Citrus Sinensis ID: 039577


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--
VGVTCGVPHRRVTALSLPNLTLGGTIPPHIGNLSFLVSLTSVAKSFYGTLPNELWQLQRLRIVDLSSGIIPGSLPDDTSGDCIMLRRLSFSFNKIRGWIPQKIGNLTELVELYLDGNNLQAGLLPSVIFNSSNIQVIILYGNHLSGHLRSSIYLPNLENLFLWQNNLCGIVPDSICNASEVTILELSKNLFSCLIPNTSGVFPNSIGNLSTSLENFYASSCQLSGGIPVGFGNLSNMIKCNLESLFGLLLGGDALEGQIPTCLANLTSLISLNLRSIRLNST
ccEEcccccccEEEEEccccccEEEccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHHccccccEEEccccEEEEccccccccccccccEEccccccccccccHHHHcccccccEEccccEEcccccccccccccccEEccccccEEcccHHHHccccccEEEcccccccccccccccccccHHHHccccccEEEccccccEEEcccHHHcccccccccccccccEEEcccccEEccccccccccccccEEccccccccc
ccEEEccccccEEEEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEcccccccccccHHHcccccccEEEccccccccccccHHHccccccEEEEcccccccccccHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccHHHHHHHHHccEEEcccccccccccHHHcccccccEEccHcccEEEcccccccccccHHHHcccccEEEEccccccccc
vgvtcgvphrrvtalslpnltlggtipphignLSFLVSLTSVAKSFYGTLPNELWQLQRLRIvdlssgiipgslpddtsgdcimlRRLSFSFnkirgwipqkigNLTELVELYLDgnnlqagllpsvifnssNIQVIILYGNhlsghlrssiylpnlenlflwqnnlcgivpdsicnaSEVTILELSKNLFsclipntsgvfpnsignLSTSLENFYASscqlsggipvgfgnlSNMIKCNLESLFGLllggdalegqipTCLANLTSLISLNLRSIRLNST
vgvtcgvphrrvTALSLPNLTLGGTIPPHIGNLSFLVSLTSVAKSFYGTLPNELWQLQRLRIVDLSSGIIpgslpddtsgdCIMLRRLSFSFNKIRGWIPQKIGNLTELVELYLDGNNLQAGLLPSVIFNSSNIQVIILYGNHLSGHLRSSIYLPNLENLFLWQNNLCGIVPDSICNASEVTILELSKNLFSCLIPNTSGVFPNSIGNLSTSLENFYASSCQLSGGIPVGFGNLSNMIKCNLESLFGLLLGGDALEGQIPTCLANLtslislnlrsirlnst
VGVTCGVPHRRVTALSLPNLTLGGTIPPHIGNLSFLVSLTSVAKSFYGTLPNELWQLQRLRIVDLSSGIIPGSLPDDTSGDCIMLRRLSFSFNKIRGWIPQKIGNLTELVELYLDGNNLQAGLLPSVIFNSSNIQVIILYGNHLSGHLRSSIYLPNLENLFLWQNNLCGIVPDSICNASEVTILELSKNLFSCLIPNTSGVFPNSIGNLSTSLENFYASSCQLSGGIPVGFGNLSNMIKCNLESLFGLLLGGDALEGQIPTCLANltslislnlrsirlnst
***TCGVPHRRVTALSLPNLTLGGTIPPHIGNLSFLVSLTSVAKSFYGTLPNELWQLQRLRIVDLSSGIIPGSLPDDTSGDCIMLRRLSFSFNKIRGWIPQKIGNLTELVELYLDGNNLQAGLLPSVIFNSSNIQVIILYGNHLSGHLRSSIYLPNLENLFLWQNNLCGIVPDSICNASEVTILELSKNLFSCLIPNTSGVFPNSIGNLSTSLENFYASSCQLSGGIPVGFGNLSNMIKCNLESLFGLLLGGDALEGQIPTCLANLTSLISLNLRSI*****
VGVTCGVPHRRVTALSLPNLTLGGTIPPHIGNLSFLVSLTSVAKSFYGTLPNELWQLQRLRIVDLSSGIIPGSLPDDTSGDCIMLRRLSFSFNKIRGWIPQKIGNLTELVELYLDGNNLQAGLLPSVIFNSSNIQVIILYGNHLSGHLRSSIYLPNLENLFLWQNNLCGIVPDSICNASEVTILELSKNLFSCLIPNTSGVFPNSIGNLSTSLENFYASSCQLSGGIPVGFGNLSNMIKCNLESLFGLLLGGDALEGQIPTCLANLTSLISLNLRSIRLN**
VGVTCGVPHRRVTALSLPNLTLGGTIPPHIGNLSFLVSLTSVAKSFYGTLPNELWQLQRLRIVDLSSGIIPGSLPDDTSGDCIMLRRLSFSFNKIRGWIPQKIGNLTELVELYLDGNNLQAGLLPSVIFNSSNIQVIILYGNHLSGHLRSSIYLPNLENLFLWQNNLCGIVPDSICNASEVTILELSKNLFSCLIPNTSGVFPNSIGNLSTSLENFYASSCQLSGGIPVGFGNLSNMIKCNLESLFGLLLGGDALEGQIPTCLANLTSLISLNLRSIRLNST
VGVTCGVPHRRVTALSLPNLTLGGTIPPHIGNLSFLVSLTSVAKSFYGTLPNELWQLQRLRIVDLSSGIIPGSLPDDTSGDCIMLRRLSFSFNKIRGWIPQKIGNLTELVELYLDGNNLQAGLLPSVIFNSSNIQVIILYGNHLSGHLRSSIYLPNLENLFLWQNNLCGIVPDSICNASEVTILELSKNLFSCLIPNTSGVFPNSIGNLSTSLENFYASSCQLSGGIPVGFGNLSNMIKCNLESLFGLLLGGDALEGQIPTCLANLTSLISLNLRS******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VGVTCGVPHRRVTALSLPNLTLGGTIPPHIGNLSFLVSLTSVAKSFYGTLPNELWQLQRLRIVDLSSGIIPGSLPDDTSGDCIMLRRLSFSFNKIRGWIPQKIGNLTELVELYLDGNNLQAGLLPSVIFNSSNIQVIILYGNHLSGHLRSSIYLPNLENLFLWQNNLCGIVPDSICNASEVTILELSKNLFSCLIPNTSGVFPNSIGNLSTSLENFYASSCQLSGGIPVGFGNLSNMIKCNLESLFGLLLGGDALEGQIPTCLANLTSLISLNLRSIRLNST
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query282 2.2.26 [Sep-21-2011]
C0LGP4 1010 Probable LRR receptor-lik yes no 0.953 0.266 0.339 2e-28
Q9LHP4 1141 Receptor-like protein kin no no 0.932 0.230 0.343 3e-24
C0LGQ5 1249 LRR receptor-like serine/ no no 0.932 0.210 0.309 7e-24
P93194 1109 Receptor-like protein kin N/A no 0.907 0.230 0.327 7e-23
C0LGT6 1031 LRR receptor-like serine/ no no 0.953 0.260 0.305 1e-22
Q9SD62 1025 Putative receptor-like pr no no 0.939 0.258 0.283 2e-22
O49318 1124 Probable leucine-rich rep no no 0.943 0.236 0.300 7e-22
Q9SHI2 1101 Leucine-rich repeat recep no no 0.960 0.246 0.312 2e-21
Q9FZ59 1088 Leucine-rich repeat recep no no 0.932 0.241 0.337 2e-21
Q9LP24 1120 Probable leucine-rich rep no no 0.875 0.220 0.326 3e-21
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function desciption
 Score =  126 bits (316), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 107/315 (33%), Positives = 160/315 (50%), Gaps = 46/315 (14%)

Query: 2   GVTCGVPHRRVTALSLPNLTLGGTIPPHIGNLSFLVSLTSVAKSFYGTLPNELWQLQRLR 61
           GVTCG  ++RVT L L  L LGG I P IGNLSFLVSL      F GT+P E+ QL RL 
Sbjct: 58  GVTCGRKNKRVTHLELGRLQLGGVISPSIGNLSFLVSLDLYENFFGGTIPQEVGQLSRLE 117

Query: 62  IVDLSSGIIPGSLPDDTSGDCIMLRRLSFSFNKIRGWIPQKIGNLTELVELYLDGNNLQA 121
            +D+    + G +P     +C  L  L    N++ G +P ++G+LT LV+L L GNN++ 
Sbjct: 118 YLDMGINYLRGPIPLGLY-NCSRLLNLRLDSNRLGGSVPSELGSLTNLVQLNLYGNNMR- 175

Query: 122 GLLPSVIFNSSNIQVIILYGNHLSGHLRSSI-YLPNLENLFLWQNNLCGIVPDSICNASE 180
           G LP+ + N + ++ + L  N+L G + S +  L  + +L L  NN  G+ P ++ N S 
Sbjct: 176 GKLPTSLGNLTLLEQLALSHNNLEGEIPSDVAQLTQIWSLQLVANNFSGVFPPALYNLSS 235

Query: 181 VTILELSKNLFS--------CLIPNT----------SGVFPNSIGNLSTSLENFYASSCQ 222
           + +L +  N FS         L+PN           +G  P ++ N+ST LE    +   
Sbjct: 236 LKLLGIGYNHFSGRLRPDLGILLPNLLSFNMGGNYFTGSIPTTLSNIST-LERLGMNENN 294

Query: 223 LSGGIPVGFGNLSNMI----------------------KCNLESLFGLLLGGDALEGQIP 260
           L+G IP  FGN+ N+                         N   L  L +G + L G +P
Sbjct: 295 LTGSIPT-FGNVPNLKLLFLHTNSLGSDSSRDLEFLTSLTNCTQLETLGIGRNRLGGDLP 353

Query: 261 TCLANLTS-LISLNL 274
             +ANL++ L++L+L
Sbjct: 354 ISIANLSAKLVTLDL 368





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description
>sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 Back     alignment and function description
>sp|Q9SD62|Y3471_ARATH Putative receptor-like protein kinase At3g47110 OS=Arabidopsis thaliana GN=At3g47110 PE=3 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
255583725 973 serine-threonine protein kinase, plant-t 0.996 0.288 0.332 2e-33
359483685 1046 PREDICTED: LRR receptor-like serine/thre 0.900 0.242 0.372 4e-33
296085726 932 unnamed protein product [Vitis vinifera] 0.886 0.268 0.359 7e-33
302142771 902 unnamed protein product [Vitis vinifera] 0.929 0.290 0.349 1e-32
9663990 1070 putative protein kinase Xa21 [Oryza sati 0.929 0.244 0.387 1e-32
115434584 1042 Os01g0153000 [Oryza sativa Japonica Grou 0.929 0.251 0.387 2e-32
359492792 1067 PREDICTED: probable LRR receptor-like se 0.957 0.253 0.377 6e-32
359485176 1160 PREDICTED: probable LRR receptor-like se 0.929 0.225 0.335 3e-30
359483677 1229 PREDICTED: LRR receptor-like serine/thre 0.950 0.218 0.322 5e-30
297831962 968 predicted protein [Arabidopsis lyrata su 0.957 0.278 0.319 6e-30
>gi|255583725|ref|XP_002532616.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223527672|gb|EEF29782.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  148 bits (374), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 132/397 (33%), Positives = 178/397 (44%), Gaps = 116/397 (29%)

Query: 1   VGVTCGVPHRRVTALSLPNLTLGGTIPPHIGNLSFLV--SLTSVAKSFYGTLPNELWQLQ 58
           +GVTCG  H RVTAL+L ++ L GTIPPH+GNLSFLV   L   A  + G +P  L+ L 
Sbjct: 68  IGVTCGARHNRVTALNLSHMGLAGTIPPHLGNLSFLVFGCLNMFAVLYIGVIPTSLFNLS 127

Query: 59  RLRIVDLSSGIIPGSLPD---------------DTSGDCI--------MLRRLSFSFNKI 95
           +L I  LSS  + G +P+               +   D I         L ++ FS N+ 
Sbjct: 128 KLSIFYLSSNNLQGYIPEAIGNLYSLRLLSLEKNEFSDSIPSSIFNISSLEQIDFSNNRF 187

Query: 96  RGWIPQKIGNLTELVELYLDGNNLQAGLLPSVIFNSSNIQVIILYGNHLSGH--LRSSIY 153
            G IP +IGNL  L EL   G N  AG++PS I+N+S + VI L  N LSGH      + 
Sbjct: 188 SGIIPDEIGNLANL-ELINLGVNRLAGVVPSGIYNASKMMVISLSSNQLSGHLPSSLGLL 246

Query: 154 LPNLENLFLWQNNLCGIVPDSICNASEVTILELSKNLFSCLIPNT--------------- 198
           LPNL  LFL  NN  G +P S+ NASE+T++ L  N F   IP+                
Sbjct: 247 LPNLRRLFLGGNNFTGPIPISLSNASELTLIALPSNSFFGHIPDELGNLRSLQYLYLWGN 306

Query: 199 ---------------------------------SGVFPNSIGNLSTSLENFYASSCQLSG 225
                                            +G  P S+GNLS+SLE   A  C ++G
Sbjct: 307 HLTIKSLSSGLSLFNSLTKCKDLRILYLHDNPLNGTLPISVGNLSSSLEVLSAYRCGITG 366

Query: 226 GIPVGFG-------------NLSNMIK---------------------------CNLESL 245
            IP+  G             +L   I                            C+L+SL
Sbjct: 367 TIPIEIGNLSNLTLLSLYENDLRGTIPATIGKLRKLQALLLDHNKLEGVFPPELCDLQSL 426

Query: 246 FGLLLGGDALEGQIPTCLANLTSLISLNLRSIRLNST 282
             L LG + L G IP+CL N+ SL +L+++  + NST
Sbjct: 427 AILSLGVNTLSGSIPSCLGNVDSLRNLSMQMNKFNST 463




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359483685|ref|XP_002263372.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase EFR-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296085726|emb|CBI29526.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|302142771|emb|CBI19974.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|9663990|dbj|BAB03631.1| putative protein kinase Xa21 [Oryza sativa Japonica Group] gi|13872947|dbj|BAB44052.1| putative protein kinase Xa21 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|115434584|ref|NP_001042050.1| Os01g0153000 [Oryza sativa Japonica Group] gi|113531581|dbj|BAF03964.1| Os01g0153000 [Oryza sativa Japonica Group] gi|125569065|gb|EAZ10580.1| hypothetical protein OsJ_00412 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|359492792|ref|XP_002278117.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485176|ref|XP_002280075.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483677|ref|XP_003633000.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297831962|ref|XP_002883863.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297329703|gb|EFH60122.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
TAIR|locus:2079142 1010 AT3G47570 [Arabidopsis thalian 0.826 0.230 0.362 5.4e-30
UNIPROTKB|Q40640 1025 Xa21 "Receptor kinase-like pro 0.858 0.236 0.363 7.9e-28
TAIR|locus:2075631 1009 AT3G47090 [Arabidopsis thalian 0.847 0.236 0.359 1.4e-26
TAIR|locus:2085949 1141 AT3G24240 [Arabidopsis thalian 0.815 0.201 0.348 7.7e-26
TAIR|locus:2075661 1025 AT3G47110 [Arabidopsis thalian 0.847 0.233 0.319 1.4e-25
TAIR|locus:2079157 1011 AT3G47580 [Arabidopsis thalian 0.875 0.244 0.332 1.6e-24
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.815 0.205 0.343 3e-24
UNIPROTKB|P93194 1109 INRPK1 "Receptor-like protein 0.879 0.223 0.323 4.8e-24
TAIR|locus:2007918 1088 PEPR2 "PEP1 receptor 2" [Arabi 0.897 0.232 0.339 9.8e-24
TAIR|locus:2149922 1031 EFR "EF-TU receptor" [Arabidop 0.826 0.225 0.326 3.1e-23
TAIR|locus:2079142 AT3G47570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 343 (125.8 bits), Expect = 5.4e-30, P = 5.4e-30
 Identities = 92/254 (36%), Positives = 137/254 (53%)

Query:     2 GVTCGVPHRRVTALSLPNLTLGGTIPPHIGNLSFLVSLTSVAKSFYGTLPNELWQLQRLR 61
             GVTCG  ++RVT L L  L LGG I P IGNLSFLVSL      F GT+P E+ QL RL 
Sbjct:    58 GVTCGRKNKRVTHLELGRLQLGGVISPSIGNLSFLVSLDLYENFFGGTIPQEVGQLSRLE 117

Query:    62 IVDLSSGIIPGSLPDDTSGDCIMLRRLSFSFNKIRGWIPQKIGNLTELVELYLDGNNLQA 121
              +D+    + G +P     +C  L  L    N++ G +P ++G+LT LV+L L GNN++ 
Sbjct:   118 YLDMGINYLRGPIPLGLY-NCSRLLNLRLDSNRLGGSVPSELGSLTNLVQLNLYGNNMR- 175

Query:   122 GLLPSVIFNSSNIQVIILYGNHLSGHLRSSI-YLPNLENLFLWQNNLCGIVPDSICNASE 180
             G LP+ + N + ++ + L  N+L G + S +  L  + +L L  NN  G+ P ++ N S 
Sbjct:   176 GKLPTSLGNLTLLEQLALSHNNLEGEIPSDVAQLTQIWSLQLVANNFSGVFPPALYNLSS 235

Query:   181 VTILELSKNLFSC-LIPNTSGVFPNSI----------GNLSTSLENFYA------SSCQL 223
             + +L +  N FS  L P+   + PN +          G++ T+L N         +   L
Sbjct:   236 LKLLGIGYNHFSGRLRPDLGILLPNLLSFNMGGNYFTGSIPTTLSNISTLERLGMNENNL 295

Query:   224 SGGIPVGFGNLSNM 237
             +G IP  FGN+ N+
Sbjct:   296 TGSIPT-FGNVPNL 308


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
UNIPROTKB|Q40640 Xa21 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2075631 AT3G47090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075661 AT3G47110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079157 AT3G47580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P93194 INRPK1 "Receptor-like protein kinase" [Ipomoea nil (taxid:35883)] Back     alignment and assigned GO terms
TAIR|locus:2007918 PEPR2 "PEP1 receptor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149922 EFR "EF-TU receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00018948001
SubName- Full=Chromosome chr12 scaffold_18, whole genome shotgun sequence; (1059 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-22
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-22
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-18
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-16
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-04
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 0.003
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 95.3 bits (237), Expect = 6e-22
 Identities = 95/294 (32%), Positives = 133/294 (45%), Gaps = 50/294 (17%)

Query: 14  ALSLPNLTLGGTIPPHIGNLSFLVSLTSVAKSFYGTLPNELWQLQRLRIVDLSSGIIPGS 73
            L L N  L G IP  IG+ S L  L        G +PN L  L  L  + L+S  + G 
Sbjct: 144 TLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQ 203

Query: 74  LPDDTSGDCIMLRRLSFSFNKIRGWIPQKIGNLTELVELYLDGNNLQAGLLPSVIFNSSN 133
           +P +  G    L+ +   +N + G IP +IG LT L  L L  NNL  G +PS + N  N
Sbjct: 204 IPREL-GQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNL-TGPIPSSLGNLKN 261

Query: 134 IQVIILYGNHLSGHLRSSIY-------------------------LPNLENLFLWQNNLC 168
           +Q + LY N LSG +  SI+                         L NLE L L+ NN  
Sbjct: 262 LQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFT 321

Query: 169 GIVPDSICNASEVTILELSKNLFSCLIPNTSGVFPN-SIGNLSTSLENFYASSCQLSGGI 227
           G +P ++ +   + +L+L  N FS  IP   G   N ++ +LST+          L+G I
Sbjct: 322 GKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTN---------NLTGEI 372

Query: 228 PVGFGNLSNMIKCNLESLFGLLLGGDALEGQIPTCLANLTSLISLNLRSIRLNS 281
           P G         C+  +LF L+L  ++LEG+IP  L    S     LR +RL  
Sbjct: 373 PEGL--------CSSGNLFKLILFSNSLEGEIPKSLGACRS-----LRRVRLQD 413


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 282
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.98
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.91
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.91
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.89
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.86
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.82
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.81
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.78
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.76
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.74
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.69
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.67
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.66
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.65
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.64
KOG4237498 consensus Extracellular matrix protein slit, conta 99.53
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.3
PLN03150623 hypothetical protein; Provisional 99.25
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.19
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.18
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.17
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.16
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.15
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 99.12
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.11
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.07
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.04
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.0
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.0
PLN03150623 hypothetical protein; Provisional 98.89
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.86
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.83
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.78
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.74
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.66
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.51
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.5
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.36
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.27
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.25
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.25
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.17
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.06
PRK15386 426 type III secretion protein GogB; Provisional 97.87
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.87
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.83
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.79
PRK15386 426 type III secretion protein GogB; Provisional 97.77
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.72
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.71
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.7
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.65
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.54
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.53
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.05
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.99
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.87
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.6
KOG4341483 consensus F-box protein containing LRR [General fu 96.56
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.41
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.93
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.85
KOG4341483 consensus F-box protein containing LRR [General fu 95.47
KOG2123 388 consensus Uncharacterized conserved protein [Funct 94.69
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.92
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.77
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 93.46
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.96
KOG4308 478 consensus LRR-containing protein [Function unknown 90.48
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.57
smart0037026 LRR Leucine-rich repeats, outliers. 88.57
KOG1947 482 consensus Leucine rich repeat proteins, some prote 86.97
KOG1947482 consensus Leucine rich repeat proteins, some prote 84.42
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 83.28
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 82.82
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.98  E-value=7.2e-32  Score=255.86  Aligned_cols=275  Identities=30%  Similarity=0.467  Sum_probs=195.7

Q ss_pred             CCeeecCCCCceEEEEcCCCccccCCCccccCCCCccEEEecCCcceeeCCcccc-CCCCCcEEEcCCCcccccCCCCcc
Q 039577            1 VGVTCGVPHRRVTALSLPNLTLGGTIPPHIGNLSFLVSLTSVAKSFYGTLPNELW-QLQRLRIVDLSSGIIPGSLPDDTS   79 (282)
Q Consensus         1 ~~~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l~-~l~~L~~L~l~~~~~~~~~~~~~~   79 (282)
                      +||+|+. .+++++|+++++.+.+.++..+..+++|++|++++|.+.+.+|..+. .+++|++|++++|.+.+.+|.   
T Consensus        61 ~gv~c~~-~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~---  136 (968)
T PLN00113         61 QGITCNN-SSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR---  136 (968)
T ss_pred             cceecCC-CCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc---
Confidence            4899986 57999999999999998888899999999999999999888887766 889999999999988766665   


Q ss_pred             CCCCCccEEEcccCeecccCCcCCcCCCCceEEEecCCCCCCCCCCccccCCCCCcEEEecCccccccCCCCc-CCCCcc
Q 039577           80 GDCIMLRRLSFSFNKIRGWIPQKIGNLTELVELYLDGNNLQAGLLPSVIFNSSNIQVIILYGNHLSGHLRSSI-YLPNLE  158 (282)
Q Consensus        80 ~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~-~~~~L~  158 (282)
                      ..+++|++|++++|.+.+..|..++.+++|++|++++|.+ .+..|..+.++++|++|++++|.+....+..+ .+.+|+
T Consensus       137 ~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l-~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~  215 (968)
T PLN00113        137 GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVL-VGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLK  215 (968)
T ss_pred             cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcc-cccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCcc
Confidence            3467777777777777666676777777777777777766 34456666677777777777776665555555 566677


Q ss_pred             EEEeecCcceeeccchhhCCCCCcEEeccCcccceecCCC-----------------CCCCCCcccccccccceEEeecc
Q 039577          159 NLFLWQNNLCGIVPDSICNASEVTILELSKNLFSCLIPNT-----------------SGVFPNSIGNLSTSLENFYASSC  221 (282)
Q Consensus       159 ~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~-----------------~~~l~~~~~~~~~~L~~L~l~~n  221 (282)
                      .|++++|.+++.+|..+..+++|++|++++|.+.+..|..                 .+.+|.++..++ +|++|++++|
T Consensus       216 ~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~-~L~~L~Ls~n  294 (968)
T PLN00113        216 WIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQ-KLISLDLSDN  294 (968)
T ss_pred             EEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhcc-CcCEEECcCC
Confidence            7777766666566666666666666666666665433321                 122344455555 6777777777


Q ss_pred             cceecCCccccCCccCcccc----------------ccccceeeccCCeeeeecchhhhccCCCceeeccCccCCC
Q 039577          222 QLSGGIPVGFGNLSNMIKCN----------------LESLFGLLLGGDALEGQIPTCLANLTSLISLNLRSIRLNS  281 (282)
Q Consensus       222 ~~~~~~~~~~~~l~~l~~l~----------------l~~l~~L~l~~n~~~~~~~~~~~~l~~L~~l~l~~n~~~~  281 (282)
                      .+.+.+|..+.++++|+.|+                +++|+.|++++|.+.+.+|..+..+++|+.+++++|++++
T Consensus       295 ~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~  370 (968)
T PLN00113        295 SLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTG  370 (968)
T ss_pred             eeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEe
Confidence            66666666666666666554                3456667777777766666667777777777777776654



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-11
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 6e-05
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 4e-11
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 5e-05
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-06
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-04
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 6e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 65.1 bits (157), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 74/261 (28%), Positives = 118/261 (45%), Gaps = 37/261 (14%) Query: 12 VTALSLPNLTLGGTIPPHIGNLSFLVSLTSVAKSFYGTLP-NELWQLQRLRIVDLSSGII 70 +T L L G +PP G+ S L SL + +F G LP + L +++ L+++DLS Sbjct: 293 LTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEF 352 Query: 71 PGSLPD------------DTSGDCI--------------MLRRLSFSFNKIRGWIPQKIG 104 G LP+ D S + L+ L N G IP + Sbjct: 353 SGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLS 412 Query: 105 NLTELVELYLDGNNLQAGLLPSVIFNSSNIQVIILYGNHLSGHL-RSSIYLPNLENLFLW 163 N +ELV L+L N L +G +PS + + S ++ + L+ N L G + + +Y+ LE L L Sbjct: 413 NCSELVSLHLSFNYL-SGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILD 471 Query: 164 QNNLCGIVPDSICNASEVTILELSKNLFSCLIPNTSGVFPNSIGNLSTSLENFYASSCQL 223 N+L G +P + N + + + LS N +G P IG L +L S+ Sbjct: 472 FNDLTGEIPSGLSNCTNLNWISLSNNRL-------TGEIPKWIGRLE-NLAILKLSNNSF 523 Query: 224 SGGIPVGFGNLSNMIKCNLES 244 SG IP G+ ++I +L + Sbjct: 524 SGNIPAELGDCRSLIWLDLNT 544
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-45
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-37
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-35
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-18
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-41
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-38
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-37
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-37
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-30
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-23
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-17
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-17
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-16
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-29
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-27
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-24
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-24
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-21
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-24
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-20
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-23
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-20
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-18
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-17
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-09
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-10
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-10
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-11
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-10
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-07
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-06
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-08
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-09
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-08
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-08
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-06
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-04
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 9e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  153 bits (390), Expect = 4e-45
 Identities = 66/281 (23%), Positives = 107/281 (38%), Gaps = 35/281 (12%)

Query: 1   VGVTCGVPHR--RVTALSLPNLTLGGT--IPPHIGNLSFLVSLT-SVAKSFYGTLPNELW 55
           +GV C    +  RV  L L  L L     IP  + NL +L  L      +  G +P  + 
Sbjct: 39  LGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIA 98

Query: 56  QLQRLRIVDLS----SGIIPGSLPDDTSGDCIMLRRLSFSFNKIRGWIPQKIGNLTELVE 111
           +L +L  + ++    SG IP  L          L  L FS+N + G +P  I +L  LV 
Sbjct: 99  KLTQLHYLYITHTNVSGAIPDFL-----SQIKTLVTLDFSYNALSGTLPPSISSLPNLVG 153

Query: 112 LYLDGNNLQAGLLPSVIFN-SSNIQVIILYGNHLSGHLRSSIYLPNLENLFLWQNNLCGI 170
           +  DGN +  G +P    + S     + +  N L+G +  +    NL  + L +N L G 
Sbjct: 154 ITFDGNRIS-GAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGD 212

Query: 171 VPDSICNASEVTILELSKNLFSCLIPNTSGVFPNSIGNLSTSLENFYASSCQLSGGIPVG 230
                 +      + L+KN  +  +          +G    +L      + ++ G +P G
Sbjct: 213 ASVLFGSDKNTQKIHLAKNSLAFDLG--------KVGLSK-NLNGLDLRNNRIYGTLPQG 263

Query: 231 FGNLSNMIKCNLESLFGLLLGGDALEGQIPT--CLANLTSL 269
              L          L  L +  + L G+IP    L      
Sbjct: 264 LTQLKF--------LHSLNVSFNNLCGEIPQGGNLQRFDVS 296


>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.98
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.98
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.94
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.91
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.91
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.83
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.77
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.77
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.73
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.73
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.72
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.71
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.7
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.7
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.67
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.66
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.65
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.57
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.57
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.56
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.54
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.52
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.5
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.48
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.47
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.47
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.44
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.43
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.41
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.39
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.35
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.35
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.3
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.24
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.24
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.23
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.2
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.17
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.11
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.99
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.79
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.77
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.57
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.57
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.41
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.29
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.1
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.97
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.96
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.94
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.92
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.88
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.56
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.46
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.66
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.57
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.21
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=1.9e-35  Score=245.32  Aligned_cols=257  Identities=25%  Similarity=0.391  Sum_probs=229.6

Q ss_pred             CCeeecCCC--CceEEEEcCCCcccc--CCCccccCCCCccEEEecC-CcceeeCCccccCCCCCcEEEcCCCcccccCC
Q 039577            1 VGVTCGVPH--RRVTALSLPNLTLGG--TIPPHIGNLSFLVSLTSVA-KSFYGTLPNELWQLQRLRIVDLSSGIIPGSLP   75 (282)
Q Consensus         1 ~~~~~~~~~--~~l~~l~l~~~~~~~--~~~~~~~~l~~L~~L~l~~-~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~   75 (282)
                      +||+|+...  +++++|+++++.+.+  .+|..+..+++|++|++++ |.+.+.+|..+.++++|++|++++|.+.+.+|
T Consensus        39 ~gv~C~~~~~~~~l~~L~L~~~~l~~~~~~~~~l~~l~~L~~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p  118 (313)
T 1ogq_A           39 LGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIP  118 (313)
T ss_dssp             TTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECC
T ss_pred             cceEeCCCCCCceEEEEECCCCCccCCcccChhHhCCCCCCeeeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCcCC
Confidence            489998644  899999999999998  8999999999999999995 99998899999999999999999999987777


Q ss_pred             CCccCCCCCccEEEcccCeecccCCcCCcCCCCceEEEecCCCCCCCCCCccccCCC-CCcEEEecCccccccCCCCc-C
Q 039577           76 DDTSGDCIMLRRLSFSFNKIRGWIPQKIGNLTELVELYLDGNNLQAGLLPSVIFNSS-NIQVIILYGNHLSGHLRSSI-Y  153 (282)
Q Consensus        76 ~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~-~L~~L~l~~~~~~~~~~~~~-~  153 (282)
                      . .+..+++|++|++++|.+.+..|..+..+++|++|++++|.+ .+..|..+..+. .|+.|++++|.+....+..+ .
T Consensus       119 ~-~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~N~l-~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~~~~~~  196 (313)
T 1ogq_A          119 D-FLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRI-SGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFAN  196 (313)
T ss_dssp             G-GGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCC-EEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGG
T ss_pred             H-HHhCCCCCCEEeCCCCccCCcCChHHhcCCCCCeEECcCCcc-cCcCCHHHhhhhhcCcEEECcCCeeeccCChHHhC
Confidence            7 789999999999999999988899999999999999999998 445788888887 99999999999987777777 5


Q ss_pred             CCCccEEEeecCcceeeccchhhCCCCCcEEeccCcccceecCCCCCCCCCcccccccccceEEeecccceecCCccccC
Q 039577          154 LPNLENLFLWQNNLCGIVPDSICNASEVTILELSKNLFSCLIPNTSGVFPNSIGNLSTSLENFYASSCQLSGGIPVGFGN  233 (282)
Q Consensus       154 ~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~l~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~  233 (282)
                      +. |+.|++++|.+++..|..+..+++|++|++++|.+++..+        .+..++ +|++|++++|.+++.+|..+..
T Consensus       197 l~-L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~--------~~~~l~-~L~~L~Ls~N~l~~~~p~~l~~  266 (313)
T 1ogq_A          197 LN-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG--------KVGLSK-NLNGLDLRNNRIYGTLPQGLTQ  266 (313)
T ss_dssp             CC-CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG--------GCCCCT-TCCEEECCSSCCEECCCGGGGG
T ss_pred             Cc-ccEEECcCCcccCcCCHHHhcCCCCCEEECCCCceeeecC--------cccccC-CCCEEECcCCcccCcCChHHhc
Confidence            55 9999999999998888889999999999999999975433        244556 9999999999999899988876


Q ss_pred             CccCccccccccceeeccCCeeeeecchhhhccCCCceeeccCcc
Q 039577          234 LSNMIKCNLESLFGLLLGGDALEGQIPTCLANLTSLISLNLRSIR  278 (282)
Q Consensus       234 l~~l~~l~l~~l~~L~l~~n~~~~~~~~~~~~l~~L~~l~l~~n~  278 (282)
                      +        ++|+.|++++|.+++.+|.. ..+++|+.+++++|.
T Consensus       267 l--------~~L~~L~Ls~N~l~~~ip~~-~~l~~L~~l~l~~N~  302 (313)
T 1ogq_A          267 L--------KFLHSLNVSFNNLCGEIPQG-GNLQRFDVSAYANNK  302 (313)
T ss_dssp             C--------TTCCEEECCSSEEEEECCCS-TTGGGSCGGGTCSSS
T ss_pred             C--------cCCCEEECcCCcccccCCCC-ccccccChHHhcCCC
Confidence            5        67889999999999999986 889999999999997



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 282
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.002
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 4e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 55.9 bits (133), Expect = 1e-09
 Identities = 65/278 (23%), Positives = 101/278 (36%), Gaps = 24/278 (8%)

Query: 2   GVTC--GVPHRRVTALSLPNLTLGG--TIPPHIGNLSFLVSLT-SVAKSFYGTLPNELWQ 56
           GV C       RV  L L  L L     IP  + NL +L  L      +  G +P  + +
Sbjct: 40  GVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAK 99

Query: 57  LQRLRIVDLSSGIIPGSLPDDTSGDCIMLRRLSFSFNKIRGWIPQKIGNLTELVELYLDG 116
           L +L  + ++   + G+   D       L  L FS+N + G +P  I +L  LV +  DG
Sbjct: 100 LTQLHYLYITHTNVSGA-IPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDG 158

Query: 117 NNLQAGLLPSVIFNSSNIQVIILYGNHLSGHLRSSIYLPNLENLFLWQNNLCGIVPDSIC 176
           N +   +  S    S     + +  N L+G +  +    NL  + L +N L G       
Sbjct: 159 NRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFG 218

Query: 177 NASEVTILELSKNLFSCLIPNTSGVFPNSIGNLSTSLENFYASSCQLSGGIPVGFGNLSN 236
           +          KN     +   S  F      LS +L      + ++ G +P G   L  
Sbjct: 219 S---------DKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKF 269

Query: 237 MIKCNLESLFGLLLGGDALEGQIPTCLANLTSLISLNL 274
                   L  L +  + L G+IP    NL        
Sbjct: 270 --------LHSLNVSFNNLCGEIPQ-GGNLQRFDVSAY 298


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.86
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.84
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.82
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.6
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.59
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.58
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.5
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.5
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.46
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.45
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.43
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.38
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.33
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.22
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.1
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.03
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.01
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.98
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.79
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.47
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.44
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.17
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.03
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=1.2e-32  Score=226.59  Aligned_cols=258  Identities=25%  Similarity=0.387  Sum_probs=222.4

Q ss_pred             CCeeecCC--CCceEEEEcCCCcccc--CCCccccCCCCccEEEecC-CcceeeCCccccCCCCCcEEEcCCCcccccCC
Q 039577            1 VGVTCGVP--HRRVTALSLPNLTLGG--TIPPHIGNLSFLVSLTSVA-KSFYGTLPNELWQLQRLRIVDLSSGIIPGSLP   75 (282)
Q Consensus         1 ~~~~~~~~--~~~l~~l~l~~~~~~~--~~~~~~~~l~~L~~L~l~~-~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~   75 (282)
                      +||+|+..  ..+|++|+++++.+.+  .+|+.++++++|++|++++ |.+.+.+|..+.++++|++|++++|.+.+..+
T Consensus        39 ~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~  118 (313)
T d1ogqa_          39 LGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIP  118 (313)
T ss_dssp             TTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECC
T ss_pred             CCeEEeCCCCcEEEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhcccccccccc
Confidence            59999763  4589999999999987  5889999999999999986 78988999999999999999999999985555


Q ss_pred             CCccCCCCCccEEEcccCeecccCCcCCcCCCCceEEEecCCCCCCCCCCccccCCCCC-cEEEecCccccccCCCCcCC
Q 039577           76 DDTSGDCIMLRRLSFSFNKIRGWIPQKIGNLTELVELYLDGNNLQAGLLPSVIFNSSNI-QVIILYGNHLSGHLRSSIYL  154 (282)
Q Consensus        76 ~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~L-~~L~l~~~~~~~~~~~~~~~  154 (282)
                      . .+..+.+|+++++..|.+...+|..+..++.++.+++++|.+ .+.+|..+..+..+ +.+.++.|.+....+..+..
T Consensus       119 ~-~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l-~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~  196 (313)
T d1ogqa_         119 D-FLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRI-SGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFAN  196 (313)
T ss_dssp             G-GGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCC-EEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGG
T ss_pred             c-cccchhhhcccccccccccccCchhhccCcccceeecccccc-ccccccccccccccccccccccccccccccccccc
Confidence            4 788899999999999998888899999999999999999988 55677777777765 88999999998777766633


Q ss_pred             CCccEEEeecCcceeeccchhhCCCCCcEEeccCcccceecCCCCCCCCCcccccccccceEEeecccceecCCccccCC
Q 039577          155 PNLENLFLWQNNLCGIVPDSICNASEVTILELSKNLFSCLIPNTSGVFPNSIGNLSTSLENFYASSCQLSGGIPVGFGNL  234 (282)
Q Consensus       155 ~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~l~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~l  234 (282)
                      .....+++..+...+..|..+..+++++.+++.++.+.+.++        .+..++ +++.|++++|++++.+|.+++++
T Consensus       197 l~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~--------~~~~~~-~L~~L~Ls~N~l~g~iP~~l~~L  267 (313)
T d1ogqa_         197 LNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG--------KVGLSK-NLNGLDLRNNRIYGTLPQGLTQL  267 (313)
T ss_dssp             CCCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG--------GCCCCT-TCCEEECCSSCCEECCCGGGGGC
T ss_pred             cccccccccccccccccccccccccccccccccccccccccc--------cccccc-ccccccCccCeecccCChHHhCC
Confidence            344578999998888888888889999999999998875433        345555 99999999999999999988875


Q ss_pred             ccCccccccccceeeccCCeeeeecchhhhccCCCceeeccCcc
Q 039577          235 SNMIKCNLESLFGLLLGGDALEGQIPTCLANLTSLISLNLRSIR  278 (282)
Q Consensus       235 ~~l~~l~l~~l~~L~l~~n~~~~~~~~~~~~l~~L~~l~l~~n~  278 (282)
                              ++|++|++++|+++|.+|+ +.++.+|+.+++++|+
T Consensus       268 --------~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         268 --------KFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNK  302 (313)
T ss_dssp             --------TTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSS
T ss_pred             --------CCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCc
Confidence                    6788999999999999986 5788999999999986



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure