Citrus Sinensis ID: 039546


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310---
MATKSKSALSETPSKASPATPRASKVGKGVTKPETDSHSPLQNSRLSIDRSPRSINSKPSIERRSPKVASTPPAKVAITPSAKAATPPVKAATPPEKSQSRLVKGSELQAQLNLVQEDLKKAKEKIELIEKEKVQAIDELKEAQRVAEEANEKLQEALMAQKRAEENSEIEKFRAVEMEQAGIEASQKKEEEWQKEIEAVRNQHALDVASLLSTTQELQRIKQELAMTTDAKNQALSHADDATKIAELHVEKVEILSSELTRLKALLDSQRETESIKNRELVLKLEEEIDTLKEELEKSRTFGKKINGKRSFY
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHccc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
matksksalsetpskaspatpraskvgkgvtkpetdshsplqnsrlsidrsprsinskpsierrspkvastppakvaitpsakaatppvkaatppeksqsrlVKGSELQAQLNLVQEDLKKAKEKIELIEKEKVQAIDELKEAQRVAEEANEKLQEALMAQKRAEENSEIEKFRAVEMEQAGIEASQKKEEEWQKEIEAVRNQHALDVASLLSTTQELQRIKQELAMTTDAKnqalshaddATKIAELHVEKVEILSSELTRLKALLDSQRETESIKNRELVLKLEEEIDTLKEELEKSRTfgkkingkrsfy
matksksalsetpskaspatpraskvgkgvtkpetdshsplqnsrlsidrsprsinskpsierrspkvastppakvaitpsakaatppvkaatppeksqsrlvKGSELQAQLNLVQEDLKKAKEKIELIEKEKVQAIDELKEAQRVAEEANEKLQEALMAQKRAEENSEIEKFRAVEMEQAGIEASQKKEEEWQKEIEAVRNQHALDVASLLSTTQELQRIKQELAMTTDAKNQALSHADDATKIAELHVEKVEILSSELTRLKAlldsqretesiknrelvlkLEEEIDTLKeeleksrtfgkkingkrsfy
MATKSKSALSETPSKASPATPRASKVGKGVTKPETDSHSPLQNSRLSIDRSPRSINSKPSIERRSPKVASTPPAKVAItpsakaatppvkaatppekSQSRLVKGSELQAQLNLVQEDlkkakekieliekekVQAIDELKEAQRVAEEANEKLQEALMAQKRAEENSEIEKFRAVEMEQAGIeasqkkeeewqkeieaVRNQHALDVASLLSTTQELQRIKQELAMTTDAKNQALSHADDATKIAELHVEKVEILSSELTRLKALLDSQRETESIKNRELVlkleeeidtlkeelekSRTFGKKINGKRSFY
****************************************************************************************************************************************************************************************************************************************************IAELHVEKVEILSSELTRLK*************************************************
*************************************************************************************************************************************************************************************************************************************************************************************************************************
**************************************************************************KVAI*************************KGSELQAQLNLVQEDLKKAKEKIELIEKEKVQAIDELKEAQRVAEEANEKLQEALMAQKRAEENSEIEKFRAVEME****************EIEAVRNQHALDVASLLSTTQELQRIKQELAMTTDAKNQALSHADDATKIAELHVEKVEILSSELTRLKALLDSQRETESIKNRELVLKLEEEIDTLKEELEKSRTFGKKINGKRSFY
******************************************************************************************************V*GSELQAQLNLVQEDLKKAKEKIELIEKEKVQAIDELKEAQRVAEEANEKLQEALMAQKRAEENSEIEKFRAVEMEQAGIEASQKKEEEWQKEIEAVRNQHALDVASLLSTTQELQRIKQELAMTTDAKNQALSHADDATKIAELHVEKVEILSSELTRLKALLDSQRETESIKNRELVLKLEEEIDTLKEELEKSRTFGKKINGK**FY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATKSKSALSETPSKASPATPRASKVGKGVTKPETDSHSPLQNSRLSIDRSPRSINSKPSIERRSPKVASTPPAKVAITPSAKAATPPVKAATPPEKSQSRLVKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKFRAVEMEQAGxxxxxxxxxxxxxxxxxxxxxHALDVASLLSTTQELQRIKQELAMTTDAKNQALSHADDATKIAELHVEKxxxxxxxxxxxxxxxxxxxxxExxxxxxxxxxxxxxxxxxxxxxxxxxxxGKKINGKRSFY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query313 2.2.26 [Sep-21-2011]
F4JJP1 1221 WEB family protein At4g27 yes no 0.907 0.232 0.555 1e-77
F4I8B9 1345 Putative WEB family prote no no 0.872 0.202 0.546 5e-77
Q9M8T5 806 WEB family protein At3g02 no no 0.888 0.344 0.522 3e-59
Q9LFE4 853 WEB family protein At5g16 no no 0.814 0.298 0.527 1e-58
Q9ZQC5 583 Interactor of constitutiv no no 0.546 0.293 0.316 1e-11
Q9SZB6 779 Protein WEAK CHLOROPLAST no no 0.795 0.319 0.303 3e-07
Q8VYU8 396 Interactor of constitutiv no no 0.313 0.247 0.344 3e-06
>sp|F4JJP1|Y4759_ARATH WEB family protein At4g27595, chloroplastic OS=Arabidopsis thaliana GN=At4g27595 PE=2 SV=1 Back     alignment and function desciption
 Score =  290 bits (741), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 166/299 (55%), Positives = 226/299 (75%), Gaps = 15/299 (5%)

Query: 1   MATKSKSALSETP-SKASPATPRASKVGKGVTKPETDSHSPLQNSRLSIDRSPRSINSKP 59
           MA+++K+ L ETP SK SP TPR SK    VTK + +S SP+Q++RLSIDRSP+++NSKP
Sbjct: 1   MASRTKTGLMETPRSKPSPPTPRVSK--PTVTKSDGNSPSPVQSTRLSIDRSPQTVNSKP 58

Query: 60  SIERRSPKVASTPPAKVAITPSAKAATPPVKAATPPEKSQSRLVKGSELQAQLNLVQEDL 119
             +RR+ +V + P A   +          +      +KSQSRL KG+ L  Q    QEDL
Sbjct: 59  VSDRRTARVPTPPEANYFL----------IIICMAFQKSQSRLGKGTGLLVQQ--TQEDL 106

Query: 120 KKAKEKIELIEKEKVQAIDELKEAQRVAEEANEKLQEALMAQKRAEENSEIEKFRAVEME 179
           +KA E+IE ++K+K +A+D+LKE++++ +EANEKL+EAL AQ  AE++SEIEKFRAVE+E
Sbjct: 107 RKANEQIERLKKDKAKALDDLKESEKLTKEANEKLREALAAQHHAEKSSEIEKFRAVELE 166

Query: 180 QAGIEASQKKEEEWQKEIEAVRNQHALDVASLLSTTQELQRIKQELAMTTDAKNQALSHA 239
           QAGIEA  KKE  W+KE+E++R+QHALD+++LLSTT+EL RIKQELAMT DAKN+ALSHA
Sbjct: 167 QAGIEAVHKKEVSWKKEVESIRSQHALDISALLSTTEELHRIKQELAMTADAKNKALSHA 226

Query: 240 DDATKIAELHVEKVEILSSELTRLKALLDSQRETESIKNRELVLKLEEEIDTLKEELEK 298
           ++ATKIAE   EK EILSSEL+RLKAL+ S  + +S ++ E+V KL+ EI+ L+ +LEK
Sbjct: 227 EEATKIAENQAEKAEILSSELSRLKALVGSDEQKKSNEDDEVVSKLKSEIEMLRGKLEK 285





Arabidopsis thaliana (taxid: 3702)
>sp|F4I8B9|Y1501_ARATH Putative WEB family protein At1g65010, chloroplastic OS=Arabidopsis thaliana GN=At1g65010 PE=1 SV=1 Back     alignment and function description
>sp|Q9M8T5|Y3293_ARATH WEB family protein At3g02930, chloroplastic OS=Arabidopsis thaliana GN=At3g02930 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFE4|Y5673_ARATH WEB family protein At5g16730, chloroplastic OS=Arabidopsis thaliana GN=At5g16730 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZQC5|ICR2_ARATH Interactor of constitutive active ROPs 2, chloroplastic OS=Arabidopsis thaliana GN=ICR2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SZB6|WEL1_ARATH Protein WEAK CHLOROPLAST MOVEMENT UNDER BLUE LIGHT-like 1 OS=Arabidopsis thaliana GN=WEL1 PE=2 SV=1 Back     alignment and function description
>sp|Q8VYU8|ICR5_ARATH Interactor of constitutive active ROPs 5 OS=Arabidopsis thaliana GN=ICR5 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query313
224124120 713 predicted protein [Populus trichocarpa] 0.932 0.409 0.698 1e-113
255558081 841 ATP binding protein, putative [Ricinus c 0.904 0.336 0.689 1e-111
359489869 846 PREDICTED: uncharacterized protein LOC10 0.884 0.327 0.710 1e-110
297737283 825 unnamed protein product [Vitis vinifera] 0.884 0.335 0.710 1e-110
356497411 859 PREDICTED: uncharacterized protein LOC10 0.923 0.336 0.635 1e-101
449460688 879 PREDICTED: WEB family protein At5g16730, 0.913 0.325 0.660 2e-97
356543309 850 PREDICTED: uncharacterized protein LOC10 0.923 0.34 0.641 2e-96
357481061 887 Interactor of constitutive active ROPs [ 0.920 0.324 0.589 1e-94
356538654 851 PREDICTED: uncharacterized protein LOC10 0.923 0.339 0.644 3e-94
356538469 861 PREDICTED: uncharacterized protein LOC10 0.923 0.335 0.635 5e-93
>gi|224124120|ref|XP_002319250.1| predicted protein [Populus trichocarpa] gi|222857626|gb|EEE95173.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 211/302 (69%), Positives = 253/302 (83%), Gaps = 10/302 (3%)

Query: 11  ETPSKASPATPRASKVGKGVTKPETDSHSPLQNSRLSIDRSPRSINSKPSIERRSPKVAS 70
           ETPSK SPATPR SK+ +GV K E+DS SPLQ+SRLS+DRSPRSINSKP+I+RR+PKV S
Sbjct: 1   ETPSKPSPATPRVSKLSRGVAKSESDSPSPLQSSRLSVDRSPRSINSKPTIDRRAPKVTS 60

Query: 71  TPPAKVAITPSAKAATPPVKAATPPEKSQSRLVKGSELQAQLNLVQEDLKKAKEKIELIE 130
             P +V++         P          ++R+VKGSELQAQLN VQEDLKKA+E+IE IE
Sbjct: 61  ATPPEVSVNKCNNFFLKP----------KTRVVKGSELQAQLNAVQEDLKKAREQIEFIE 110

Query: 131 KEKVQAIDELKEAQRVAEEANEKLQEALMAQKRAEENSEIEKFRAVEMEQAGIEASQKKE 190
           KE+ QAIDELK+AQ+ AE+ANEKLQEAL+AQKRAEENSEIEKFRAVE+EQAGIE +QKKE
Sbjct: 111 KERAQAIDELKQAQKAAEDANEKLQEALVAQKRAEENSEIEKFRAVELEQAGIEDAQKKE 170

Query: 191 EEWQKEIEAVRNQHALDVASLLSTTQELQRIKQELAMTTDAKNQALSHADDATKIAELHV 250
           EEWQKE+EAVR+QHALDV +LLSTTQELQR+KQELAM TDAKNQALSHADDATKIAE+H 
Sbjct: 171 EEWQKELEAVRSQHALDVTALLSTTQELQRLKQELAMITDAKNQALSHADDATKIAEIHA 230

Query: 251 EKVEILSSELTRLKALLDSQRETESIKNRELVLKLEEEIDTLKEELEKSRTFGKKINGKR 310
           EKVE+LSSELTRL  LLDS+ ETE+I++ ++VL+L EEID+LK++LEKS  F  K+  + 
Sbjct: 231 EKVEMLSSELTRLNVLLDSKLETEAIESNKIVLQLNEEIDSLKQQLEKSEDFEDKLIERE 290

Query: 311 SF 312
           +F
Sbjct: 291 AF 292




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255558081|ref|XP_002520069.1| ATP binding protein, putative [Ricinus communis] gi|223540833|gb|EEF42393.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359489869|ref|XP_002270776.2| PREDICTED: uncharacterized protein LOC100249386 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737283|emb|CBI26484.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356497411|ref|XP_003517554.1| PREDICTED: uncharacterized protein LOC100795783 [Glycine max] Back     alignment and taxonomy information
>gi|449460688|ref|XP_004148077.1| PREDICTED: WEB family protein At5g16730, chloroplastic-like [Cucumis sativus] gi|449531197|ref|XP_004172574.1| PREDICTED: WEB family protein At5g16730, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356543309|ref|XP_003540104.1| PREDICTED: uncharacterized protein LOC100777446 [Glycine max] Back     alignment and taxonomy information
>gi|357481061|ref|XP_003610816.1| Interactor of constitutive active ROPs [Medicago truncatula] gi|355512151|gb|AES93774.1| Interactor of constitutive active ROPs [Medicago truncatula] Back     alignment and taxonomy information
>gi|356538654|ref|XP_003537816.1| PREDICTED: uncharacterized protein LOC100808226 [Glycine max] Back     alignment and taxonomy information
>gi|356538469|ref|XP_003537726.1| PREDICTED: uncharacterized protein LOC100803802 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query313
TAIR|locus:504955294 1221 AT4G27595 "AT4G27595" [Arabido 0.856 0.219 0.494 3.9e-57
TAIR|locus:2010826 1345 AT1G65010 [Arabidopsis thalian 0.584 0.136 0.579 8.7e-49
TAIR|locus:2075402 806 AT3G02930 "AT3G02930" [Arabido 0.578 0.224 0.494 7.8e-35
TAIR|locus:2119206 779 AT4G33390 "AT4G33390" [Arabido 0.501 0.201 0.283 2.3e-08
UNIPROTKB|Q8VXD2 601 p70 "P70 protein" [Nicotiana t 0.559 0.291 0.255 3.4e-07
TAIR|locus:2066301 807 WEB1 "WEAK CHLOROPLAST MOVEMEN 0.504 0.195 0.257 1.1e-06
TAIR|locus:2825751 752 AT1G45545 "AT1G45545" [Arabido 0.712 0.296 0.236 8.9e-06
TAIR|locus:2061758 583 RIP2 "ROP interactive partner 0.402 0.216 0.248 2.7e-05
TAIR|locus:2176625 649 AT5G55860 "AT5G55860" [Arabido 0.504 0.243 0.220 7.9e-05
TAIR|locus:504955294 AT4G27595 "AT4G27595" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 598 (215.6 bits), Expect = 3.9e-57, P = 3.9e-57
 Identities = 140/283 (49%), Positives = 186/283 (65%)

Query:     1 MATKSKSALSETP-SKASPATPRASKVGKGVTKPETDSHSPLQNSRLSIDRSPRSINSKP 59
             MA+++K+ L ETP SK SP TPR SK    VTK + +S SP+Q++RLSIDRSP+++NSKP
Sbjct:     1 MASRTKTGLMETPRSKPSPPTPRVSK--PTVTKSDGNSPSPVQSTRLSIDRSPQTVNSKP 58

Query:    60 SIERRSPKVASTPPAKVAIXXXXXXXXXXXXXXXXXXXSQSRLVKGSELQAQLNLVQEDX 119
               +RR+ +V + P A   +                   SQSRL KG+ L  Q    QED 
Sbjct:    59 VSDRRTARVPTPPEANYFLIIICMAFQK----------SQSRLGKGTGLLVQQT--QEDL 106

Query:   120 XXXXXXXXXXXXXXVQAIDELKEAQRVAEEANEKLQEALMAQKRAEENSEIEKFRAVEME 179
                            +A+D+LKE++++ +EANEKL+EAL AQ  AE++SEIEKFRAVE+E
Sbjct:   107 RKANEQIERLKKDKAKALDDLKESEKLTKEANEKLREALAAQHHAEKSSEIEKFRAVELE 166

Query:   180 QAGIXXXXXXXXXXXXXXXXVRNQHALDVASLLSTTQELQRIKQELAMTTDAKNQALSHA 239
             QAGI                +R+QHALD+++LLSTT+EL RIKQELAMT DAKN+ALSHA
Sbjct:   167 QAGIEAVHKKEVSWKKEVESIRSQHALDISALLSTTEELHRIKQELAMTADAKNKALSHA 226

Query:   240 DDATKIAELHVEKVEILSSELTRLKALLDSQRETESIKNRELV 282
             ++ATKIAE   EK EILSSEL+RLKAL+ S  + +S ++ E+V
Sbjct:   227 EEATKIAENQAEKAEILSSELSRLKALVGSDEQKKSNEDDEVV 269




GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2010826 AT1G65010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075402 AT3G02930 "AT3G02930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119206 AT4G33390 "AT4G33390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8VXD2 p70 "P70 protein" [Nicotiana tabacum (taxid:4097)] Back     alignment and assigned GO terms
TAIR|locus:2066301 WEB1 "WEAK CHLOROPLAST MOVEMENT UNDER BLUE LIGHT 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825751 AT1G45545 "AT1G45545" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061758 RIP2 "ROP interactive partner 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2176625 AT5G55860 "AT5G55860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.XIII.2607.1
hypothetical protein (713 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query313
pfam12128 1198 pfam12128, DUF3584, Protein of unknown function (D 3e-09
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-06
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 6e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 9e-06
pfam05701 484 pfam05701, DUF827, Plant protein of unknown functi 1e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 7e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 2e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 7e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 7e-04
PRK11281 1113 PRK11281, PRK11281, hypothetical protein; Provisio 9e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 0.001
PRK02224 880 PRK02224, PRK02224, chromosome segregation protein 0.001
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.003
pfam05109830 pfam05109, Herpes_BLLF1, Herpes virus major outer 0.003
>gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) Back     alignment and domain information
 Score = 57.8 bits (140), Expect = 3e-09
 Identities = 51/211 (24%), Positives = 96/211 (45%), Gaps = 14/211 (6%)

Query: 107 ELQAQLNLVQEDLKKAKEKIELIEKEKVQAIDELKEAQRVAEEANEKLQEALMAQKRAEE 166
           EL+ +L   +E L+ A  K +  E++ VQA  EL+E +R   EA   L++A +  +R + 
Sbjct: 604 ELRERLQQAEEALQSAVAKQKQAEEQLVQANAELEEQKRAEAEARTALKQARLDLQRLQN 663

Query: 167 NSEIEKFRAVEMEQAGIEASQKKEEEWQKEIEAVRNQHALDVASLLSTTQELQRIKQELA 226
             +  K    ++E A  E  Q+ E + ++ ++A   Q      + L   + L+   +EL 
Sbjct: 664 EQQSLK---DKLELAIAERKQQAETQLRQ-LDAQLKQLLEQQQAFL---EALKDDFRELR 716

Query: 227 MTTDAKNQALSHADDATKIAELHVEKVEILSSELTRLKALLDSQRETESIKNR----ELV 282
               AK Q +    D  ++A+L        +    RLK  L  Q + E + +       V
Sbjct: 717 TERLAKWQVVEGELDN-QLAQLSAAIEAARTQAKARLKE-LKKQYDRE-LASLDVDPNTV 773

Query: 283 LKLEEEIDTLKEELEKSRTFGKKINGKRSFY 313
            +L+ +I+ L+  +E+      ++   R+F 
Sbjct: 774 KELKRQIEELETTIERIAVRRPEVREYRAFM 804


This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication. Length = 1198

>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|218704 pfam05701, DUF827, Plant protein of unknown function (DUF827) Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 313
PF05701 522 WEMBL: Weak chloroplast movement under blue light; 100.0
PF05701 522 WEMBL: Weak chloroplast movement under blue light; 98.25
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 97.59
PRK11637 428 AmiB activator; Provisional 97.47
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 97.44
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 97.41
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 97.31
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 97.31
PF00038312 Filament: Intermediate filament protein; InterPro: 97.25
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 97.22
PF00038312 Filament: Intermediate filament protein; InterPro: 97.1
KOG0971 1243 consensus Microtubule-associated protein dynactin 97.1
PRK04778 569 septation ring formation regulator EzrA; Provision 97.03
KOG0996 1293 consensus Structural maintenance of chromosome pro 96.98
COG4372 499 Uncharacterized protein conserved in bacteria with 96.9
PRK02224 880 chromosome segregation protein; Provisional 96.86
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 96.86
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 96.79
PRK11637 428 AmiB activator; Provisional 96.66
PRK02224 880 chromosome segregation protein; Provisional 96.63
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 96.6
KOG0996 1293 consensus Structural maintenance of chromosome pro 96.33
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 96.27
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 96.23
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 95.95
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 95.79
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 95.76
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 95.65
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 95.62
KOG0971 1243 consensus Microtubule-associated protein dynactin 95.55
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 95.43
KOG1003205 consensus Actin filament-coating protein tropomyos 95.25
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 95.25
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 95.22
PF06160 560 EzrA: Septation ring formation regulator, EzrA ; I 95.15
KOG4807593 consensus F-actin binding protein, regulates actin 94.96
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 94.9
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 94.75
COG4942 420 Membrane-bound metallopeptidase [Cell division and 94.36
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 94.26
KOG4673 961 consensus Transcription factor TMF, TATA element m 94.14
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 94.04
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 93.8
PRK04863 1486 mukB cell division protein MukB; Provisional 93.69
TIGR00998334 8a0101 efflux pump membrane protein (multidrug res 93.48
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 93.47
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 93.16
PRK10476346 multidrug resistance protein MdtN; Provisional 93.15
PF11570136 E2R135: Coiled-coil receptor-binding R-domain of c 92.69
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 92.67
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 91.99
PRK15136 390 multidrug efflux system protein EmrA; Provisional 91.95
KOG1003205 consensus Actin filament-coating protein tropomyos 91.78
PRK10929 1109 putative mechanosensitive channel protein; Provisi 91.66
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 91.54
KOG4673 961 consensus Transcription factor TMF, TATA element m 91.51
PRK09039 343 hypothetical protein; Validated 91.5
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 90.96
PRK04863 1486 mukB cell division protein MukB; Provisional 90.7
TIGR03007 498 pepcterm_ChnLen polysaccharide chain length determ 90.59
KOG0933 1174 consensus Structural maintenance of chromosome pro 90.48
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 90.31
PF0858179 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t 89.98
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 89.85
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 89.74
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 89.65
PHA02562 562 46 endonuclease subunit; Provisional 89.42
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 89.32
PF14662193 CCDC155: Coiled-coil region of CCDC155 89.06
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 88.33
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 88.25
PRK09039 343 hypothetical protein; Validated 88.03
PRK10929 1109 putative mechanosensitive channel protein; Provisi 87.68
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 87.62
KOG0933 1174 consensus Structural maintenance of chromosome pro 87.34
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 87.29
PRK10246 1047 exonuclease subunit SbcC; Provisional 87.22
PRK03918 880 chromosome segregation protein; Provisional 86.91
PRK04778569 septation ring formation regulator EzrA; Provision 86.66
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 86.44
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 86.26
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 86.23
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 85.9
COG4942 420 Membrane-bound metallopeptidase [Cell division and 85.59
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 85.29
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 85.2
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 85.04
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 84.92
PRK11281 1113 hypothetical protein; Provisional 84.69
KOG0963 629 consensus Transcription factor/CCAAT displacement 84.68
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 84.32
KOG1103 561 consensus Predicted coiled-coil protein [Function 84.21
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 84.07
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 84.02
PF12001111 DUF3496: Domain of unknown function (DUF3496); Int 83.65
COG1566352 EmrA Multidrug resistance efflux pump [Defense mec 82.92
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 82.89
PRK03598331 putative efflux pump membrane fusion protein; Prov 82.88
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 82.8
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 82.76
TIGR02971327 heterocyst_DevB ABC exporter membrane fusion prote 82.72
PF05911 769 DUF869: Plant protein of unknown function (DUF869) 82.69
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 81.22
KOG0964 1200 consensus Structural maintenance of chromosome pro 81.0
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 80.54
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 80.26
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
Probab=100.00  E-value=1.1e-34  Score=292.10  Aligned_cols=204  Identities=42%  Similarity=0.530  Sum_probs=185.9

Q ss_pred             cchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHhh
Q 039546          103 VKGSELQAQLNLVQEDLKKAKEKIELIEKEKVQAIDELKEAQRVAEEANEKLQEALMAQKRAEENSEIEKFRAVEMEQAG  182 (313)
Q Consensus       103 ~~~~elE~QL~~~QeEL~k~KeQl~~AE~~KaqAl~ELE~AKr~ieeL~~KLE~a~~~q~qA~e~sEl~k~Ra~ElEq~~  182 (313)
                      .+..++++||+++|+||++||+||.++|.+|.+||+||+.|||+|++|++||+.++.++.+|++++|+++||+++|++|.
T Consensus        27 e~~~~~e~eL~~~qeel~~~k~~l~~~E~~k~~~l~ELe~akr~veel~~kLe~~~~~~~~a~~~~e~~k~r~~e~e~~~  106 (522)
T PF05701_consen   27 ERVKEKETELEKAQEELAKLKEQLEAAEREKAQALSELESAKRTVEELKLKLEKAQAEEKQAEEDSELAKFRAKELEQGI  106 (522)
T ss_pred             hhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHhHHHHHHHhhhh
Confidence            46688999999999999999999999999999999999999999999999999999999999999999999999999985


Q ss_pred             hhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHH
Q 039546          183 IEASQKKEEEWQKEIEAVRNQHALDVASLLSTTQELQRIKQELAMTTDAKNQALSHADDATKIAELHVEKVEILSSELTR  262 (313)
Q Consensus       183 ~~~a~~~~~a~k~ELE~ar~qha~~~AeL~Sak~EL~klrqEl~~~~~ak~aA~~~AeeA~~aae~~~eKveeLt~EL~~  262 (313)
                      ++   ..++.|+.+|++++.||+.++++|++|++||+++|++|++++++|+.|++||++|+++++.|.++|++|+.||++
T Consensus       107 ~~---~~~~~~k~ele~~~~q~~~~~~eL~~~k~EL~~lr~e~~~~~~~k~~A~~~aeea~~~a~~~~~kve~L~~Ei~~  183 (522)
T PF05701_consen  107 AE---EASVAWKAELESAREQYASAVAELDSVKQELEKLRQELASALDAKNAALKQAEEAVSAAEENEEKVEELSKEIIA  183 (522)
T ss_pred             cc---cchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            44   456779999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhhhHhhhhhhh-----------------HHHHHHHHHHHHHHHHHHHhhhhHhHhhhhh
Q 039546          263 LKALLDSQRETESIKN-----------------RELVLKLEEEIDTLKEELEKSRTFGKKINGK  309 (313)
Q Consensus       263 lKe~Les~~~~e~~~~-----------------~e~~~~le~e~~~L~~el~ka~~~e~k~~~~  309 (313)
                      ||++|++.+.......                 -..+.+.+.++..|+.++..+++++.+|...
T Consensus       184 lke~l~~~~~a~~eAeee~~~~~~~~~~~~~~~~~~leeae~~l~~L~~e~~~~k~Le~kL~~a  247 (522)
T PF05701_consen  184 LKESLESAKLAHIEAEEERIEIAAEREQDAEEWEKELEEAEEELEELKEELEAAKDLESKLAEA  247 (522)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999865322100                 0246777888999999999999999888753



Several sequences in this family are described as being myosin heavy chain-like.

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>PF11570 E2R135: Coiled-coil receptor-binding R-domain of colicin E2; InterPro: IPR024566 Bacteriocins are protein antibiotics that kill bacteria closely related to the producing species Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PRK15136 multidrug efflux system protein EmrA; Provisional Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>KOG1103 consensus Predicted coiled-coil protein [Function unknown] Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF12001 DUF3496: Domain of unknown function (DUF3496); InterPro: IPR021885 This presumed domain is functionally uncharacterised Back     alignment and domain information
>COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PRK03598 putative efflux pump membrane fusion protein; Provisional Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query313
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 7e-11
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-10
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 6e-09
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 4e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 8e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 8e-06
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 3e-05
3qne_A 485 Seryl-tRNA synthetase, cytoplasmic; amino acid bio 9e-04
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
 Score = 62.2 bits (151), Expect = 7e-11
 Identities = 34/197 (17%), Positives = 75/197 (38%), Gaps = 4/197 (2%)

Query: 107  ELQAQLNLVQEDLKKAKEKIELIEKEKVQAIDELKEAQRVAEEANEKLQEALMAQKRAEE 166
                ++  +++D+   +++   + KE+    + + +      E  EK +  L   K   E
Sbjct: 980  TADGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEEEEKAKN-LTKLKNKHE 1038

Query: 167  NSEIEKFRAVEMEQAGIEASQKKEEEWQKEIEAVRNQHALDVASLLSTTQELQRIKQELA 226
            +   E    ++ E+   +  +K + + + E   +  Q A   A +     +L + ++EL 
Sbjct: 1039 SMISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQAQIAELKAQLAKKEEELQ 1098

Query: 227  MTTDAKNQALSHADDATKIAELHVEKVEILSSELTRLKALLD---SQRETESIKNRELVL 283
                      S  ++A K        +  L  +L   KA  +    Q+   S +   L  
Sbjct: 1099 AALARLEDETSQKNNALKKIRELESHISDLQEDLESEKAARNKAEKQKRDLSEELEALKT 1158

Query: 284  KLEEEIDTLKEELEKSR 300
            +LE+ +DT   + E   
Sbjct: 1159 ELEDTLDTTATQQELRG 1175


>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A Length = 485 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query313
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 96.03
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 95.54
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 95.52
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 95.14
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 95.05
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 94.39
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 91.56
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 91.49
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 91.22
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 90.06
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 87.39
2b5u_A551 Colicin E3; high resolution colicin E3, ribosome i 87.23
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 87.14
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 86.12
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 86.08
2w83_C77 C-JUN-amino-terminal kinase-interacting protein 4; 85.56
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 83.53
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 83.49
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 82.26
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 80.15
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
Probab=96.03  E-value=0.028  Score=61.03  Aligned_cols=18  Identities=28%  Similarity=0.442  Sum_probs=6.8

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q 039546          113 NLVQEDLKKAKEKIELIE  130 (313)
Q Consensus       113 ~~~QeEL~k~KeQl~~AE  130 (313)
                      ..++++|.+++..+...+
T Consensus       860 ~~L~~eL~el~~~L~~le  877 (1184)
T 1i84_S          860 QAKDEELQRTKERQQKAE  877 (1184)
T ss_dssp             CHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            333333333333333333



>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00