Citrus Sinensis ID: 039546
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 313 | ||||||
| 224124120 | 713 | predicted protein [Populus trichocarpa] | 0.932 | 0.409 | 0.698 | 1e-113 | |
| 255558081 | 841 | ATP binding protein, putative [Ricinus c | 0.904 | 0.336 | 0.689 | 1e-111 | |
| 359489869 | 846 | PREDICTED: uncharacterized protein LOC10 | 0.884 | 0.327 | 0.710 | 1e-110 | |
| 297737283 | 825 | unnamed protein product [Vitis vinifera] | 0.884 | 0.335 | 0.710 | 1e-110 | |
| 356497411 | 859 | PREDICTED: uncharacterized protein LOC10 | 0.923 | 0.336 | 0.635 | 1e-101 | |
| 449460688 | 879 | PREDICTED: WEB family protein At5g16730, | 0.913 | 0.325 | 0.660 | 2e-97 | |
| 356543309 | 850 | PREDICTED: uncharacterized protein LOC10 | 0.923 | 0.34 | 0.641 | 2e-96 | |
| 357481061 | 887 | Interactor of constitutive active ROPs [ | 0.920 | 0.324 | 0.589 | 1e-94 | |
| 356538654 | 851 | PREDICTED: uncharacterized protein LOC10 | 0.923 | 0.339 | 0.644 | 3e-94 | |
| 356538469 | 861 | PREDICTED: uncharacterized protein LOC10 | 0.923 | 0.335 | 0.635 | 5e-93 |
| >gi|224124120|ref|XP_002319250.1| predicted protein [Populus trichocarpa] gi|222857626|gb|EEE95173.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 412 bits (1060), Expect = e-113, Method: Compositional matrix adjust.
Identities = 211/302 (69%), Positives = 253/302 (83%), Gaps = 10/302 (3%)
Query: 11 ETPSKASPATPRASKVGKGVTKPETDSHSPLQNSRLSIDRSPRSINSKPSIERRSPKVAS 70
ETPSK SPATPR SK+ +GV K E+DS SPLQ+SRLS+DRSPRSINSKP+I+RR+PKV S
Sbjct: 1 ETPSKPSPATPRVSKLSRGVAKSESDSPSPLQSSRLSVDRSPRSINSKPTIDRRAPKVTS 60
Query: 71 TPPAKVAITPSAKAATPPVKAATPPEKSQSRLVKGSELQAQLNLVQEDLKKAKEKIELIE 130
P +V++ P ++R+VKGSELQAQLN VQEDLKKA+E+IE IE
Sbjct: 61 ATPPEVSVNKCNNFFLKP----------KTRVVKGSELQAQLNAVQEDLKKAREQIEFIE 110
Query: 131 KEKVQAIDELKEAQRVAEEANEKLQEALMAQKRAEENSEIEKFRAVEMEQAGIEASQKKE 190
KE+ QAIDELK+AQ+ AE+ANEKLQEAL+AQKRAEENSEIEKFRAVE+EQAGIE +QKKE
Sbjct: 111 KERAQAIDELKQAQKAAEDANEKLQEALVAQKRAEENSEIEKFRAVELEQAGIEDAQKKE 170
Query: 191 EEWQKEIEAVRNQHALDVASLLSTTQELQRIKQELAMTTDAKNQALSHADDATKIAELHV 250
EEWQKE+EAVR+QHALDV +LLSTTQELQR+KQELAM TDAKNQALSHADDATKIAE+H
Sbjct: 171 EEWQKELEAVRSQHALDVTALLSTTQELQRLKQELAMITDAKNQALSHADDATKIAEIHA 230
Query: 251 EKVEILSSELTRLKALLDSQRETESIKNRELVLKLEEEIDTLKEELEKSRTFGKKINGKR 310
EKVE+LSSELTRL LLDS+ ETE+I++ ++VL+L EEID+LK++LEKS F K+ +
Sbjct: 231 EKVEMLSSELTRLNVLLDSKLETEAIESNKIVLQLNEEIDSLKQQLEKSEDFEDKLIERE 290
Query: 311 SF 312
+F
Sbjct: 291 AF 292
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255558081|ref|XP_002520069.1| ATP binding protein, putative [Ricinus communis] gi|223540833|gb|EEF42393.1| ATP binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359489869|ref|XP_002270776.2| PREDICTED: uncharacterized protein LOC100249386 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297737283|emb|CBI26484.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356497411|ref|XP_003517554.1| PREDICTED: uncharacterized protein LOC100795783 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449460688|ref|XP_004148077.1| PREDICTED: WEB family protein At5g16730, chloroplastic-like [Cucumis sativus] gi|449531197|ref|XP_004172574.1| PREDICTED: WEB family protein At5g16730, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356543309|ref|XP_003540104.1| PREDICTED: uncharacterized protein LOC100777446 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357481061|ref|XP_003610816.1| Interactor of constitutive active ROPs [Medicago truncatula] gi|355512151|gb|AES93774.1| Interactor of constitutive active ROPs [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356538654|ref|XP_003537816.1| PREDICTED: uncharacterized protein LOC100808226 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356538469|ref|XP_003537726.1| PREDICTED: uncharacterized protein LOC100803802 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 313 | ||||||
| TAIR|locus:504955294 | 1221 | AT4G27595 "AT4G27595" [Arabido | 0.856 | 0.219 | 0.494 | 3.9e-57 | |
| TAIR|locus:2010826 | 1345 | AT1G65010 [Arabidopsis thalian | 0.584 | 0.136 | 0.579 | 8.7e-49 | |
| TAIR|locus:2075402 | 806 | AT3G02930 "AT3G02930" [Arabido | 0.578 | 0.224 | 0.494 | 7.8e-35 | |
| TAIR|locus:2119206 | 779 | AT4G33390 "AT4G33390" [Arabido | 0.501 | 0.201 | 0.283 | 2.3e-08 | |
| UNIPROTKB|Q8VXD2 | 601 | p70 "P70 protein" [Nicotiana t | 0.559 | 0.291 | 0.255 | 3.4e-07 | |
| TAIR|locus:2066301 | 807 | WEB1 "WEAK CHLOROPLAST MOVEMEN | 0.504 | 0.195 | 0.257 | 1.1e-06 | |
| TAIR|locus:2825751 | 752 | AT1G45545 "AT1G45545" [Arabido | 0.712 | 0.296 | 0.236 | 8.9e-06 | |
| TAIR|locus:2061758 | 583 | RIP2 "ROP interactive partner | 0.402 | 0.216 | 0.248 | 2.7e-05 | |
| TAIR|locus:2176625 | 649 | AT5G55860 "AT5G55860" [Arabido | 0.504 | 0.243 | 0.220 | 7.9e-05 |
| TAIR|locus:504955294 AT4G27595 "AT4G27595" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 598 (215.6 bits), Expect = 3.9e-57, P = 3.9e-57
Identities = 140/283 (49%), Positives = 186/283 (65%)
Query: 1 MATKSKSALSETP-SKASPATPRASKVGKGVTKPETDSHSPLQNSRLSIDRSPRSINSKP 59
MA+++K+ L ETP SK SP TPR SK VTK + +S SP+Q++RLSIDRSP+++NSKP
Sbjct: 1 MASRTKTGLMETPRSKPSPPTPRVSK--PTVTKSDGNSPSPVQSTRLSIDRSPQTVNSKP 58
Query: 60 SIERRSPKVASTPPAKVAIXXXXXXXXXXXXXXXXXXXSQSRLVKGSELQAQLNLVQEDX 119
+RR+ +V + P A + SQSRL KG+ L Q QED
Sbjct: 59 VSDRRTARVPTPPEANYFLIIICMAFQK----------SQSRLGKGTGLLVQQT--QEDL 106
Query: 120 XXXXXXXXXXXXXXVQAIDELKEAQRVAEEANEKLQEALMAQKRAEENSEIEKFRAVEME 179
+A+D+LKE++++ +EANEKL+EAL AQ AE++SEIEKFRAVE+E
Sbjct: 107 RKANEQIERLKKDKAKALDDLKESEKLTKEANEKLREALAAQHHAEKSSEIEKFRAVELE 166
Query: 180 QAGIXXXXXXXXXXXXXXXXVRNQHALDVASLLSTTQELQRIKQELAMTTDAKNQALSHA 239
QAGI +R+QHALD+++LLSTT+EL RIKQELAMT DAKN+ALSHA
Sbjct: 167 QAGIEAVHKKEVSWKKEVESIRSQHALDISALLSTTEELHRIKQELAMTADAKNKALSHA 226
Query: 240 DDATKIAELHVEKVEILSSELTRLKALLDSQRETESIKNRELV 282
++ATKIAE EK EILSSEL+RLKAL+ S + +S ++ E+V
Sbjct: 227 EEATKIAENQAEKAEILSSELSRLKALVGSDEQKKSNEDDEVV 269
|
|
| TAIR|locus:2010826 AT1G65010 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075402 AT3G02930 "AT3G02930" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2119206 AT4G33390 "AT4G33390" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8VXD2 p70 "P70 protein" [Nicotiana tabacum (taxid:4097)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2066301 WEB1 "WEAK CHLOROPLAST MOVEMENT UNDER BLUE LIGHT 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2825751 AT1G45545 "AT1G45545" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2061758 RIP2 "ROP interactive partner 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2176625 AT5G55860 "AT5G55860" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| gw1.XIII.2607.1 | hypothetical protein (713 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 313 | |||
| pfam12128 | 1198 | pfam12128, DUF3584, Protein of unknown function (D | 3e-09 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 9e-06 | |
| pfam05701 | 484 | pfam05701, DUF827, Plant protein of unknown functi | 1e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 7e-04 | |
| PRK11281 | 1113 | PRK11281, PRK11281, hypothetical protein; Provisio | 9e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 0.001 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.003 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 0.003 |
| >gnl|CDD|221432 pfam12128, DUF3584, Protein of unknown function (DUF3584) | Back alignment and domain information |
|---|
Score = 57.8 bits (140), Expect = 3e-09
Identities = 51/211 (24%), Positives = 96/211 (45%), Gaps = 14/211 (6%)
Query: 107 ELQAQLNLVQEDLKKAKEKIELIEKEKVQAIDELKEAQRVAEEANEKLQEALMAQKRAEE 166
EL+ +L +E L+ A K + E++ VQA EL+E +R EA L++A + +R +
Sbjct: 604 ELRERLQQAEEALQSAVAKQKQAEEQLVQANAELEEQKRAEAEARTALKQARLDLQRLQN 663
Query: 167 NSEIEKFRAVEMEQAGIEASQKKEEEWQKEIEAVRNQHALDVASLLSTTQELQRIKQELA 226
+ K ++E A E Q+ E + ++ ++A Q + L + L+ +EL
Sbjct: 664 EQQSLK---DKLELAIAERKQQAETQLRQ-LDAQLKQLLEQQQAFL---EALKDDFRELR 716
Query: 227 MTTDAKNQALSHADDATKIAELHVEKVEILSSELTRLKALLDSQRETESIKNR----ELV 282
AK Q + D ++A+L + RLK L Q + E + + V
Sbjct: 717 TERLAKWQVVEGELDN-QLAQLSAAIEAARTQAKARLKE-LKKQYDRE-LASLDVDPNTV 773
Query: 283 LKLEEEIDTLKEELEKSRTFGKKINGKRSFY 313
+L+ +I+ L+ +E+ ++ R+F
Sbjct: 774 KELKRQIEELETTIERIAVRRPEVREYRAFM 804
|
This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication. Length = 1198 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|218704 pfam05701, DUF827, Plant protein of unknown function (DUF827) | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 313 | |||
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 100.0 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 98.25 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 97.59 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.47 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 97.44 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 97.41 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 97.31 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 97.31 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 97.25 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 97.22 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 97.1 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 97.1 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 97.03 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 96.98 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 96.9 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 96.86 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 96.86 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 96.79 | |
| PRK11637 | 428 | AmiB activator; Provisional | 96.66 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 96.63 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 96.6 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 96.33 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 96.27 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 96.23 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 95.95 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 95.79 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 95.76 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 95.65 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 95.62 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 95.55 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 95.43 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 95.25 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 95.25 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 95.22 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 95.15 | |
| KOG4807 | 593 | consensus F-actin binding protein, regulates actin | 94.96 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 94.9 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 94.75 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 94.36 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 94.26 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 94.14 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 94.04 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 93.8 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 93.69 | |
| TIGR00998 | 334 | 8a0101 efflux pump membrane protein (multidrug res | 93.48 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 93.47 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 93.16 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 93.15 | |
| PF11570 | 136 | E2R135: Coiled-coil receptor-binding R-domain of c | 92.69 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 92.67 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 91.99 | |
| PRK15136 | 390 | multidrug efflux system protein EmrA; Provisional | 91.95 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 91.78 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 91.66 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 91.54 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 91.51 | |
| PRK09039 | 343 | hypothetical protein; Validated | 91.5 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 90.96 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 90.7 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 90.59 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 90.48 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 90.31 | |
| PF08581 | 79 | Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t | 89.98 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 89.85 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 89.74 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 89.65 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 89.42 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 89.32 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 89.06 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 88.33 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 88.25 | |
| PRK09039 | 343 | hypothetical protein; Validated | 88.03 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 87.68 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 87.62 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 87.34 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 87.29 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 87.22 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 86.91 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 86.66 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 86.44 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 86.26 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 86.23 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 85.9 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 85.59 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 85.29 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 85.2 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 85.04 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 84.92 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 84.69 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 84.68 | |
| PF07798 | 177 | DUF1640: Protein of unknown function (DUF1640); In | 84.32 | |
| KOG1103 | 561 | consensus Predicted coiled-coil protein [Function | 84.21 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 84.07 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 84.02 | |
| PF12001 | 111 | DUF3496: Domain of unknown function (DUF3496); Int | 83.65 | |
| COG1566 | 352 | EmrA Multidrug resistance efflux pump [Defense mec | 82.92 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 82.89 | |
| PRK03598 | 331 | putative efflux pump membrane fusion protein; Prov | 82.88 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 82.8 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 82.76 | |
| TIGR02971 | 327 | heterocyst_DevB ABC exporter membrane fusion prote | 82.72 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 82.69 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 81.22 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 81.0 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 80.54 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 80.26 |
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-34 Score=292.10 Aligned_cols=204 Identities=42% Similarity=0.530 Sum_probs=185.9
Q ss_pred cchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHhh
Q 039546 103 VKGSELQAQLNLVQEDLKKAKEKIELIEKEKVQAIDELKEAQRVAEEANEKLQEALMAQKRAEENSEIEKFRAVEMEQAG 182 (313)
Q Consensus 103 ~~~~elE~QL~~~QeEL~k~KeQl~~AE~~KaqAl~ELE~AKr~ieeL~~KLE~a~~~q~qA~e~sEl~k~Ra~ElEq~~ 182 (313)
.+..++++||+++|+||++||+||.++|.+|.+||+||+.|||+|++|++||+.++.++.+|++++|+++||+++|++|.
T Consensus 27 e~~~~~e~eL~~~qeel~~~k~~l~~~E~~k~~~l~ELe~akr~veel~~kLe~~~~~~~~a~~~~e~~k~r~~e~e~~~ 106 (522)
T PF05701_consen 27 ERVKEKETELEKAQEELAKLKEQLEAAEREKAQALSELESAKRTVEELKLKLEKAQAEEKQAEEDSELAKFRAKELEQGI 106 (522)
T ss_pred hhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHhHHHHHHHhhhh
Confidence 46688999999999999999999999999999999999999999999999999999999999999999999999999985
Q ss_pred hhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHH
Q 039546 183 IEASQKKEEEWQKEIEAVRNQHALDVASLLSTTQELQRIKQELAMTTDAKNQALSHADDATKIAELHVEKVEILSSELTR 262 (313)
Q Consensus 183 ~~~a~~~~~a~k~ELE~ar~qha~~~AeL~Sak~EL~klrqEl~~~~~ak~aA~~~AeeA~~aae~~~eKveeLt~EL~~ 262 (313)
++ ..++.|+.+|++++.||+.++++|++|++||+++|++|++++++|+.|++||++|+++++.|.++|++|+.||++
T Consensus 107 ~~---~~~~~~k~ele~~~~q~~~~~~eL~~~k~EL~~lr~e~~~~~~~k~~A~~~aeea~~~a~~~~~kve~L~~Ei~~ 183 (522)
T PF05701_consen 107 AE---EASVAWKAELESAREQYASAVAELDSVKQELEKLRQELASALDAKNAALKQAEEAVSAAEENEEKVEELSKEIIA 183 (522)
T ss_pred cc---cchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 44 456779999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHhhhhHhhhhhhh-----------------HHHHHHHHHHHHHHHHHHHhhhhHhHhhhhh
Q 039546 263 LKALLDSQRETESIKN-----------------RELVLKLEEEIDTLKEELEKSRTFGKKINGK 309 (313)
Q Consensus 263 lKe~Les~~~~e~~~~-----------------~e~~~~le~e~~~L~~el~ka~~~e~k~~~~ 309 (313)
||++|++.+....... -..+.+.+.++..|+.++..+++++.+|...
T Consensus 184 lke~l~~~~~a~~eAeee~~~~~~~~~~~~~~~~~~leeae~~l~~L~~e~~~~k~Le~kL~~a 247 (522)
T PF05701_consen 184 LKESLESAKLAHIEAEEERIEIAAEREQDAEEWEKELEEAEEELEELKEELEAAKDLESKLAEA 247 (522)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 9999999865322100 0246777888999999999999999888753
|
Several sequences in this family are described as being myosin heavy chain-like. |
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >PF11570 E2R135: Coiled-coil receptor-binding R-domain of colicin E2; InterPro: IPR024566 Bacteriocins are protein antibiotics that kill bacteria closely related to the producing species | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK15136 multidrug efflux system protein EmrA; Provisional | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins | Back alignment and domain information |
|---|
| >KOG1103 consensus Predicted coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12001 DUF3496: Domain of unknown function (DUF3496); InterPro: IPR021885 This presumed domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PRK03598 putative efflux pump membrane fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 313 | |||
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-11 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 8e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 4e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-04 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 8e-06 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 3e-05 | |
| 3qne_A | 485 | Seryl-tRNA synthetase, cytoplasmic; amino acid bio | 9e-04 |
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
Score = 62.2 bits (151), Expect = 7e-11
Identities = 34/197 (17%), Positives = 75/197 (38%), Gaps = 4/197 (2%)
Query: 107 ELQAQLNLVQEDLKKAKEKIELIEKEKVQAIDELKEAQRVAEEANEKLQEALMAQKRAEE 166
++ +++D+ +++ + KE+ + + + E EK + L K E
Sbjct: 980 TADGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEEEEKAKN-LTKLKNKHE 1038
Query: 167 NSEIEKFRAVEMEQAGIEASQKKEEEWQKEIEAVRNQHALDVASLLSTTQELQRIKQELA 226
+ E ++ E+ + +K + + + E + Q A A + +L + ++EL
Sbjct: 1039 SMISELEVRLKKEEKSRQELEKIKRKLEGESSDLHEQIAELQAQIAELKAQLAKKEEELQ 1098
Query: 227 MTTDAKNQALSHADDATKIAELHVEKVEILSSELTRLKALLD---SQRETESIKNRELVL 283
S ++A K + L +L KA + Q+ S + L
Sbjct: 1099 AALARLEDETSQKNNALKKIRELESHISDLQEDLESEKAARNKAEKQKRDLSEELEALKT 1158
Query: 284 KLEEEIDTLKEELEKSR 300
+LE+ +DT + E
Sbjct: 1159 ELEDTLDTTATQQELRG 1175
|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A Length = 485 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 313 | |||
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 96.03 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 95.54 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 95.52 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 95.14 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 95.05 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 94.39 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 91.56 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 91.49 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 91.22 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 90.06 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 87.39 | |
| 2b5u_A | 551 | Colicin E3; high resolution colicin E3, ribosome i | 87.23 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 87.14 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 86.12 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 86.08 | |
| 2w83_C | 77 | C-JUN-amino-terminal kinase-interacting protein 4; | 85.56 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 83.53 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 83.49 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 82.26 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 80.15 |
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
Probab=96.03 E-value=0.028 Score=61.03 Aligned_cols=18 Identities=28% Similarity=0.442 Sum_probs=6.8
Q ss_pred HHHHHHHHHHHHHHHHHH
Q 039546 113 NLVQEDLKKAKEKIELIE 130 (313)
Q Consensus 113 ~~~QeEL~k~KeQl~~AE 130 (313)
..++++|.+++..+...+
T Consensus 860 ~~L~~eL~el~~~L~~le 877 (1184)
T 1i84_S 860 QAKDEELQRTKERQQKAE 877 (1184)
T ss_dssp CHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHH
Confidence 333333333333333333
|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >2b5u_A Colicin E3; high resolution colicin E3, ribosome inactivation, ribosome inhibitor, hydrolase; HET: CIT; 2.30A {Escherichia coli} SCOP: b.101.1.1 b.110.1.1 h.4.9.1 PDB: 1jch_A* 1ujw_B* 2ysu_B 1e44_B 2xfz_Y* 2xg1_Y* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00