransferase (contains TPR repeat) 95.5
COG4262508 Predicted spermidine synthase with an N-terminal m 95.47
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 95.46
TIGR00536284 hemK_fam HemK family putative methylases. The gene 95.42
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 95.41
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 95.38
PRK04457262 spermidine synthase; Provisional 95.35
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 95.3
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 95.15
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 95.14
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 95.05
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 94.88
KOG3045325 consensus Predicted RNA methylase involved in rRNA 94.87
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 94.82
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 94.78
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 94.74
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 94.73
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 94.55
COG5459484 Predicted rRNA methylase [Translation, ribosomal s 94.48
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 94.42
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 94.41
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 94.36
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 94.28
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 93.78
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 93.77
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 93.74
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 93.71
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 93.67
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 93.53
PRK13699227 putative methylase; Provisional 93.5
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 93.27
PRK13255218 thiopurine S-methyltransferase; Reviewed 93.18
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 93.09
PF13679141 Methyltransf_32: Methyltransferase domain 93.03
COG4123248 Predicted O-methyltransferase [General function pr 92.97
COG3129292 Predicted SAM-dependent methyltransferase [General 92.96
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 92.96
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 92.92
KOG3115249 consensus Methyltransferase-like protein [General 92.81
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 92.8
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 92.65
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 92.62
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 92.57
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 92.29
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 92.25
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 92.19
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 92.12
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 91.89
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 91.88
TIGR03438301 probable methyltransferase. This model represents 91.78
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 91.72
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 91.71
COG4076252 Predicted RNA methylase [General function predicti 91.55
PLN03075296 nicotianamine synthase; Provisional 91.54
KOG4300252 consensus Predicted methyltransferase [General fun 91.52
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 91.48
PLN02668386 indole-3-acetate carboxyl methyltransferase 91.44
KOG2793248 consensus Putative N2,N2-dimethylguanosine tRNA me 91.31
cd00315275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 91.17
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 91.12
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 90.92
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 90.64
PF03269177 DUF268: Caenorhabditis protein of unknown function 90.62
PRK00811283 spermidine synthase; Provisional 90.58
PF10354166 DUF2431: Domain of unknown function (DUF2431); Int 90.5
PRK14902444 16S rRNA methyltransferase B; Provisional 90.01
PRK10901427 16S rRNA methyltransferase B; Provisional 89.95
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 89.63
PF03492334 Methyltransf_7: SAM dependent carboxyl methyltrans 89.35
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 89.3
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 89.26
PRK11524284 putative methyltransferase; Provisional 89.22
PF02005377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 89.17
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 88.93
KOG4589232 consensus Cell division protein FtsJ [Cell cycle c 88.88
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 88.83
PHA01634156 hypothetical protein 88.07
KOG2198375 consensus tRNA cytosine-5-methylases and related e 87.69
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 87.62
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 86.98
PRK14901434 16S rRNA methyltransferase B; Provisional 86.65
PRK09880343 L-idonate 5-dehydrogenase; Provisional 86.63
PRK01581374 speE spermidine synthase; Validated 86.61
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 86.55
PLN02232160 ubiquinone biosynthesis methyltransferase 86.51
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 86.25
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 86.15
KOG0822649 consensus Protein kinase inhibitor [Cell cycle con 86.1
KOG1562337 consensus Spermidine synthase [Amino acid transpor 85.8
PRK14903431 16S rRNA methyltransferase B; Provisional 85.75
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 85.66
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 84.93
KOG3115249 consensus Methyltransferase-like protein [General 84.56
PF03514374 GRAS: GRAS domain family; InterPro: IPR005202 Sequ 84.24
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 84.07
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 83.36
KOG2361264 consensus Predicted methyltransferase [General fun 82.39
PRK03612521 spermidine synthase; Provisional 82.15
KOG2920282 consensus Predicted methyltransferase [General fun 82.14
PRK14904445 16S rRNA methyltransferase B; Provisional 81.87
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 81.53
PLN02585315 magnesium protoporphyrin IX methyltransferase 81.36
PLN02366308 spermidine synthase 80.87
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 80.7
KOG1271227 consensus Methyltransferases [General function pre 80.43
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 80.15
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information 
Probab=100.00  E-value=3.9e-154  Score=1236.82  Aligned_cols=495  Identities=53%  Similarity=0.985  Sum_probs=475.2

Q ss_pred             CccCCCCchhhhhccccccccccccccCCCCCCCCcCCCCCCCCCCCCCCCCCccccccccccccCcchhhhhccCCCce
Q 039518          107 EYIPCHDPSYVKKLLPSLDLSRKEELERHCPPLEKRLFCLVPPPKDYKIPIRWPTSRDYVWQSNVNHTRLAEVKGGQNWV  186 (617)
Q Consensus       107 ~y~pc~d~~~~~~~~~~~~~~~~~~~er~Cp~~~~r~~Clvp~P~~Y~~P~~wP~s~d~~W~~n~~~~~L~~~k~~q~W~  186 (617)
                      |||||+|+.++.++.  +...+.||+|||||+.+++++||||+|++|+.||+||+|||++|++|+||++|+++|+.|||+
T Consensus         1 dy~PC~D~~~~~~~~--~~~~~~~~rERhCP~~~~~~~CLVp~P~gYk~P~~WP~SRd~iW~~Nvph~~L~~~K~~qnWv   78 (506)
T PF03141_consen    1 DYIPCLDNSRAIKFL--LSRERMEHRERHCPPPEERLRCLVPPPKGYKTPIPWPKSRDYIWYANVPHTKLAEEKADQNWV   78 (506)
T ss_pred             CCcCCCCHHHHHhhc--cCcccccEeeccCcCCCCCCccccCCCccCCCCCCCCcccceeeecccCchHHhhhcccccce
Confidence            799999999987763  445566899999999999999999999999999999999999999999999999999999999


Q ss_pred             eccCcceecCCCCCcccCChhHHHHHHHhhhhh--ccCCcccCCCCeEEEECCCCcHHHHHhccCCCcEEEeeecCCcHH
Q 039518          187 HEKGQLWWFPGGGTHFKHGAPEYIQRLGNMMTN--ETGNLRSAGVFQVLDVGCGVASFSAFLLPLDIQTMSFAPKDGHEN  264 (617)
Q Consensus       187 ~~e~d~~~Fpgggt~F~~~a~~Y~~~L~~~L~~--~~~~lr~~~g~rVLDIGCGtG~~a~~La~~gv~~v~v~~iDis~~  264 (617)
                      +.+|+++.|||||++|.+|+.+|++.|.++++.  ..+.+|+     +||||||+|+|+++|+++++.++++++.|.+++
T Consensus        79 ~~~gd~~~FPgggt~F~~Ga~~Yid~i~~~~~~~~~~g~iR~-----~LDvGcG~aSF~a~l~~r~V~t~s~a~~d~~~~  153 (506)
T PF03141_consen   79 RVEGDKFRFPGGGTMFPHGADHYIDQIAEMIPLIKWGGGIRT-----ALDVGCGVASFGAYLLERNVTTMSFAPNDEHEA  153 (506)
T ss_pred             eecCCEEEeCCCCccccCCHHHHHHHHHHHhhccccCCceEE-----EEeccceeehhHHHHhhCCceEEEcccccCCch
Confidence            999999999999999999999999999999988  6777887     999999999999999999999999999999999


Q ss_pred             HHHHHHHhCCCcEEEEecCCCCCCCCCCeeEEEecccccccccchHHHHHHHHHhccCCeEEEEEeCCCC-CCCCCChhh
Q 039518          265 QIQFALERGIGAMISALSTKQLPYPSSSFEMVHCSRCRVDWHANDGILLKEVDRVLRPNGYFVYSAPPAY-RKDKDYPLI  343 (617)
Q Consensus       265 ~lq~A~erg~~~~~~~~d~~~Lpf~d~sFDlV~~s~~l~h~~~d~~~~L~el~RvLrPGG~Liis~p~~~-~~~~~~~~~  343 (617)
                      ++|+|.|||+++.+.+...++|||++++||+|||++|+..|..+.+.+|.|++|+|||||+|+++.|+.+ ....+....
T Consensus       154 qvqfaleRGvpa~~~~~~s~rLPfp~~~fDmvHcsrc~i~W~~~~g~~l~evdRvLRpGGyfv~S~ppv~~r~~~~~~~~  233 (506)
T PF03141_consen  154 QVQFALERGVPAMIGVLGSQRLPFPSNAFDMVHCSRCLIPWHPNDGFLLFEVDRVLRPGGYFVLSGPPVYQRTDEDLEEE  233 (506)
T ss_pred             hhhhhhhcCcchhhhhhccccccCCccchhhhhcccccccchhcccceeehhhhhhccCceEEecCCcccccchHHHHHH
Confidence            9999999999999998889999999999999999999999998888999999999999999999999999 444566788


Q ss_pred             HHHHHHHHHHcCceEEEEeeeeEEEeeccchhhhhhcccCccCCccccCCCCCCccccccccccccccc---ccCCCCCC
Q 039518          344 WDKLVNLTTAMCWKLIARKIQTAIWIKEENQSCLLHNADLKLIDVCDAVDEFKPSWNTPLGNCVQISSA---QTNSQKLP  420 (617)
Q Consensus       344 W~~le~La~~~gw~~v~~~~~~~IwqKp~~~~C~~~r~~~~~p~lC~~~~d~~~~WY~~L~~c~~~~~~---~~~~~~~~  420 (617)
                      |++|+++++++||+++.++++++|||||.+++||.+|+..+.|++|++.+|+|++||++|++||+++++   +.++++++
T Consensus       234 ~~~~~~l~~~lCW~~va~~~~~aIwqKp~~~~Cy~~r~~~~~pplC~~~~dpd~aWY~~l~~Cit~~p~~~~~~~~~~~~  313 (506)
T PF03141_consen  234 WNAMEDLAKSLCWKKVAEKGDTAIWQKPTNNSCYQKRKPGKSPPLCDSSDDPDAAWYVPLEACITPLPEVSSEIAGGWLP  313 (506)
T ss_pred             HHHHHHHHHHHHHHHheeeCCEEEEeccCCchhhhhccCCCCCCCCCCCCCCcchhhcchhhhcCcCCcccccccccCCC
Confidence            999999999999999999999999999999999999988889999998899999999999999998865   47889999


Q ss_pred             CCCCccccCCccccc---cccCccccccchhhHHHHHHHHHHhcc--CCCCCeeeEEeccccccchhhhccCCCeEEEEe
Q 039518          421 PRPERLSVYSESLSR---IGITQEEFTTDTSFWQDQVRHYWQLMN--VNETEIRNAMDMNAYCGGFAVALNSLPVWVMNI  495 (617)
Q Consensus       421 ~wp~rl~~~p~~~~~---~~~~~~~f~~d~~~w~~~v~~y~~~~~--~~~~~~Rn~mDm~~~~g~faa~l~~~~v~vmnv  495 (617)
                      +||+||+++|+|+..   .|+++|.|++|+++|+++|++|+++++  +++++||||||||||+|||||||.++|||||||
T Consensus       314 ~WP~RL~~~P~rl~~~~~~g~~~e~F~~Dt~~Wk~~V~~Y~~l~~~~i~~~~iRNVMDMnAg~GGFAAAL~~~~VWVMNV  393 (506)
T PF03141_consen  314 KWPERLNAVPPRLSSGSIPGISPEEFKEDTKHWKKRVSHYKKLLGLAIKWGRIRNVMDMNAGYGGFAAALIDDPVWVMNV  393 (506)
T ss_pred             CChhhhccCchhhhcCCcCCCCHHHHHHHHHHHHHHHHHHHHhhcccccccceeeeeeecccccHHHHHhccCCceEEEe
Confidence            999999999999764   899999999999999999999999888  999999999999999999999999999999999


Q ss_pred             ccCCCCchhHHHHhhcccccccccCCCCCCCCCccchhhccccccccccCCCCCChhhHHhhhhhcccCCceEEEecChH
Q 039518          496 VPISMKNTLSAIYNRGILGAFHDWCEPFSTYPRTYDLLHANHLFSHYKNRGEVCSLEDIMLEMDLIIRPQGFIIIRDEKS  575 (617)
Q Consensus       496 ~p~~~~~~l~~~~~RGlig~~~~~~~~f~typrtyDl~H~~~~~s~~~~~~~~c~~~~~l~e~dRilRP~G~~i~~d~~~  575 (617)
                      ||..++|||++||||||||+||||||+|||||||||||||++|||+|   .+||+|++|||||||||||||++||||+.+
T Consensus       394 VP~~~~ntL~vIydRGLIG~yhDWCE~fsTYPRTYDLlHA~~lfs~~---~~rC~~~~illEmDRILRP~G~~iiRD~~~  470 (506)
T PF03141_consen  394 VPVSGPNTLPVIYDRGLIGVYHDWCEAFSTYPRTYDLLHADGLFSLY---KDRCEMEDILLEMDRILRPGGWVIIRDTVD  470 (506)
T ss_pred             cccCCCCcchhhhhcccchhccchhhccCCCCcchhheehhhhhhhh---cccccHHHHHHHhHhhcCCCceEEEeccHH
Confidence            99999999999999999999999999999999999999999999999   899999999999999999999999999999


Q ss_pred             HHHHHHhhhhcCCceEEEeeccccCCCceeEEEEEe
Q 039518          576 LITRIRDLAPKFLWDVELHSLENREKKMESVLICRK  611 (617)
Q Consensus       576 ~~~~~~~~~~~~~W~~~~~~~e~~~~~~~~~l~~~k  611 (617)
                      ++++|++|+++|||+++++++|+|++++||||||||
T Consensus       471 vl~~v~~i~~~lrW~~~~~d~e~g~~~~EkiL~~~K  506 (506)
T PF03141_consen  471 VLEKVKKIAKSLRWEVRIHDTEDGPDGPEKILICQK  506 (506)
T ss_pred             HHHHHHHHHHhCcceEEEEecCCCCCCCceEEEEEC
Confidence            999999999999999999999999999999999998

; GO: 0008168 methyltransferase activity
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>KOG3201 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information
>KOG2793 consensus Putative N2,N2-dimethylguanosine tRNA methyltransferase [RNA processing and modification] Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03269 DUF268: Caenorhabditis protein of unknown function, DUF268; InterPro: IPR004951 This family consists of proteins of unknown function found in Caenorhabditis species Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PF10354 DUF2431: Domain of unknown function (DUF2431); InterPro: IPR019446 This entry represents the N-terminal domain of a family of proteins whose function is not known Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>KOG2198 consensus tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>KOG0822 consensus Protein kinase inhibitor [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1562 consensus Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>PF03514 GRAS: GRAS domain family; InterPro: IPR005202 Sequence analysis of the products of the GRAS (GAI, RGA, SCR) gene family indicates that they share a variable N terminus and a highly conserved C terminus that contains five recognizable motifs [] Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>KOG2920 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query617
2avn_A260 Crystal Structure Of A UbiquinoneMENAQUINONE BIOSYN 7e-05
3l8d_A242 Crystal Structure Of Methyltransferase From Bacillu 8e-05
>pdb|2AVN|A Chain A, Crystal Structure Of A UbiquinoneMENAQUINONE BIOSYNTHESIS Methyltransferase-Related Protein (Tm1389) From Thermotoga Maritima Msb8 At 2.35 A Resolution Length = 260 Back     alignment and structure 
Iteration: 1

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 49/104 (47%), Gaps = 4/104 (3%)
Query: 231 QVLDVGCGVASFSAFLLPLDIQTMSFAPKDGHENQIQFALERGIGAMISALSTKQLPYPS 290
           +VLD+G G   +S FL     + +   P    +  ++ A E+G+  ++ A   + LP+PS
Sbjct: 57  RVLDLGGGTGKWSLFLQERGFEVVLVDP---SKEXLEVAREKGVKNVVEA-KAEDLPFPS 112
Query: 291 SSFEMVHCSRCRVDWHANDGILLKEVDRVLRPNGYFVYSAPPAY 334
            +FE V      + +  N      E+ RVL P+G  + +    Y
Sbjct: 113 GAFEAVLALGDVLSYVENKDKAFSEIRRVLVPDGLLIATVDNFY 156
>pdb|3L8D|A Chain A, Crystal Structure Of Methyltransferase From Bacillus Thuringiensis Length = 242 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query617
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 1e-10
3f4k_A257 Putative methyltransferase; structural genomics, P 9e-09
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 1e-08
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 2e-08
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 2e-08
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 4e-08
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 4e-08
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 4e-08
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 5e-08
3i9f_A170 Putative type 11 methyltransferase; structural gen 1e-07
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 2e-07
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
3ege_A261 Putative methyltransferase from antibiotic biosyn 1e-06
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 1e-06
1xxl_A239 YCGJ protein; structural genomics, protein structu 2e-06
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 3e-06
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 4e-06
3cc8_A230 Putative methyltransferase; structural genomics, j 5e-06
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 7e-06
1vl5_A260 Unknown conserved protein BH2331; putative methylt 8e-06
1vlm_A219 SAM-dependent methyltransferase; possible histamin 9e-06
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 9e-06
3m33_A226 Uncharacterized protein; structural genomics, PSI- 1e-05
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 2e-05
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 4e-05
3gu3_A284 Methyltransferase; alpha-beta protein, structural 5e-05
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 5e-05
2kw5_A202 SLR1183 protein; structural genomics, northeast st 5e-05
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 8e-05
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 8e-05
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 9e-05
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 4e-04
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 5e-04
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 5e-04
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 Back     alignment and structure
 Score = 61.0 bits (148), Expect = 1e-10
 Identities = 36/132 (27%), Positives = 51/132 (38%), Gaps = 30/132 (22%)

Query: 232 VLDVGCGVASFSAFLLP-------LDIQTMSFAPKDGHENQIQFALERGIGAMIS----- 279
           VLDVGCG    +  L         +DI   S       E  IQ   ERG G  +S     
Sbjct: 57  VLDVGCGDGYGTYKLSRTGYKAVGVDI---S-------EVMIQKGKERGEGPDLSFIKGD 106

Query: 280 ALSTKQLPYPSSSFEMVHCSRCRVDWHAND-GILLKEVDRVLRPNGYFVYS--APPAYRK 336
                 LP+ +  FE +            +    L E+ RVL+ +GY   +   P A  +
Sbjct: 107 LS---SLPFENEQFEAIMAIN--SLEWTEEPLRALNEIKRVLKSDGYACIAILGPTAKPR 161

Query: 337 DKDYPLIWDKLV 348
           +  YP ++ K V
Sbjct: 162 ENSYPRLYGKDV 173
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 203 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Length = 243 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Length = 227 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Length = 253 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Length = 261 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Length = 273 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 195 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Length = 230 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Length = 266 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Length = 219 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Length = 297 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Length = 269 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Length = 263 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Length = 211 Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Length = 202 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Length = 211 Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Length = 215 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Length = 299 Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Length = 199 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Length = 241 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Length = 235 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query617
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.63
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.62
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.61
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.61
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 99.61
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.59
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.59
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.58
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 99.58
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.58
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.58
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.57
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.57
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.56
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 99.56
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.55
3f4k_A257 Putative methyltransferase; structural genomics, P 99.55
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.55
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.55
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.55
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.54
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 99.54
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.54
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.54
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.54
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.53
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.53
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.53
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 99.53
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.52
3gu3_A284 Methyltransferase; alpha-beta protein, structural 99.52
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.52
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.52
3lcc_A235 Putative methyl chloride transferase; halide methy 99.52
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 99.52
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.51
3ege_A261 Putative methyltransferase from antibiotic biosyn 99.51
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.51
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.51
3ocj_A305 Putative exported protein; structural genomics, PS 99.5
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 99.49
1vlm_A219 SAM-dependent methyltransferase; possible histamin 99.49
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.49
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 99.49
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.48
4e2x_A416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 99.48
3cc8_A230 Putative methyltransferase; structural genomics, j 99.48
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.47
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 99.47
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.47
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 99.46
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 99.46
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.45
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.45
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 99.44
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.44
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.44
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.44
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 99.43
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.43
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.43
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.42
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 99.42
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 99.41
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 99.4
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.4
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.4
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.4
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.39
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.39
2i62_A265 Nicotinamide N-methyltransferase; structural genom 99.39
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 99.38
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.37
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.35
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 99.34
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.34
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.34
3lpm_A259 Putative methyltransferase; structural genomics, p 99.33
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.33
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.33
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.33
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.32
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.32
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.32
1wzn_A252 SAM-dependent methyltransferase; structural genomi 99.32
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 99.31
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.31
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.3
2r3s_A335 Uncharacterized protein; methyltransferase domain, 99.29
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.29
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.29
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 99.29
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.28
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.28
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 99.28
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 99.28
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.27
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.27
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.27
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.27
3dp7_A363 SAM-dependent methyltransferase; structural genomi 99.27
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 99.27
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.27
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 99.25
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.25
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.24
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 99.23
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.23
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.22
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.21
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 99.21
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.21
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.2
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 99.2
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.2
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.19
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.18
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.18
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.18
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.17
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.17
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 99.17
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.17
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.17
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.17
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 99.16
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.16
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 99.16
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 99.16
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 99.16
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 99.15
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 99.15
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 99.15
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.15
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.14
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.14
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.14
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.14
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 99.14
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 99.13
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 99.13
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.13
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.13
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.12
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.12
2fyt_A340 Protein arginine N-methyltransferase 3; structural 99.12
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 99.1
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.1
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 99.1
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.09
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.09
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 99.09
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 99.08
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.08
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.08
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.08
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 99.07
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.07
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 99.07
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 99.07
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.06
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 99.05
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.05
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.05
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.04
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 99.03
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.02
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 99.01
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.01
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.0
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.0
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 98.99
1ne2_A200 Hypothetical protein TA1320; structural genomics, 98.98
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 98.98
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 98.98
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 98.98
2qm3_A373 Predicted methyltransferase; putative methyltransf 98.95
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 98.95
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 98.95
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 98.95
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 98.95
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 98.94
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 98.94
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 98.94
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 98.94
2b25_A336 Hypothetical protein; structural genomics, methyl 98.93
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 98.93
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 98.92
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 98.92
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 98.91
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 98.91
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 98.91
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 98.9
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 98.9
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 98.89
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 98.89
3duw_A223 OMT, O-methyltransferase, putative; alternating of 98.88
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 98.88
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 98.88
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 98.87
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 98.87
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 98.86
1xj5_A334 Spermidine synthase 1; structural genomics, protei 98.86
3sso_A419 Methyltransferase; macrolide, natural product, ros 98.85
3m6w_A464 RRNA methylase; rRNA methyltransferase, 5-methylcy 98.83
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 98.83
3k6r_A278 Putative transferase PH0793; structural genomics, 98.82
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 98.82
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 98.81
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 98.8
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 98.8
2b78_A385 Hypothetical protein SMU.776; structure genomics, 98.8
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 98.8
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 98.8
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 98.79
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 98.78
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 98.78
2i7c_A283 Spermidine synthase; transferase, structural genom 98.78
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 98.77
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 98.77
2o07_A304 Spermidine synthase; structural genomics, structur 98.76
3gjy_A317 Spermidine synthase; APC62791, structural genomics 98.75
2pt6_A321 Spermidine synthase; transferase, structural genom 98.75
2h00_A254 Methyltransferase 10 domain containing protein; st 98.75
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 98.75
2avd_A229 Catechol-O-methyltransferase; structural genomics, 98.74
2frx_A479 Hypothetical protein YEBU; rossmann-type S-adenosy 98.74
3giw_A277 Protein of unknown function DUF574; rossmann-fold 98.74
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 98.73
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 98.73
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 98.73
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 98.72
2cmg_A262 Spermidine synthase; transferase, putrescine amino 98.7
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 98.7
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 98.69
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 98.68
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 98.68
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 98.68
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 98.68
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 98.67
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 98.62
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 98.6
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 98.59
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 98.59
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 98.55
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 98.5
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 98.48
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 98.48
2ih2_A421 Modification methylase TAQI; DNA, DNA methyltransf 98.47
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 98.41
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.39
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 98.34
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 98.34
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.26
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.25
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 98.24
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 98.24
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.23
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 98.22
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.21
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 98.18
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 98.17
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 98.16
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 98.16
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 98.12
3i9f_A170 Putative type 11 methyltransferase; structural gen 98.1
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 98.08
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 98.08
3axs_A392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 98.07
3ocj_A305 Putative exported protein; structural genomics, PS 98.07
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 98.06
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 98.06
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 98.06
4hg2_A257 Methyltransferase type 11; structural genomics, PS 98.06
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 98.05
3hnr_A220 Probable methyltransferase BT9727_4108; structural 98.04
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 98.02
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.01
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 98.0
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.0
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 98.0
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 98.0
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 97.99
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 97.99
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 97.99
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 97.98
2p7i_A250 Hypothetical protein; putative methyltransferase, 97.98
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 97.98
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 97.98
3lcc_A235 Putative methyl chloride transferase; halide methy 97.98
3dh0_A219 SAM dependent methyltransferase; cystal structure, 97.97
2dul_A378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 97.96
1xxl_A239 YCGJ protein; structural genomics, protein structu 97.96
3fut_A271 Dimethyladenosine transferase; methyltransferase, 97.95
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 97.95
1jsx_A207 Glucose-inhibited division protein B; methyltransf 97.93
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 97.93
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 97.92
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 97.92
3m70_A286 Tellurite resistance protein TEHB homolog; structu 97.92
3f4k_A257 Putative methyltransferase; structural genomics, P 97.9
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 97.9
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 97.89
3cc8_A230 Putative methyltransferase; structural genomics, j 97.88
1vl5_A260 Unknown conserved protein BH2331; putative methylt 97.88
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 97.87
2i62_A265 Nicotinamide N-methyltransferase; structural genom 97.87
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 97.87
2efj_A384 3,7-dimethylxanthine methyltransferase; SAM-depend 97.86
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 97.86
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 97.85
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 97.85
3ege_A261 Putative methyltransferase from antibiotic biosyn 97.84
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 97.83
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 97.83
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 97.83
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 97.83
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 97.82
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 97.82
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 97.81
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 97.81
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 97.79
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 97.79
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 97.78
2ar0_A541 M.ecoki, type I restriction enzyme ecoki M protein 97.78
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 97.78
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 97.78
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 97.78
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 97.76
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 97.76
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 97.75
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 97.75
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 97.74
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 97.74
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 97.74
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 97.74
1vlm_A219 SAM-dependent methyltransferase; possible histamin 97.74
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 97.74
4gqb_A637 Protein arginine N-methyltransferase 5; TIM barrel 97.73
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 97.72
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 97.71
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 97.7
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 97.7
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 97.69
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 97.68
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 97.67
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 97.67
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 97.67
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 97.66
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 97.66
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 97.66
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 97.65
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 97.64
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 97.63
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 97.63
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 97.62
3khk_A544 Type I restriction-modification system methylation 97.6
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 97.6
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 97.59
1wzn_A252 SAM-dependent methyltransferase; structural genomi 97.59
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 97.58
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 97.58
2kw5_A202 SLR1183 protein; structural genomics, northeast st 97.56
3ua3_A745 Protein arginine N-methyltransferase 5; TIM-barrel 97.54
3ll7_A410 Putative methyltransferase; methytransferase, stru 97.54
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 97.53
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 97.52
3lpm_A259 Putative methyltransferase; structural genomics, p 97.52
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 97.51
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 97.5
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 97.5
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 97.49
3lkd_A542 Type I restriction-modification system methyltrans 97.49
3m33_A226 Uncharacterized protein; structural genomics, PSI- 97.49
3dtn_A234 Putative methyltransferase MM_2633; structural gen 97.49
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 97.47
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 97.46
2frn_A278 Hypothetical protein PH0793; structural genomics, 97.46
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 97.45
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 97.45
3duw_A223 OMT, O-methyltransferase, putative; alternating of 97.44
2b3t_A276 Protein methyltransferase HEMK; translation termin 97.44
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 97.42
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 97.41
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 97.41
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 97.39
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 97.38
3dp7_A363 SAM-dependent methyltransferase; structural genomi 97.37
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 97.37
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 97.37
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 97.35
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 97.35
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 97.34
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 97.33
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 97.33
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 97.31
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 97.31
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 97.3
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 97.3
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 97.3
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 97.29
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 97.28
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 97.27
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 97.24
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 97.24
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 97.22
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 97.22
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 97.21
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 97.2
3cvo_A202 Methyltransferase-like protein of unknown functio; 97.19
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 97.19
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 97.19
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 97.18
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 97.18
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 97.17
2r3s_A335 Uncharacterized protein; methyltransferase domain, 97.17
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 97.16
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 97.14
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 97.14
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 97.14
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 97.1
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 97.09
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 97.09
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 97.09
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 97.08
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 97.07
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 97.06
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 97.04
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 97.03
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 97.02
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 97.01
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 97.01
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 96.99
2esr_A177 Methyltransferase; structural genomics, hypothetic 96.98
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 96.97
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 96.96
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 96.94
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 96.94
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 96.94
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 96.86
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 96.85
1yb2_A275 Hypothetical protein TA0852; structural genomics, 96.83
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 96.79
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 96.76
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 96.75
1ws6_A171 Methyltransferase; structural genomics, riken stru 96.75
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 96.74
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 96.73
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 96.71
3sso_A419 Methyltransferase; macrolide, natural product, ros 96.69
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 96.66
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 96.63
2b25_A336 Hypothetical protein; structural genomics, methyl 96.61
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 96.61
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 96.6
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 96.6
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 96.58
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 96.57
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 96.57
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 96.54
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 96.46
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 96.42
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 96.42
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 96.4
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 96.4
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 96.4
2avd_A229 Catechol-O-methyltransferase; structural genomics, 96.38
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 96.37
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 96.3
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 96.3
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 96.28
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 96.26
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 96.25
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 96.23
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 96.22
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 96.21
2px2_A269 Genome polyprotein [contains: capsid protein C (co 96.2
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 96.19
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 96.19
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 96.17
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 96.15
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 96.08
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 96.05
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 96.03
2fpo_A202 Methylase YHHF; structural genomics, putative meth 96.02
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 96.02
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 95.99
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 95.98
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 95.96
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 95.89
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 95.88
1xj5_A334 Spermidine synthase 1; structural genomics, protei 95.88
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 95.83
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 95.76
3lkz_A321 Non-structural protein 5; flavivirus, methyltransf 95.75
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 95.74
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 95.72
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 95.62
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 95.62
2pt6_A321 Spermidine synthase; transferase, structural genom 95.53
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
Probab=99.63  E-value=2e-15  Score=148.58  Aligned_cols=130  Identities=15%  Similarity=0.102  Sum_probs=105.5

Q ss_pred             CCCeEEEECCCCcHHHHHhccCCCcEEEeeecCCcHHHHHHHHHhCC-CcEEEEecCCCCCCCCCCeeEEEecccccccc
Q 039518          228 GVFQVLDVGCGVASFSAFLLPLDIQTMSFAPKDGHENQIQFALERGI-GAMISALSTKQLPYPSSSFEMVHCSRCRVDWH  306 (617)
Q Consensus       228 ~g~rVLDIGCGtG~~a~~La~~gv~~v~v~~iDis~~~lq~A~erg~-~~~~~~~d~~~Lpf~d~sFDlV~~s~~l~h~~  306 (617)
                      ++.+|||||||+|.++..+++.+.   .++++|+++.+++.|+++.. ++.+..+|++.+ +++++||+|++..+++|+.
T Consensus        42 ~~~~vLDiGcG~G~~~~~l~~~~~---~v~gvD~s~~~~~~a~~~~~~~v~~~~~d~~~~-~~~~~fD~v~~~~~l~~~~  117 (250)
T 2p7i_A           42 RPGNLLELGSFKGDFTSRLQEHFN---DITCVEASEEAISHAQGRLKDGITYIHSRFEDA-QLPRRYDNIVLTHVLEHID  117 (250)
T ss_dssp             CSSCEEEESCTTSHHHHHHTTTCS---CEEEEESCHHHHHHHHHHSCSCEEEEESCGGGC-CCSSCEEEEEEESCGGGCS
T ss_pred             CCCcEEEECCCCCHHHHHHHHhCC---cEEEEeCCHHHHHHHHHhhhCCeEEEEccHHHc-CcCCcccEEEEhhHHHhhc
Confidence            445699999999999999998876   57788999999999998865 688888888887 4688999999999888876


Q ss_pred             cchHHHHHHHH-HhccCCeEEEEEeCCCCCC------------CC----------C--ChhhHHHHHHHHHHcCceEEEE
Q 039518          307 ANDGILLKEVD-RVLRPNGYFVYSAPPAYRK------------DK----------D--YPLIWDKLVNLTTAMCWKLIAR  361 (617)
Q Consensus       307 ~d~~~~L~el~-RvLrPGG~Liis~p~~~~~------------~~----------~--~~~~W~~le~La~~~gw~~v~~  361 (617)
                       ++..+|+++. |+|||||++++++|.....            ..          .  ....-+++.+++++.||+++..
T Consensus       118 -~~~~~l~~~~~~~LkpgG~l~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~Gf~~~~~  196 (250)
T 2p7i_A          118 -DPVALLKRINDDWLAEGGRLFLVCPNANAVSRQIAVKMGIISHNSAVTEAEFAHGHRCTYALDTLERDASRAGLQVTYR  196 (250)
T ss_dssp             -SHHHHHHHHHHTTEEEEEEEEEEEECTTCHHHHHHHHTTSSSSTTCCCHHHHHTTCCCCCCHHHHHHHHHHTTCEEEEE
T ss_pred             -CHHHHHHHHHHHhcCCCCEEEEEcCChHHHHHHHHHHcCccccchhcccccccccccccCCHHHHHHHHHHCCCeEEEE
Confidence             8899999999 9999999999998754210            00          0  0112345889999999999875


Q ss_pred             e
Q 039518          362 K  362 (617)
Q Consensus       362 ~  362 (617)
                      .
T Consensus       197 ~  197 (250)
T 2p7i_A          197 S  197 (250)
T ss_dssp             E
T ss_pred             e
Confidence            4
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 617
d1wzna1251 c.66.1.43 (A:1-251) Hypothetical methyltransferase 2e-08
d1xvaa_292 c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Ra 9e-06
d2gh1a1281 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bac 7e-05
d1y8ca_246 c.66.1.43 (A:) Putative methyltransferase CAC2371 3e-04
d1xxla_234 c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus 9e-04
d1yb2a1250 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T 0.001
d1nkva_245 c.66.1.21 (A:) Hypothetical Protein YjhP {Escheric 0.002
d2avna1246 c.66.1.41 (A:1-246) Hypothetical methyltransferase 0.003
d1g8sa_230 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Meth 0.003
d2i6ga1198 c.66.1.44 (A:1-198) Putative methyltransferase Teh 0.003
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 251 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: CAC2371-like
domain: Hypothetical methyltransferase PH1305
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]

 Score = 53.2 bits (126), Expect = 2e-08
 Identities = 18/127 (14%), Positives = 41/127 (32%), Gaps = 2/127 (1%)

Query: 232 VLDVGCGVASFSAFLLPLDIQTMSFAPKDGHENQIQFALERGIGAMISALSTKQLPYPSS 291
           VLD+ CG    +  L     + +     +      +   +     +             +
Sbjct: 45  VLDLACGTGIPTLELAERGYEVVGLDLHEEMLRVARRKAKERNLKIEFLQGDVLEIAFKN 104

Query: 292 SFEMVHCSRCRVDWH--ANDGILLKEVDRVLRPNGYFVYSAPPAYRKDKDYPLIWDKLVN 349
            F+ V      + +    +   L  +V   L+P G F+   P  +   +D P++W++   
Sbjct: 105 EFDAVTMFFSTIMYFDEEDLRKLFSKVAEALKPGGVFITDFPCWFYGGRDGPVVWNEQKG 164

Query: 350 LTTAMCW 356
               +  
Sbjct: 165 EEKLVIM 171
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 292 Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Length = 281 Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Length = 246 Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Length = 245 Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Length = 246 Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query617
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.73
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.71
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.69
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.67
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.66
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.64
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.62
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.62
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.62
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.58
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.57
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.55
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.55
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.53
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.51
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.48
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.48
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.47
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.44
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 99.42
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.41
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 99.4
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.39
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.38
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.37
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.36
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.35
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.35
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.32
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.31
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.3
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.3
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.27
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.27
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 99.26
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.24
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.21
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.17
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.15
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.14
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.1
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.06
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 99.05
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 99.04
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.0
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 98.99
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 98.96
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 98.96
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 98.89
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 98.8
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 98.66
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 98.66
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 98.65
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 98.64
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 98.61
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 98.53
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 98.52
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 98.5
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 98.49
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 98.46
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 98.44
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 98.44
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 98.35
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 98.33
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 98.33
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 98.32
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 98.3
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 98.24
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.2
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 98.18
d2h00a1250 Methyltransferase 10 domain containing protein MET 98.18
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 98.11
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 98.09
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 98.06
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.06
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 98.05
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 98.03
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.03
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.02
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.01
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 97.99
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 97.96
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 97.96
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 97.95
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 97.94
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 97.91
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 97.88
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 97.88
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 97.79
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 97.79
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 97.78
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 97.77
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 97.74
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 97.72
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 97.69
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 97.68
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 97.67
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 97.65
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 97.63
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 97.59
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 97.54
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 97.51
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 97.47
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 97.46
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 97.46
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 97.44
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 97.41
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 97.37
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 97.36
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 97.35
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 97.34
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 97.33
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 97.3
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 97.25
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 97.25
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 97.24
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 97.24
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 97.2
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 97.18
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 97.17
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 97.15
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 97.12
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 97.12
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 97.11
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 97.09
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 97.08
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 97.05
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 97.01
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 97.0
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 96.97
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 96.93
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 96.69
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 96.61
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 96.54
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 96.22
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 96.15
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 96.15
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 96.1
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 95.99
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 95.89
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 95.59
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 95.32
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 95.07
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 94.93
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 94.74
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 94.71
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 94.66
d2ar0a1524 M.EcoKI {Escherichia coli [TaxId: 562]} 94.64
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 94.46
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 94.31
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 94.3
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 94.25
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 94.19
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 94.18
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 93.86
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 93.72
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 93.43
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 93.24
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 93.12
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 92.88
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 92.48
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 92.21
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 92.07
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 91.68
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 91.47
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 91.25
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 91.04
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 91.04
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 91.0
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 90.92
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 90.56
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 89.91
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 89.9
d1m6ex_359 Salicylic acid carboxyl methyltransferase (SAMT) { 88.51
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 88.51
d1i4wa_322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 86.73
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 86.01
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 85.96
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 85.42
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 85.16
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 85.11
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 84.16
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 84.07
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 84.04
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 84.02
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 83.68
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 83.27
d1g55a_343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 83.02
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 82.6
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 82.39
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 82.35
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 81.6
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 80.88
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 80.49
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: UbiE/COQ5-like
domain: Hypothetical protein BH2331
species: Bacillus halodurans [TaxId: 86665]

Probab=99.73  E-value=9.8e-18  Score=162.86  Aligned_cols=132  Identities=19%  Similarity=0.242  Sum_probs=103.0

Q ss_pred             ccCCCCeEEEECCCCcHHHHHhccCCCcEEEeeecCCcHHHHHHHHHh----C-CCcEEEEecCCCCCCCCCCeeEEEec
Q 039518          225 RSAGVFQVLDVGCGVASFSAFLLPLDIQTMSFAPKDGHENQIQFALER----G-IGAMISALSTKQLPYPSSSFEMVHCS  299 (617)
Q Consensus       225 r~~~g~rVLDIGCGtG~~a~~La~~gv~~v~v~~iDis~~~lq~A~er----g-~~~~~~~~d~~~Lpf~d~sFDlV~~s  299 (617)
                      .++++.+|||||||+|.++..|++++.   .++++|+|+.+++.|+++    + .++.+.+++.+++|+++++||+|+|.
T Consensus        12 ~l~~~~rVLDiGcG~G~~~~~l~~~~~---~v~gvD~s~~~i~~A~~~~~~~~~~~i~~~~~d~~~l~~~~~~fD~v~~~   88 (231)
T d1vl5a_          12 ALKGNEEVLDVATGGGHVANAFAPFVK---KVVAFDLTEDILKVARAFIEGNGHQQVEYVQGDAEQMPFTDERFHIVTCR   88 (231)
T ss_dssp             TCCSCCEEEEETCTTCHHHHHHGGGSS---EEEEEESCHHHHHHHHHHHHHTTCCSEEEEECCC-CCCSCTTCEEEEEEE
T ss_pred             CCCCcCEEEEecccCcHHHHHHHHhCC---EEEEEECCHHHHhhhhhccccccccccccccccccccccccccccccccc
Confidence            446677899999999999999998875   578889999999998765    3 45789999999999999999999999


Q ss_pred             ccccccccchHHHHHHHHHhccCCeEEEEEeCCCCCCC--------------CCC--hhhHHHHHHHHHHcCceEEE
Q 039518          300 RCRVDWHANDGILLKEVDRVLRPNGYFVYSAPPAYRKD--------------KDY--PLIWDKLVNLTTAMCWKLIA  360 (617)
Q Consensus       300 ~~l~h~~~d~~~~L~el~RvLrPGG~Liis~p~~~~~~--------------~~~--~~~W~~le~La~~~gw~~v~  360 (617)
                      .+++|+. |+..+|+++.|+|||||++++.++......              ..+  ...-.++.++++++||+.+.
T Consensus        89 ~~l~~~~-d~~~~l~~~~r~LkpgG~l~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~aGf~~~~  164 (231)
T d1vl5a_          89 IAAHHFP-NPASFVSEAYRVLKKGGQLLLVDNSAPENDAFDVFYNYVEKERDYSHHRAWKKSDWLKMLEEAGFELEE  164 (231)
T ss_dssp             SCGGGCS-CHHHHHHHHHHHEEEEEEEEEEEEEBCSSHHHHHHHHHHHHHHCTTCCCCCBHHHHHHHHHHHTCEEEE
T ss_pred             ccccccC-CHHHHHHHHHHhcCCCcEEEEEeCCCCCCHHHHHHHHHHHhhcccCcccCCCHHHHHHHHHHCCCEEEE
Confidence            9887765 899999999999999999999754211100              000  00013377788889998764
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure