Citrus Sinensis ID: 039656

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660

KLEALGQFLTKSKLDWKNALKNLTRISNPNIYDVLKISYNELKKEEKSIFLDIACFFKGEDKDYMTMIQDYPDYADYGVNFLVDKSLITISCYNKLQMHDLLQEMGQEIVRQESVRDPSKRSRLWHHEDVYNVLKRNKGTIAIEGIFLDMSKIRDIHLACGTFTSMSNLRLLKFYMPNRDGFSIMSSKVHLDQGLEYLPEELRYLHWYGYPLRTLPSNFDPENLIALNLPYSKVEQIWKGEKYLNVDGSAISHLPSSIADLNKLEDLSFFGCKASVLPRVLSGLSSLKWMELRDCDLIKIPQDIGSLSSLEWFVLSGNNFEHLPASIKKLSRLTYLNLSGCNMLRSLPELPIRLICLDARNCERLRTLQELPSCPEELDASILESLSKHSRESTQPRIYFNFTNCLKVNGNAYNILAEIKLRLFNEKNFDTQRGISICLPGSGIPDWFSNQSSGSSITIQLPRHCCNRIFIGFAFSAVIEFQRDSDARGEYFHVRCDYTFENKHVDHCHLVQYLTIDSDHVILGFQPCCDIQPPDGDHSAAVSFRFLIENKKCHNEKCCGVNPVYANPNMTKSNTFTLKFAASSEEECTKPRIEFHDKPSRSGATGNIPGSVRRENTTTLQQQSCSSSQIFHKRGGFFSFLIRNEVMLCSVQFFAQTGFR

ccEEEcccccccHHHHHHHHHHHHcccccHHHHHHcccccccccccccEEEEEEEccccccHHHHHHHHccccccccccHHHcccccEEEEcccEEEccHHHHHHHHHHHHHccccccccEEEEccccHHHHHHHcccccccEEEEEEEccccEEEEEccccccccccccEEEEEccccccccccccEEEcccccccccccccEEEEccccccccccccccccccEEEcccccccccccccccccccccccEEEcccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEEcccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHHHHHHccccccccccEEEEEccccccccccccccccEEEEEcccccccccccEEEEEEEEEEccccccccccEEEEEEEEEccEEEEEEEEcccccccccEEEEEEEccccccccccccccEEEEEEEEEEccccEEEEEEEEEEEccccccccccEEEEcccccccccccccccEEccccccccccccccccccccccccccccccccEEEcccccHHHHHHHHHHEEEEEHHHHHcccc

ccHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHEEEccccccHHHHHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHcEEEEEccccEEEHHHHHHHHHHHHHHHcccccccccEEEccHHHHHHHHHccccccEEEEEEEEccccccccccHHHHHHccccEEEEEEccccccccccccEEEcccccccccHHcEEEEccccccccccccccHHHHEEEcccccHHHHHHccccEEcccccccEcccccHccccccHEEEccccccccccccHHHHHHHcEEEccccccccccccccccccccEEEccccccEEccccHHHcHcccEEEccccccHccccccHHHHHHHHHccccccccccccccHHHHHHHccccccccccccccccccEEEEccHHHccHHHHHHHHHHHHHHHHHcccccccccEEEEccccccHHEcEcccccEEEEEccccccccccccEEEEEEEEEcccccccccEEEEEEEEEEEccccccccccccccccccEEEEEEcccccccccccccccEEEEEEEEcccccEEEEEcEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHcccc

KLEALGQFLTKSKLDWKNALKNltrisnpniyDVLKISYNELKKEEKSIFLDIAcffkgedkDYMTMIQdypdyadygvnflvDKSLITISCYNKLQMHDLLQEMGQEIVrqesvrdpskrsrlwhhEDVYNVLKrnkgtiaiegIFLDMSKIRDIHLAcgtftsmsnLRLLKfympnrdgfsimSSKVHLdqgleylpeELRYLHwygyplrtlpsnfdpenlialnlpyskveqiwkgekylnvdgsaishlpssiadlnkledlsffgckasvlprvlsglsslkwmelrdcdlikipqdigslsSLEWFVLSGNNFEHLPASIKKLSRLTYLnlsgcnmlrslpelPIRLICLDARNCErlrtlqelpscpeelDASILESLSkhsrestqpriyfNFTNCLKVNGNAYNILAEIKLRLfneknfdtqrgisiclpgsgipdwfsnqssgssitiqlprhccnriFIGFAFSAVIEFqrdsdargeyFHVRCdytfenkhvdhchlvqyltidsdhvilgfqpccdiqppdgdhsAAVSFRFLIEnkkchnekccgvnpvyanpnmtksntfTLKFAASseeectkpriefhdkpsrsgatgnipgsvrrentttlqqqscsssqifhkrggFFSFLIRNEVMLCSVQFFAQTGFR

klealgqfltkskldwKNALknltrisnpniydVLKISYNELKKEEKSIFLDIACFFKGEDKDYMTMIQDYPDYADYGVNFLVDKSLITISCYNKLQMHDLLQEMGQEIVRQEsvrdpskrsrlwhhedvynvlkrnkgtIAIEGIFLDMSKIRDIHLACGTFTSMSNLRLLKFYMPNRDGFSIMSSKVHLDQGLEYLPEELRYLHWYGYPLRTLPSNFDPENLIALNLPYSKVEQIWKGEKYLNVDGSAISHLPSSIADLNKLEDLSFFGCKASVLPRVLSGLSSLKWMELRDCDLIKIPQDIGSLSSLEWFVLSGNNFEHLPASIKKLSRLTYLNLSGCNMLRSLPELPIRLICLDARNCERLRTlqelpscpeELDASILESLskhsrestqPRIYFNFTNCLKVNGNAYNILAEIKLRLFNEKNFDTQRGISICLPGSGIPDWFSNQSSGSSITIQLPRHCCNRIFIGFAFSAVIEFQRDSDARGEYFHVRCDYTFENKHVDHCHLVQYLTIDSDHVILGFQPCCDIQPPDGDHSAAVSFRFLIENKKCHNEKCCGVNPVYANPNMTKSNTFTLKFAASSEEECTKpriefhdkpsrsgatgnipgsvrrENTTTLqqqscsssqifHKRGGFFSFLIRNEVMLCSVQFFAQTGFR

******QFLTKSKLDWKNALKNLTRISNPNIYDVLKISYNELKKEEKSIFLDIACFFKGEDKDYMTMIQDYPDYADYGVNFLVDKSLITISCYNKLQMHDLLQEMG****************RLWHHEDVYNVLKRNKGTIAIEGIFLDMSKIRDIHLACGTFTSMSNLRLLKFYMPNRDGFSIMSSKVHLDQGLEYLPEELRYLHWYGYPLRTLPSNFDPENLIALNLPYSKVEQIWKGEKYLNVDGSAISHLPSSIADLNKLEDLSFFGCKASVLPRVLSGLSSLKWMELRDCDLIKIPQDIGSLSSLEWFVLSGNNFEHLPASIKKLSRLTYLNLSGCNMLRSLPELPIRLICLDARNCERLRTLQEL*************************RIYFNFTNCLKVNGNAYNILAEIKLRLFNEKNFDTQRGISICLPGSGIPDWFSNQSSGSSITIQLPRHCCNRIFIGFAFSAVIEFQRDSDARGEYFHVRCDYTFENKHVDHCHLVQYLTIDSDHVILGFQPCCDIQPPDGDHSAAVSFRFLIENKKCHNEKCCGVNPVYANPNMTKSNTFTLK**************************************************IFHKRGGFFSFLIRNEVMLCSVQFFAQ****

KLEALGQFLTKSKLDWKNALKNLTRISNPNIYDVLKISYNELKKEEKSIFLDIACFFKGEDKDYMTMIQDYPDYADYGVNFLVDKSLITISCYNKLQMHDLLQEMGQEIVRQESVRDPSKRSRLWHHEDVYNVLKRNKGTIAIEGIFLDMSKIRDIHLACGTFTSMSNLRLLKFYMPNRDGFSIMSSKVHLDQGLEYLPEELRYLHWYGYPLRTLPSNFDPENLIALNLPYSKVEQIWKGEKYLNVDGSAISHLPSSIADLNKLEDLSFFGCKASVLPRVLSGLSSLKWMELRDCDLIKIPQDIGSLSSLEWFVLSGNNFEHLPASIKKLSRLTYLNLSGCNMLRSLPELPIRLICLDARNCERLRTLQELPSCPEELDASILESLSKHSRESTQPRIYFNFTNCLKVNGNAYNILAE*KLRLFNEKNFDTQRGISICLPGSGIPDWFSNQSSGSSITIQLPRHCCNRIFIGFAFSAVIEFQRDSDARGEYFHVRCDYTFENKHVDHCHLVQYLTIDSDHVILGFQPCCDIQPPDGDHSAAVSFRFLIENKKCHNEKCCGVNPVY******************************************************************HKRGGFFSFLIRNEVMLCSVQFFAQTGF*

KLEALGQFLTKSKLDWKNALKNLTRISNPNIYDVLKISYNELKKEEKSIFLDIACFFKGEDKDYMTMIQDYPDYADYGVNFLVDKSLITISCYNKLQMHDLLQEMGQEIVR**********SRLWHHEDVYNVLKRNKGTIAIEGIFLDMSKIRDIHLACGTFTSMSNLRLLKFYMPNRDGFSIMSSKVHLDQGLEYLPEELRYLHWYGYPLRTLPSNFDPENLIALNLPYSKVEQIWKGEKYLNVDGSAISHLPSSIADLNKLEDLSFFGCKASVLPRVLSGLSSLKWMELRDCDLIKIPQDIGSLSSLEWFVLSGNNFEHLPASIKKLSRLTYLNLSGCNMLRSLPELPIRLICLDARNCERLRTLQELPSCPEELDASILESLSKHSRESTQPRIYFNFTNCLKVNGNAYNILAEIKLRLFNEKNFDTQRGISICLPGSGIPDWFSNQSSGSSITIQLPRHCCNRIFIGFAFSAVIEFQRDSDARGEYFHVRCDYTFENKHVDHCHLVQYLTIDSDHVILGFQPCCDIQPPDGDHSAAVSFRFLIENKKCHNEKCCGVNPVYANPNMTKSNTFTLKFAASSEEECTKPRIEFHDKPSRSGATGNIPGSVRRE************SQIFHKRGGFFSFLIRNEVMLCSVQFFAQTGFR

KLEALGQFLTKSKLDWKNALKNLTRISNPNIYDVLKISYNELKKEEKSIFLDIACFFKGEDKDYMTMIQDYPDYADYGVNFLVDKSLITISCYNKLQMHDLLQEMGQEIVRQESVRDPSKRSRLWHHEDVYNVLKRNKGTIAIEGIFLDMSKIRDIHLACGTFTSMSNLRLLKFYMPNRDGFSIMSSKVHLDQGLEYLPEELRYLHWYGYPLRTLPSNFDPENLIALNLPYSKVEQIWKGEKYLNVDGSAISHLPSSIADLNKLEDLSFFGCKASVLPRVLSGLSSLKWMELRDCDLIKIPQDIGSLSSLEWFVLSGNNFEHLPASIKKLSRLTYLNLSGCNMLRSLPELPIRLICLDARNCERLRTLQELPSCPEELDASILESLSKHSRESTQPRIYFNFTNCLKVNGNAYNILAEIKLRLFNEKNFDTQRGISICLPGSGIPDWFSNQSSGSSITIQLPRHCCNRIFIGFAFSAVIEFQRDSDARGEYFHVRCDYTFENKHVDHCHLVQYLTIDSDHVILGFQPCCDIQPPDGDHSAAVSFRFLIENKKCHNEKCCGVNPVYANP******************************************S************SCSSSQIFHKRGGFFSFLIRNEVMLCSVQFFAQTGFR

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		660	2.2.26 [Sep-21-2011]
O82500		1095	Putative disease resistan	no	no	0.672	0.405	0.312	3e-51
Q9SZ67		1895	Probable WRKY transcripti	no	no	0.496	0.173	0.387	1e-48
Q9FL92		1372	Probable WRKY transcripti	no	no	0.493	0.237	0.348	3e-41
Q9FH83		1288	Probable WRKY transcripti	no	no	0.536	0.274	0.325	6e-41
Q40392		1144	TMV resistance protein N	N/A	no	0.534	0.308	0.310	2e-39
O23530		1301	Protein SUPPRESSOR OF npr	no	no	0.478	0.242	0.309	2e-33
Q9FKN7		1613	Protein DA1-related 4 OS=	no	no	0.719	0.294	0.262	1e-28
Q9RBS2		1024	Protein PopC OS=Ralstonia	yes	no	0.231	0.149	0.329	2e-10
Q7SXW3		601	Leucine-rich repeat-conta	yes	no	0.183	0.201	0.336	2e-08
B4N9T4		641	Leucine-rich repeat prote	N/A	no	0.168	0.173	0.330	2e-07

>sp\|O82500\|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1	Back alignment and function desciption

 Score =  203 bits (517), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 163/521 (31%), Positives = 253/521 (48%), Gaps = 77/521 (14%)

Query: 2   LEALGQFLT-KSKLDWKNALKNLTRISNPNIYDVLKISYNELKKEEKSIFLDIACFFKGE 60
           L  LG F+  K K +W+ +L  L    +  +  VLK+ Y+ L   EK +FL IAC F G+
Sbjct: 385 LRVLGSFMRGKGKEEWEFSLPTLKSRLDGEVEKVLKVGYDGLHDHEKDLFLHIACIFSGQ 444

Query: 61  DKDYM--TMIQDYPDYADYGVNFLVDKSLITISCYNKLQMHDLLQEMGQEIVRQESVRDP 118
            ++Y+   +I +   Y  +G+  L DKSLI      +++MH LL+++G+E+VR++S+ +P
Sbjct: 445 HENYLKQMIIANNDTYVSFGLQVLADKSLIQKFENGRIEMHSLLRQLGKEVVRKQSIYEP 504

Query: 119 SKRSRLWHHEDVYNVLKRNKGTIAIEGIFLDMSKIR-DIHLACGTFTSMSNLRLLKFYM- 176
            KR  L + ++   VL  N GT  + GI LDM +I+ +++++  TF  M NL  LKFYM 
Sbjct: 505 GKRQFLMNAKETCGVLSNNTGTGTVLGISLDMCEIKEELYISEKTFEEMRNLVYLKFYMS 564

Query: 177 -PNRDGFSIMSSKVHL-DQGLEYLPEELRYLHWYGYPLRTLPSNFDPENLIALNLPYSKV 234
            P  D    M  K+ L ++GL YLP +LR LHW  YPL   PS+F PE L+ LN+ +SK+
Sbjct: 565 SPIDDK---MKVKLQLPEEGLSYLP-QLRLLHWDAYPLEFFPSSFRPECLVELNMSHSKL 620

Query: 235 EQIWKGE------KYLNVDGS------------------------AISHLPSSIADLNKL 264
           +++W G       + +N++ S                        ++  LPSSI +L  L
Sbjct: 621 KKLWSGVQPLRNLRTMNLNSSRNLEILPNLMEATKLNRLDLGWCESLVELPSSIKNLQHL 680

Query: 265 EDLSFFGCKA-SVLPRVLSGLSSLKWMELRDCDLIKIPQDIGSLSSLEWFVLSGNNFEHL 323
             L    CK   ++P  ++ L SL+ +  R C  ++   +I   +++    L G     +
Sbjct: 681 ILLEMSCCKKLEIIPTNIN-LPSLEVLHFRYCTRLQTFPEIS--TNIRLLNLIGTAITEV 737

Query: 324 PASIK-------------KLSRLTY-------LNLSGCNMLRSLPE----LPIRLICLDA 359
           P S+K             K+ RL +       L L     L ++P     LP RL  +D 
Sbjct: 738 PPSVKYWSKIDEICMERAKVKRLVHVPYVLEKLCLRENKELETIPRYLKYLP-RLQMIDI 796

Query: 360 RNCERLRTLQELPSCPEELDASILESLSKHSRESTQPRIYFNFTNCLKVNGNAYNILAEI 419
             C  + +L +LP     L A   ESL           I+ NF NCLK+   A       
Sbjct: 797 SYCINIISLPKLPGSVSALTAVNCESLQILHGHFRNKSIHLNFINCLKLGQRAQE----- 851

Query: 420 KLRLFNEKNFDTQRGISICLPGSGIPDWFSNQSSGSSITIQ 460
             ++           I+  LPG  +P +FS +S+GSSI I 
Sbjct: 852 --KIHRSVYIHQSSYIADVLPGEHVPAYFSYRSTGSSIMIH 890

Arabidopsis thaliana (taxid: 3702)

>sp\|Q9SZ67\|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1	Back alignment and function description

>sp\|Q9FL92\|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1	Back alignment and function description

>sp\|Q9FH83\|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3	Back alignment and function description

>sp\|Q40392\|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1	Back alignment and function description

>sp\|O23530\|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3	Back alignment and function description

>sp\|Q9FKN7\|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2	Back alignment and function description

>sp\|Q9RBS2\|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2	Back alignment and function description

>sp\|Q7SXW3\|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1	Back alignment and function description

>sp\|B4N9T4\|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		660
255537139		1137	leucine-rich repeat-containing protein,	0.824	0.478	0.337	7e-82
255573549		908	ATP binding protein, putative [Ricinus c	0.683	0.496	0.363	5e-78
255563202		1158	leucine-rich repeat containing protein,	0.754	0.430	0.356	6e-78
255564976		944	TMV resistance protein N, putative [Rici	0.75	0.524	0.349	3e-74
255579570		1116	TMV resistance protein N, putative [Rici	0.704	0.416	0.355	4e-73
224145028		709	nbs-lrr resistance protein [Populus tric	0.675	0.629	0.395	4e-73
356554611		1114	PREDICTED: TMV resistance protein N-like	0.784	0.464	0.326	3e-71
255547494		1082	TMV resistance protein N, putative [Rici	0.706	0.430	0.349	5e-71
359495272		1003	PREDICTED: TMV resistance protein N-like	0.809	0.532	0.332	2e-70
147865361		1002	hypothetical protein VITISV_003077 [Viti	0.821	0.540	0.336	1e-69

>gi\|255537139\|ref\|XP_002509636.1\| leucine-rich repeat-containing protein, putative [Ricinus communis] gi\|223549535\|gb\|EEF51023.1\| leucine-rich repeat-containing protein, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  311 bits (797), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 234/693 (33%), Positives = 323/693 (46%), Gaps = 149/693 (21%)

Query: 2    LEALGQFL-TKSKLDWKNALKNLTRISNPNIYDVLKISYNELKKEEKSIFLDIACFFKGE 60
            L+ LG FL  KSK +W++AL  L +  +    +VLKISY+ L  EEK+IFLDIACFF+GE
Sbjct: 384  LKVLGSFLFGKSKTEWESALDKLKKAPHRATQNVLKISYDGLDAEEKNIFLDIACFFRGE 443

Query: 61   DKDYMTMIQDYPDYA-DYGVNFLVDKSLITISCYNKLQMHDLLQEMGQEIVRQESVRDPS 119
              + +T I D   ++   G+  LVDKSLITI   +K++MHDLLQEMG+EIV QES + PS
Sbjct: 444  SVEMVTKILDGCGFSTKIGLCLLVDKSLITI-LNDKVEMHDLLQEMGKEIVLQES-KQPS 501

Query: 120  KRSRLWHHEDVYNVLKRNKGTIAIEGIFLDMSKIRDIHLACGTFTSMSNLRLLKFYMPNR 179
            +R+RLW+HED+ +V  RN GT  IEG+ L+ S I  I L    F  M NLR LKFY    
Sbjct: 502  QRTRLWNHEDILHVFSRNLGTETIEGMCLNTSMINKIELNSNAFGRMYNLRFLKFYQSYI 561

Query: 180  DGFSIMSSKVHLDQGLEYLPEELRYLHWYGYPLRTLPSNFDPENLIALNLPYSKVEQIWK 239
             G     +K+ L QGL+ L  ELRYLHW+GYPL++LP+     NL+ L LPYSKV+++WK
Sbjct: 562  HGGFKECTKIRLPQGLDSLSNELRYLHWHGYPLKSLPARIHLMNLVVLVLPYSKVKRLWK 621

Query: 240  GEK-----------------------------YLNVDG---------------------- 248
            G K                             Y+ + G                      
Sbjct: 622  GCKDLKKLKVIDLSYSQALIRITELTTASNLSYMKLSGCKNLRSMPSTTRWKSLSTLEMN 681

Query: 249  --SAISHLPSSIADLNKLEDLSFFGCK-ASVLPRVLSGLSSLKWMELRDCDLIKIPQDIG 305
              + +  LPSSI  L  LE LS  GC      P +L  +  LK + L    + ++P  I 
Sbjct: 682  YCTKLESLPSSICKLKSLESLSLCGCSNLQSFPEILESMDRLKVLVLNGTAIKELPSSIE 741

Query: 306  SLSSLEWFVLSG-NNFEHLPASIKKLSRLTYLNLSGCNMLRSLPE--------------- 349
             L  L    L    N  HLP S   L  L +L L+ C  L  LPE               
Sbjct: 742  RLKGLSSIYLENCRNLAHLPESFCNLKALYWLFLTFCPKLEKLPEKLSNLTTLEDLSVGV 801

Query: 350  -----LP----------------------------IRLICLDARNCERLRTLQELPSCPE 376
                 LP                            + L CLD  +C RLR+L E+P    
Sbjct: 802  CNLLKLPSHMNHLSCISKLDLSGNYFDQLPSFKYLLNLRCLDISSCRRLRSLPEVPHSLT 861

Query: 377  ELDA---SILESLS--------KHSRESTQPRIYFNFTNCLKVNGNAYN--------ILA 417
            ++DA     LE++S        K++      +I   FT+C K++ +A++         + 
Sbjct: 862  DIDAHDCRSLETISGLKQIFQLKYTHTFYDKKII--FTSCFKMDESAWSDFLADAQFWIQ 919

Query: 418  EIKLRLFNEKNFDTQRGISICLPGSGIPDWFSNQSSGSSITIQLPRHCCNRIFIGFAFSA 477
            ++ +R  +E++F      SI  PGS IP WF  QS GSSI IQL         +GF    
Sbjct: 920  KVAMRAKDEESF------SIWYPGSKIPKWFGYQSEGSSIVIQLHPRSHKHNLLGFTLCV 973

Query: 478  VIEFQRDSDARGEYFHVRCDYTFENKHVDHCHLVQYLT-----------IDSDHVILGFQ 526
            V+ F+ + +    +F V C Y  +N   ++    +  +           + SDHVIL + 
Sbjct: 974  VLAFEDEFEYHNSFFDVLCVYQLKNYRGEYTDCKEVYSSRTHVSGKNKYVGSDHVILFYD 1033

Query: 527  PCCDIQPPDGDHSAAVSFRFLIENKKCHNEKCC 559
            P       +       SF F  +N    NE CC
Sbjct: 1034 PNFSSTEANELSYNEASFEFYWQN----NESCC 1062

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255573549\|ref\|XP_002527699.1\| ATP binding protein, putative [Ricinus communis] gi\|223532930\|gb\|EEF34698.1\| ATP binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|255563202\|ref\|XP_002522604.1\| leucine-rich repeat containing protein, putative [Ricinus communis] gi\|223538080\|gb\|EEF39691.1\| leucine-rich repeat containing protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|255564976\|ref\|XP_002523481.1\| TMV resistance protein N, putative [Ricinus communis] gi\|223537309\|gb\|EEF38940.1\| TMV resistance protein N, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|255579570\|ref\|XP_002530627.1\| TMV resistance protein N, putative [Ricinus communis] gi\|223529837\|gb\|EEF31770.1\| TMV resistance protein N, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224145028\|ref\|XP_002325500.1\| nbs-lrr resistance protein [Populus trichocarpa] gi\|222862375\|gb\|EEE99881.1\| nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356554611\|ref\|XP_003545638.1\| PREDICTED: TMV resistance protein N-like [Glycine max]	Back alignment and taxonomy information

>gi\|255547494\|ref\|XP_002514804.1\| TMV resistance protein N, putative [Ricinus communis] gi\|223545855\|gb\|EEF47358.1\| TMV resistance protein N, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|359495272\|ref\|XP_002276182.2\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147865361\|emb\|CAN84090.1\| hypothetical protein VITISV_003077 [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		660
TAIR\|locus:2175991		1294	AT5G17680 [Arabidopsis thalian	0.537	0.274	0.381	2.6e-56
TAIR\|locus:2118106		1219	AT4G12010 [Arabidopsis thalian	0.546	0.296	0.383	5.4e-55
TAIR\|locus:2081810		1226	AT3G51570 [Arabidopsis thalian	0.604	0.325	0.340	1.8e-52
TAIR\|locus:2122955		1309	AT4G19500 [Arabidopsis thalian	0.548	0.276	0.365	8.3e-52
TAIR\|locus:2153363		1261	AT5G45200 [Arabidopsis thalian	0.65	0.340	0.331	3.3e-51
TAIR\|locus:2118116		1895	WRKY19 [Arabidopsis thaliana (	0.495	0.172	0.401	3.5e-51
TAIR\|locus:2158475		1217	RPS4 "RESISTANT TO P. SYRINGAE	0.621	0.336	0.324	5.9e-50
TAIR\|locus:2146243		900	AT5G18360 [Arabidopsis thalian	0.566	0.415	0.348	4.2e-48
TAIR\|locus:2155189		980	AT5G49140 [Arabidopsis thalian	0.606	0.408	0.344	7.4e-48
TAIR\|locus:2163426		1187	TAO1 "target of AVRB operation	0.554	0.308	0.325	3.6e-47

TAIR\|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 591 (213.1 bits), Expect = 2.6e-56, P = 2.6e-56
 Identities = 146/383 (38%), Positives = 227/383 (59%)

Query:     2 LEALGQFL-TKSKLDWKNALKNLTRISNPNIYDVLKISYNELKKEEKSIFLDIACFFKGE 60
             L  LG FL  +S+++W++ L  L    + +I +VL++SY+ L ++EK+IFL I+CF+  +
Sbjct:   385 LRVLGSFLYRRSQIEWESTLARLKTYPHSDIMEVLRVSYDGLDEQEKAIFLYISCFYNMK 444

Query:    61 DKDYMTMIQDYPDYA-DYGVNFLVDKSLITISCYNKLQMHDLLQEMGQEIVRQESVRDPS 119
               DY+  + D   YA + G+  L +KSLI +     +++HDLL++MG+E+VRQ++V +P+
Sbjct:   445 QVDYVRKLLDLCGYAAEIGITILTEKSLI-VESNGCVKIHDLLEQMGRELVRQQAVNNPA 503

Query:   120 KRSRLWHHEDVYNVLKRNKGTIAIEGIFLDMSKIRDIHLACGTFTSMSNLRLLKFYMPNR 179
             +R  LW  ED+ ++L  N GT  +EGI L++S+I ++  +   F  +SNL+LL FY  + 
Sbjct:   504 QRLLLWDPEDICHLLSENSGTQLVEGISLNLSEISEVFASDRAFEGLSNLKLLNFYDLSF 563

Query:   180 DGFSIMSSKVHLDQGLEYLPEELRYLHWYGYPLRTLPSNFDPENLIALNLPYSKVEQIWK 239
             DG     ++VHL  GL YLP +LRYL W GYPL+T+PS F PE L+ L +  S +E++W 
Sbjct:   564 DG----ETRVHLPNGLSYLPRKLRYLRWDGYPLKTMPSRFFPEFLVELCMSNSNLEKLWD 619

Query:   240 GEKYLN----VDGSAISHLPSSIADLNK---LEDLSFFGCKA--SVLPRVLSGLSSLKWM 290
             G + L     +D S   +L   + DL+K   LE+L+   C++   V P +   L  L   
Sbjct:   620 GIQPLRNLKKMDLSRCKYLVE-VPDLSKATNLEELNLSYCQSLVEVTPSI-KNLKGLSCF 677

Query:   291 ELRDCDLIK-IPQDIGSLSSLEWFVLSG-NNFEHLPASIKKLSRLTYLNLSGCNMLRSLP 348
              L +C  +K IP  I  L SLE   +SG ++ +H P  I   +R  YL+ +    +  LP
Sbjct:   678 YLTNCIQLKDIPIGI-ILKSLETVGMSGCSSLKHFP-EISWNTRRLYLSST---KIEELP 732

Query:   349 ELPIRLICL---DARNCERLRTL 368
                 RL CL   D  +C+RLRTL
Sbjct:   733 SSISRLSCLVKLDMSDCQRLRTL 755

GO:0005622 "intracellular" evidence=IEA

GO:0006952 "defense response" evidence=IEA;ISS

GO:0007165 "signal transduction" evidence=IEA

GO:0043531 "ADP binding" evidence=IEA

TAIR\|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2081810 AT3G51570 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2122955 AT4G19500 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2118116 WRKY19 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2158475 RPS4 "RESISTANT TO P. SYRINGAE 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2146243 AT5G18360 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2155189 AT5G49140 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00013803001	SubName- Full=Chromosome undetermined scaffold_100, whole genome shotgun sequence; (1064 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		660
PLN03210		1153	PLN03210, PLN03210, Resistant to P	3e-55
PLN03210		1153	PLN03210, PLN03210, Resistant to P	4e-16
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	1e-09
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	3e-07
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	8e-07
pfam00931		285	pfam00931, NB-ARC, NB-ARC domain	3e-05
PRK15370		754	PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl	4e-05
PRK15387		788	PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss	1e-04
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	3e-04
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	0.003

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

 Score =  203 bits (519), Expect = 3e-55
 Identities = 137/379 (36%), Positives = 200/379 (52%), Gaps = 35/379 (9%)

Query: 2   LEALGQFLT-KSKLDWKNALKNLTRISNPNIYDVLKISYNELK-KEEKSIFLDIACFFKG 59
           L  LG +L  + K DW + L  L    +  I   L++SY+ L  K++K+IF  IAC F G
Sbjct: 392 LNVLGSYLRGRDKEDWMDMLPRLRNGLDGKIEKTLRVSYDGLNNKKDKAIFRHIACLFNG 451

Query: 60  ED-KDYMTMIQDYPDYADYGVNFLVDKSLITISCYNKLQMHDLLQEMGQEIVRQESVRDP 118
           E   D   ++ +     + G+  LVDKSLI +   + ++MH LLQEMG+EIVR +S  +P
Sbjct: 452 EKVNDIKLLLANSDLDVNIGLKNLVDKSLIHVR-EDIVEMHSLLQEMGKEIVRAQS-NEP 509

Query: 119 SKRSRLWHHEDVYNVLKRNKGTIAIEGIFLDMSKIRDIHLACGTFTSMSNLRLLKFYMPN 178
            +R  L   +D+ +VL+ N GT  + GI LD+ +I ++H+    F  M NL  LKFY   
Sbjct: 510 GEREFLVDAKDICDVLEDNTGTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKK 569

Query: 179 RDGFSIMSSKV--HLDQGLEYLPEELRYLHWYGYPLRTLPSNFDPENLIALNLPYSKVEQ 236
            D       +V  HL +G +YLP +LR L W  YPLR +PSNF PENL+ L +  SK+E+
Sbjct: 570 WD----QKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEK 625

Query: 237 IWKGEKYLNVDGSAISHLPSSIADLNKLEDLSFFGCKASVLPRVLSGLSSLKWMELRDC- 295
           +W G                 +  L  L ++   G K       LS  ++L+ ++L DC 
Sbjct: 626 LWDG-----------------VHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCS 668

Query: 296 DLIKIPQDIGSLSSLEWFVLSG-NNFEHLPASIKKLSRLTYLNLSGCNMLRSLPELPIRL 354
            L+++P  I  L+ LE   +S   N E LP  I  L  L  LNLSGC+ L+S P++   +
Sbjct: 669 SLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDISTNI 727

Query: 355 ICLDARNCERLRTLQELPS 373
             LD         ++E PS
Sbjct: 728 SWLDLDET----AIEEFPS 742

syringae 6; Provisional. Length = 1153

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|216202 pfam00931, NB-ARC, NB-ARC domain	Back alignment and domain information

>gnl\|CDD\|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>gnl\|CDD\|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		660
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.97
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.76
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.75
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.69
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.68
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.61
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.6
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.57
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.53
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.52
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.51
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.51
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.51
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.51
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.5
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.47
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.4
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	99.28
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.26
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.22
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	99.07
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.05
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	99.04
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	99.02
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.0
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.95
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.93
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.91
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.88
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.83
KOG4237		498	consensus Extracellular matrix protein slit, conta	98.79
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.75
PLN03150		623	hypothetical protein; Provisional	98.66
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	98.63
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	98.61
PRK15386		426	type III secretion protein GogB; Provisional	98.54
PRK15386		426	type III secretion protein GogB; Provisional	98.54
PLN03150		623	hypothetical protein; Provisional	98.5
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	98.43
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.26
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.24
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.24
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.2
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.14
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.07
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	98.02
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.99
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.75
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.73
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.7
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.58
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.57
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.32
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.14
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.09
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.08
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.03
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.84
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.65
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	96.56
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.99
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	95.66
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.34
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	95.33
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	94.24
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	94.01
KOG0473		326	consensus Leucine-rich repeat protein [Function un	93.67
PF07725		20	LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Le	92.1
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	91.28
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	90.97
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	89.47
KOG0473		326	consensus Leucine-rich repeat protein [Function un	87.95
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	86.93
smart00370		26	LRR Leucine-rich repeats, outliers.	84.36
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	84.36
smart00370		26	LRR Leucine-rich repeats, outliers.	83.92
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	83.92
KOG4308		478	consensus LRR-containing protein [Function unknown	83.73
KOG1947		482	consensus Leucine rich repeat proteins, some prote	80.31

>PLN03210 Resistant to P	Back alignment and domain information

Probab=100.00  E-value=1.2e-62  Score=595.11  Aligned_cols=548  Identities=31%  Similarity=0.548  Sum_probs=397.3

Q ss_pred             CeeeecccccCC-HHHHHHHHHHHhcCCCchhhhhhhccccccch-hhhceeeeeecCCCCCCHHHHHHHhcCCCC-ccc
Q 039656            1 KLEALGQFLTKS-KLDWKNALKNLTRISNPNIYDVLKISYNELKK-EEKSIFLDIACFFKGEDKDYMTMIQDYPDY-ADY   77 (660)
Q Consensus         1 AlkvlG~~L~~k-~~eW~~~l~~l~~~~~~~I~~~LklSYd~Lp~-~lK~cFLy~a~Fp~~~~~~~l~~iw~a~gf-~~~   77 (660)
                      ||+|+|+.|++| .++|++++++|++.++.+|+++|++|||+|++ .+|.||+||||||++++++++..++.++|+ ++.
T Consensus       391 Al~vlgs~L~~k~~~~W~~~l~~L~~~~~~~I~~~L~~SYd~L~~~~~k~~Fl~ia~ff~~~~~~~v~~~l~~~~~~~~~  470 (1153)
T PLN03210        391 GLNVLGSYLRGRDKEDWMDMLPRLRNGLDGKIEKTLRVSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNI  470 (1153)
T ss_pred             HHHHHHHHHcCCCHHHHHHHHHHHHhCccHHHHHHHHHhhhccCccchhhhhheehhhcCCCCHHHHHHHHHhcCCCchh
Confidence            789999999999 99999999999998889999999999999987 489999999999999999999999988888 888


Q ss_pred             cchhhhcCCCEEEecCCeEeecHHHHHHHHHHHhhhccCCCCCcccccCchhHHHHhhcCcCCCcEEEEEeecCCCeeee
Q 039656           78 GVNFLVDKSLITISCYNKLQMHDLLQEMGQEIVRQESVRDPSKRSRLWHHEDVYNVLKRNKGTIAIEGIFLDMSKIRDIH  157 (660)
Q Consensus        78 ~i~~Li~rsLi~~~~~~~~~MHDLl~d~~~~i~~~e~~~~p~~~~rL~~~~di~~vl~~~~~~~~v~~i~l~~s~~~~~~  157 (660)
                      +++.|++||||++. .++++||||+|+||++++++++ .+|++++|+|+++|+++++..++|++.+++|.++.+.+.++.
T Consensus       471 ~l~~L~~ksLi~~~-~~~~~MHdLl~~~~r~i~~~~~-~~~~~r~~l~~~~di~~vl~~~~g~~~v~~i~l~~~~~~~~~  548 (1153)
T PLN03210        471 GLKNLVDKSLIHVR-EDIVEMHSLLQEMGKEIVRAQS-NEPGEREFLVDAKDICDVLEDNTGTKKVLGITLDIDEIDELH  548 (1153)
T ss_pred             ChHHHHhcCCEEEc-CCeEEhhhHHHHHHHHHHHhhc-CCCCcceeEeCHHHHHHHHHhCcccceeeEEEeccCccceee
Confidence            99999999999998 7899999999999999999998 789999999999999999999999999999999999999999


Q ss_pred             cCcccccCCCCccEEEEecCCCCCcccCCcceecCCccccCCcCceEEEeeCCCCCCCCCCCCCCCceEEeCCCCCCccc
Q 039656          158 LACGTFTSMSNLRLLKFYMPNRDGFSIMSSKVHLDQGLEYLPEELRYLHWYGYPLRTLPSNFDPENLIALNLPYSKVEQI  237 (660)
Q Consensus       158 l~~~~f~~l~~Lr~L~l~~n~~~~~~~~~~~~~lp~~l~~l~~~Lr~L~l~~~~l~~lP~~~~l~~L~~L~L~~n~l~~l  237 (660)
                      +...+|.+|++|++|.++.+....  ......++|.++..+|.+||+|+|.+|+++.+|..+.+.+|+.|+|++|+++.+
T Consensus       549 i~~~aF~~m~~L~~L~~~~~~~~~--~~~~~~~lp~~~~~lp~~Lr~L~~~~~~l~~lP~~f~~~~L~~L~L~~s~l~~L  626 (1153)
T PLN03210        549 IHENAFKGMRNLLFLKFYTKKWDQ--KKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKL  626 (1153)
T ss_pred             ecHHHHhcCccccEEEEecccccc--cccceeecCcchhhcCcccEEEEecCCCCCCCCCcCCccCCcEEECcCcccccc
Confidence            999999999999999998775421  112346789999999989999999999999999999999999999999999888


Q ss_pred             cC------CCeeecCCCC-CCcccCccccCCCCCcEEEecCCC-CcCCCCCCCCCCCCCEEEccCCC-CCCCCcccCCC-
Q 039656          238 WK------GEKYLNVDGS-AISHLPSSIADLNKLEDLSFFGCK-ASVLPRVLSGLSSLKWMELRDCD-LIKIPQDIGSL-  307 (660)
Q Consensus       238 ~~------~l~~L~l~~~-~l~~lp~si~~L~~L~~L~l~~~~-~~~lp~~l~~L~~L~~L~Ls~~~-l~~lp~~l~~l-  307 (660)
                      |.      +++.|+++++ .++.+|. ++.+++|++|++++|. +..+|..+.++++|+.|++++|. +..+|..+ ++ 
T Consensus       627 ~~~~~~l~~Lk~L~Ls~~~~l~~ip~-ls~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c~~L~~Lp~~i-~l~  704 (1153)
T PLN03210        627 WDGVHSLTGLRNIDLRGSKNLKEIPD-LSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGI-NLK  704 (1153)
T ss_pred             ccccccCCCCCEEECCCCCCcCcCCc-cccCCcccEEEecCCCCccccchhhhccCCCCEEeCCCCCCcCccCCcC-CCC
Confidence            75      3466666543 3455553 5555666666666554 44455555555555555554442 22233221 11 


Q ss_pred             -------------------------------------------------------------------------cccCccc
Q 039656          308 -------------------------------------------------------------------------SSLEWFV  314 (660)
Q Consensus       308 -------------------------------------------------------------------------~~L~~L~  314 (660)
                                                                                               ++|+.|+
T Consensus       705 sL~~L~Lsgc~~L~~~p~~~~nL~~L~L~~n~i~~lP~~~~l~~L~~L~l~~~~~~~l~~~~~~l~~~~~~~~~sL~~L~  784 (1153)
T PLN03210        705 SLYRLNLSGCSRLKSFPDISTNISWLDLDETAIEEFPSNLRLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLF  784 (1153)
T ss_pred             CCCEEeCCCCCCccccccccCCcCeeecCCCccccccccccccccccccccccchhhccccccccchhhhhccccchhee
Confidence                                                                                     2445555


Q ss_pred             ccccc-ceecchhhhcCCCCCeecccCccCCCCCCCC--CcCCcEEecccCcCCcccCCCCCCCcccc--hh----HH--
Q 039656          315 LSGNN-FEHLPASIKKLSRLTYLNLSGCNMLRSLPEL--PIRLICLDARNCERLRTLQELPSCPEELD--AS----IL--  383 (660)
Q Consensus       315 L~~n~-l~~lp~~i~~l~~L~~L~L~~c~~l~~lp~~--~~~L~~L~l~~c~~L~~l~~~~~~~~~l~--~~----~~--  383 (660)
                      |++|. +..+|.+++++++|+.|+|++|+.++.+|..  +++|+.|++++|..|+.++..+..+..|.  ..    .+  
T Consensus       785 Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~~~~L~sL~~L~Ls~c~~L~~~p~~~~nL~~L~Ls~n~i~~iP~s  864 (1153)
T PLN03210        785 LSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGINLESLESLDLSGCSRLRTFPDISTNISDLNLSRTGIEEVPWW  864 (1153)
T ss_pred             CCCCCCccccChhhhCCCCCCEEECCCCCCcCeeCCCCCccccCEEECCCCCccccccccccccCEeECCCCCCccChHH
Confidence            55443 3367888888999999999999888888865  67888888888888776654432221110  00    00  


Q ss_pred             ----hhhhcccCC-------------CCCCCeEEe-------------------------------------ecCCcccC
Q 039656          384 ----ESLSKHSRE-------------STQPRIYFN-------------------------------------FTNCLKVN  409 (660)
Q Consensus       384 ----~~l~~~~~~-------------~~~~~~~~~-------------------------------------~~nC~~L~  409 (660)
                          ..|....+.             ....+..+.                                     |.||++|+
T Consensus       865 i~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L~~~~l~~~~~~~~~~~~n~~~~~p~~~~l~f~nC~~L~  944 (1153)
T PLN03210        865 IEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWNGSPSEVAMATDNIHSKLPSTVCINFINCFNLD  944 (1153)
T ss_pred             HhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCCcccccccCCCCchhhhhhcccccccCCchhccccccccCCC
Confidence                000000000             001112233                                     44555554


Q ss_pred             hhHHHHHHHHHHHHhhccCCCCcCcceeecCCCCCCCCccccCCCceEE-EeCCCCCCcCcccceEEEEEEeeccCCC-C
Q 039656          410 GNAYNILAEIKLRLFNEKNFDTQRGISICLPGSGIPDWFSNQSSGSSIT-IQLPRHCCNRIFIGFAFSAVIEFQRDSD-A  487 (660)
Q Consensus       410 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~pg~~iP~Wf~~q~~g~si~-i~lp~~~~~~~~~gf~~c~v~~~~~~~~-~  487 (660)
                      +.+.  +   +     .+    .....+++||.++|+||.||+.|++++ |++|+.|+...|.||++|+|+++..... .
T Consensus       945 ~~a~--l---~-----~~----~~~~~~~l~g~evp~~f~hr~~g~sl~~i~l~~~~~~~~~~~f~~c~v~~~~~~~~~~ 1010 (1153)
T PLN03210        945 QEAL--L---Q-----QQ----SIFKQLILSGEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRACAVVDSESFFIIS 1010 (1153)
T ss_pred             chhh--h---c-----cc----ccceEEECCCccCchhccCCcccceeeeeccCCcccCCCccceEEEEEEecCccccCC
Confidence            4331  0   0     00    112347899999999999999999998 9999999988899999999998876432 2


Q ss_pred             CCceEEEEEEEeecCCceee--EEEeec-cCCCCCeEEEccccCCC----CC-CCCCCCCceEEEEEEEeecCCC-eeee
Q 039656          488 RGEYFHVRCDYTFENKHVDH--CHLVQY-LTIDSDHVILGFQPCCD----IQ-PPDGDHSAAVSFRFLIENKKCH-NEKC  558 (660)
Q Consensus       488 ~~~~~~~~~~~~~~~~~~~~--~~~~~~-~~~~sdh~~l~~~~~~~----~~-~~~~~~~~~~~f~f~~~~~~~~-~vk~  558 (660)
                      ....+.|.|.|....|....  +..+.+ .....+|+++ |+....    .. .....+++ |+++|.+.+.... +||+
T Consensus      1011 ~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~-~~~~~~~~~~~~~~~~~~~~~-~~~~f~~~~~~~~~~~~~ 1088 (1153)
T PLN03210       1011 VSFDIQVCCRFIDRLGNHFDSPYQPHVFSVTKKGSHLVI-FDCCFPLNEDNAPLAELNYDH-VDIQFRLTNKNSQLKLKG 1088 (1153)
T ss_pred             CceeEEEEEEEECCCCCccccCCCceeEeeeccccceEE-ecccccccccccchhccCCce-eeEEEEEecCCCCeEEEe
Confidence            35678888887655443111  000011 0123445554 121100    00 11234566 8888888664444 8999


Q ss_pred             eeeEEEecCCCC
Q 039656          559 CGVNPVYANPNM  570 (660)
Q Consensus       559 cGv~lvy~~~~~  570 (660)
                      |||+++|+.+.-
T Consensus      1089 cg~~~~~~~~~~ 1100 (1153)
T PLN03210       1089 CGIRLSEDDSSL 1100 (1153)
T ss_pred             eeEEEeccCCCc
Confidence            999999987744

syringae 6; Provisional

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF07725 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		660
4fcg_A		328	Structure Of The Leucine-Rich Repeat Domain Of The		1e-06

>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328

Back alignment and structure

Iteration: 1

Score = 52.0 bits (123), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 42/148 (28%), Positives = 73/148 (49%), Gaps = 17/148 (11%) Query: 236 QIWKGEKYLNVDGSAISHLPSSIADLNKLEDLSFFGC-KASVLPRVLS---------GLS 285 Q + G + L + + + LP+SIA LN+L +LS C + + LP L+ GL Sbjct: 124 QQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLV 183 Query: 286 SLKWMELRDCDLIKIPQDIGSLSSLEWFVLSGNNFEHLPASIKKLSRLTYLNLSGCNMLR 345 +L+ + L + +P I +L +L+ + + L +I L +L L+L GC LR Sbjct: 184 NLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALR 243 Query: 346 SLPEL-----PIRLICLDARNCERLRTL 368 + P + P++ + L ++C L TL Sbjct: 244 NYPPIFGGRAPLKRLIL--KDCSNLLTL 269

PyMOL of 4fcg

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		660
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	5e-29
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	7e-29
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-24
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-04
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-24
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-17
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-17
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-18
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-15
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-15
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	8e-09
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-05
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	9e-16
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	3e-12
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-15
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-15
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-15
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	8e-15
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	6e-07
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	8e-05
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	7e-15
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-13
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-10
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	4e-05
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	1e-14
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	5e-11
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	6e-14
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	3e-09
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	6e-04
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-13
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	6e-10
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-07
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-07
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	4e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-04
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-13
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-12
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	6e-10
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-13
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-10
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-08
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-13
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-11
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	8e-10
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	9e-10
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	5e-09
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-08
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-07
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	8e-07
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	9e-07
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	9e-07
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	6e-06
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	4e-13
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-13
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-11
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	5e-11
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	8e-10
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-06
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	9e-13
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	6e-12
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	1e-12
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	9e-11
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	1e-12
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	9e-07
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	5e-05
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-12
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-10
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-10
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-08
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	9e-05
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-12
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-09
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-12
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-11
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	5e-11
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	7e-07
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	7e-06
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	5e-12
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	7e-10
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	7e-12
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	6e-11
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	5e-10
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	7e-12
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	2e-10
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	4e-07
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-11
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-11
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-08
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-07
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	6e-06
1o6v_A		466	Internalin A; bacterial infection, extracellular r	3e-11
1o6v_A		466	Internalin A; bacterial infection, extracellular r	9e-10
1o6v_A		466	Internalin A; bacterial infection, extracellular r	3e-06
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	4e-11
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	1e-07
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	2e-07
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	8e-05
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	5e-11
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-10
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	5e-11
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-10
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	4e-08
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-10
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	7e-10
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-09
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-09
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	4e-10
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-08
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	3e-08
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-06
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	6e-06
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	9e-10
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	9e-07
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	2e-09
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	1e-08
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	4e-09
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	9e-09
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	8e-07
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	9e-09
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	8e-06
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-08
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	7e-04
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	1e-08
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	2e-08
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	7e-07
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	7e-07
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	3e-06
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	2e-05
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	2e-08
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-08
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	1e-07
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	1e-07
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-08
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-07
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-05
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	4e-08
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	5e-08
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	4e-04
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	9e-08
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	1e-04
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	1e-07
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	8e-06
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	2e-07
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	7e-05
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	3e-07
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	3e-04
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	7e-07
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-06
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-05
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	4e-06
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	7e-06
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	1e-05
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	7e-05
3m19_A		251	Variable lymphocyte receptor A diversity region; a	9e-05
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	1e-04
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	1e-04
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	1e-04
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	1e-04
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	3e-04
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	6e-04

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

 Score =  117 bits (295), Expect = 5e-29
 Identities = 49/252 (19%), Positives = 91/252 (36%), Gaps = 43/252 (17%)

Query: 163 FTSMSNLRLLKFYMPNRDGFSIMSSKVHLDQ-------GLEYLPEE--------LRYLHW 207
              +S  +       NR   +   +  +  Q        L+   +            L  
Sbjct: 29  HDVLSQWQRHYNADRNRWHSAWRQANSNNPQIETRTGRALKATADLLEDATQPGRVALEL 88

Query: 208 YGYPLRTLPSN-FDPENLIALNLPYSKVEQIWK--GE----KYLNVDGSAISHLPSSIAD 260
              PL   P   F   +L  + +  + + ++     +    + L +  + +  LP+SIA 
Sbjct: 89  RSVPLPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQFAGLETLTLARNPLRALPASIAS 148

Query: 261 LNKLEDLSFFGCK----------ASVLPRVLSGLSSLKWMELRDCDLIKIPQDIGSLSSL 310
           LN+L +LS   C           ++       GL +L+ + L    +  +P  I +L +L
Sbjct: 149 LNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNL 208

Query: 311 EWFVLSGNNFEHLPASIKKLSRLTYLNLSGCNMLRSLPE----LPIRLICLDARNCERLR 366
           +   +  +    L  +I  L +L  L+L GC  LR+ P         L  L  ++C  L 
Sbjct: 209 KSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRA-PLKRLILKDCSNLL 267

Query: 367 TLQELPSCPEEL 378
           TL      P ++
Sbjct: 268 TL------PLDI 273

PyMOL of 4fcg

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		660
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.86
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.86
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.82
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.81
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.81
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.8
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.8
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.8
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.79
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.79
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.79
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.78
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.78
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.78
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.78
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.77
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.77
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.76
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.76
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.76
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.75
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.75
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.75
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.75
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.75
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.75
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.75
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.75
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.74
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.74
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.74
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.74
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.73
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.73
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.73
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.73
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.73
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.73
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.72
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.72
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.72
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.72
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.72
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.71
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.71
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.71
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.71
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.71
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.71
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.71
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.71
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.71
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.71
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.71
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.7
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.7
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.7
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.7
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.69
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.69
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.69
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.68
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.68
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.68
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.67
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.67
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.67
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.67
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.67
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.67
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.66
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.66
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.66
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.65
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.65
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.65
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.65
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.65
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.65
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.64
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.64
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.63
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.63
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.63
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.62
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.62
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.61
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.61
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.61
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.59
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.57
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.57
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.57
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.56
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.56
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.55
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.55
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.55
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.54
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.54
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.53
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.5
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.49
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.49
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.48
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.48
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.48
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.47
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.46
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.46
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.46
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.45
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.44
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.44
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.44
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.43
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.43
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	99.42
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.42
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.4
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.39
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.36
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.35
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.33
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.33
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.32
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.32
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.32
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.25
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.22
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.21
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.2
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.18
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.18
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.18
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	99.14
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	99.1
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.02
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.01
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.92
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	98.9
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	98.86
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.85
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.81
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.78
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	98.72
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.71
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.66
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.56
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.44
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.35
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.95
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.81
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.7
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.6
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.51
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.34
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.21
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	96.89
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	96.65
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	96.5
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	96.21
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	95.86
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	95.35
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	95.29
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	94.64
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	94.62
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	93.1

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

Probab=99.86  E-value=1.3e-21  Score=205.94  Aligned_cols=200  Identities=24%  Similarity=0.350  Sum_probs=149.8

Q ss_pred             CCcEEEEEeecCCCeeeecCcccccCCCCccEEEEecCCCCCcccCCcceecCCccccCCcCceEEEeeCCCCCCCCCCC
Q 039656          140 TIAIEGIFLDMSKIRDIHLACGTFTSMSNLRLLKFYMPNRDGFSIMSSKVHLDQGLEYLPEELRYLHWYGYPLRTLPSNF  219 (660)
Q Consensus       140 ~~~v~~i~l~~s~~~~~~l~~~~f~~l~~Lr~L~l~~n~~~~~~~~~~~~~lp~~l~~l~~~Lr~L~l~~~~l~~lP~~~  219 (660)
                      ...++.+.+....+.  .++ ..+.++++|++|++++|.+.         .+|..+..++ +|++|++++|.+..+|..+
T Consensus        80 ~~~l~~L~L~~n~l~--~lp-~~l~~l~~L~~L~L~~n~l~---------~lp~~~~~l~-~L~~L~Ls~n~l~~lp~~l  146 (328)
T 4fcg_A           80 QPGRVALELRSVPLP--QFP-DQAFRLSHLQHMTIDAAGLM---------ELPDTMQQFA-GLETLTLARNPLRALPASI  146 (328)
T ss_dssp             STTCCEEEEESSCCS--SCC-SCGGGGTTCSEEEEESSCCC---------CCCSCGGGGT-TCSEEEEESCCCCCCCGGG
T ss_pred             ccceeEEEccCCCch--hcC-hhhhhCCCCCEEECCCCCcc---------chhHHHhccC-CCCEEECCCCccccCcHHH
Confidence            345667777666664  333 34667999999999999873         6788888888 8999999999999999888


Q ss_pred             -CCCCceEEeCCCCCCc-cc---------------cCCCeeecCCCCCCcccCccccCCCCCcEEEecCCCCcCCCCCCC
Q 039656          220 -DPENLIALNLPYSKVE-QI---------------WKGEKYLNVDGSAISHLPSSIADLNKLEDLSFFGCKASVLPRVLS  282 (660)
Q Consensus       220 -~l~~L~~L~L~~n~l~-~l---------------~~~l~~L~l~~~~l~~lp~si~~L~~L~~L~l~~~~~~~lp~~l~  282 (660)
                       .+++|++|++++|++. .+               .+.++.|++++|.++.+|.+++++++|++|++++|.+..+|..+.
T Consensus       147 ~~l~~L~~L~L~~n~~~~~~p~~~~~~~~~~~~~~l~~L~~L~L~~n~l~~lp~~l~~l~~L~~L~L~~N~l~~l~~~l~  226 (328)
T 4fcg_A          147 ASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIH  226 (328)
T ss_dssp             GGCTTCCEEEEEEETTCCCCCSCSEEEC-CCCEEESTTCCEEEEEEECCCCCCGGGGGCTTCCEEEEESSCCCCCCGGGG
T ss_pred             hcCcCCCEEECCCCCCccccChhHhhccchhhhccCCCCCEEECcCCCcCcchHhhcCCCCCCEEEccCCCCCcCchhhc
Confidence             8999999999986543 33               345667777777777777777777777777777777777777777


Q ss_pred             CCCCCCEEEccCCCCCC-CCcccCCCcccCccccccccce-ecchhhhcCCCCCeecccCccCCCCCCCCCc
Q 039656          283 GLSSLKWMELRDCDLIK-IPQDIGSLSSLEWFVLSGNNFE-HLPASIKKLSRLTYLNLSGCNMLRSLPELPI  352 (660)
Q Consensus       283 ~L~~L~~L~Ls~~~l~~-lp~~l~~l~~L~~L~L~~n~l~-~lp~~i~~l~~L~~L~L~~c~~l~~lp~~~~  352 (660)
                      .+++|++|+|++|.+.+ +|..++.+++|++|+|++|++. .+|..+..+++|+.|+|++|+.++.+|+.+.
T Consensus       227 ~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~iP~~l~  298 (328)
T 4fcg_A          227 HLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIA  298 (328)
T ss_dssp             GCTTCCEEECTTCTTCCBCCCCTTCCCCCCEEECTTCTTCCBCCTTGGGCTTCCEEECTTCTTCCCCCGGGG
T ss_pred             cCCCCCEEECcCCcchhhhHHHhcCCCCCCEEECCCCCchhhcchhhhcCCCCCEEeCCCCCchhhccHHHh
Confidence            77777777777776665 6777777777777777776554 6777777777777777777777777776533

PyMOL of 4fcg

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		660
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	2e-07
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	1e-06
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	2e-04
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	3e-07
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	1e-06
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	9e-05
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	4e-06
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	5e-06
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	3e-05
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	2e-04
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	2e-04
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	0.001
d2ca6a1		344	c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom	5e-04
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	0.001
d1h6ta2		210	c.10.2.1 (A:31-240) Internalin B {Listeria monocyt	0.001
d1xwdc1		242	c.10.2.7 (C:18-259) Follicle-stimulating hormone r	0.001

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Leucine rich effector protein YopM
domain: Leucine rich effector protein YopM
species: Yersinia pestis [TaxId: 632]

 Score = 51.0 bits (120), Expect = 2e-07
 Identities = 26/90 (28%), Positives = 33/90 (36%), Gaps = 8/90 (8%)

Query: 289 WMELRDCDLIKIPQDIGSLSSLEWFVLSGNNFEHLPASIKKLSRLTYLNLSGCNMLRSLP 348
            +   +    +I        SLE   +S N    LPA      RL  L  S  N L  +P
Sbjct: 265 NLYYLNASSNEIRSLCDLPPSLEELNVSNNKLIELPALP---PRLERLIAS-FNHLAEVP 320

Query: 349 ELPIRLICLDARNCERLRTLQELPSCPEEL 378
           ELP  L  L          L+E P  PE +
Sbjct: 321 ELPQNLKQLHVEYNP----LREFPDIPESV 346

PyMOL of d1jl5a_

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		660
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.77
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.69
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.68
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.68
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.62
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.62
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.6
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.6
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.59
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.59
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.58
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.56
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.56
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.56
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.52
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.52
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.51
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.5
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.4
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.39
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.38
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.38
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.36
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.3
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.24
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.21
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.08
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	98.96
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.95
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.94
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.76
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	98.72
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.68
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.63
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.58
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.79
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.72
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	97.62
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.68
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	95.88
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.74
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	93.51

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.77  E-value=1e-18  Score=179.72  Aligned_cols=220  Identities=18%  Similarity=0.184  Sum_probs=168.2

Q ss_pred             CCCcEEEEEeecCCCeeeecCcccccCCCCccEEEEec-CCCCCcccCCcceecCCccccCCcCceEEEeeCCCCCCCCC
Q 039656          139 GTIAIEGIFLDMSKIRDIHLACGTFTSMSNLRLLKFYM-PNRDGFSIMSSKVHLDQGLEYLPEELRYLHWYGYPLRTLPS  217 (660)
Q Consensus       139 ~~~~v~~i~l~~s~~~~~~l~~~~f~~l~~Lr~L~l~~-n~~~~~~~~~~~~~lp~~l~~l~~~Lr~L~l~~~~l~~lP~  217 (660)
                      ++.+|..+.+....+....--+..+.++++|++|+|++ |.+.|        .+|..+..++ +|++|++++|.+..++.
T Consensus        48 ~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g--------~iP~~i~~L~-~L~~L~Ls~N~l~~~~~  118 (313)
T d1ogqa_          48 QTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVG--------PIPPAIAKLT-QLHYLYITHTNVSGAIP  118 (313)
T ss_dssp             SCCCEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEES--------CCCGGGGGCT-TCSEEEEEEECCEEECC
T ss_pred             CcEEEEEEECCCCCCCCCCCCChHHhcCcccccccccccccccc--------cccccccccc-ccchhhhcccccccccc
Confidence            34467877777665543322346789999999999986 66542        6899999998 99999999999976654


Q ss_pred             C-C-CCCCceEEeCCCCCCccc-------cCCCeeecCCCCCCc-ccCccccCCCCC-cEEEecCCCCcC----------
Q 039656          218 N-F-DPENLIALNLPYSKVEQI-------WKGEKYLNVDGSAIS-HLPSSIADLNKL-EDLSFFGCKASV----------  276 (660)
Q Consensus       218 ~-~-~l~~L~~L~L~~n~l~~l-------~~~l~~L~l~~~~l~-~lp~si~~L~~L-~~L~l~~~~~~~----------  276 (660)
                      . + .+.+|+.+++++|.+...       .+.++.+++++|.+. .+|..+..+.+| +.+++++|++..          
T Consensus       119 ~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~  198 (313)
T d1ogqa_         119 DFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN  198 (313)
T ss_dssp             GGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCC
T ss_pred             ccccchhhhcccccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccc
Confidence            4 4 788899999988876543       235577888888887 678877777775 677777765432          


Q ss_pred             --------------CCCCCCCCCCCCEEEccCCCCCCCCcccCCCcccCccccccccce-ecchhhhcCCCCCeecccCc
Q 039656          277 --------------LPRVLSGLSSLKWMELRDCDLIKIPQDIGSLSSLEWFVLSGNNFE-HLPASIKKLSRLTYLNLSGC  341 (660)
Q Consensus       277 --------------lp~~l~~L~~L~~L~Ls~~~l~~lp~~l~~l~~L~~L~L~~n~l~-~lp~~i~~l~~L~~L~L~~c  341 (660)
                                    +|..+..+++|+.|++++|.+...++.++.+++|+.|+|++|+++ .+|.+++++++|++|+|++|
T Consensus       199 ~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N  278 (313)
T d1ogqa_         199 LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFN  278 (313)
T ss_dssp             CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGGGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSS
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccccccccCccCeecccCChHHhCCCCCCEEECcCC
Confidence                          455567788899999999988887778888999999999999998 89999999999999999999


Q ss_pred             cCCCCCCCC--CcCCcEEecccCcCCcc
Q 039656          342 NMLRSLPEL--PIRLICLDARNCERLRT  367 (660)
Q Consensus       342 ~~l~~lp~~--~~~L~~L~l~~c~~L~~  367 (660)
                      +..+.+|+.  +.+|+.+++.++..|..
T Consensus       279 ~l~g~iP~~~~L~~L~~l~l~~N~~l~g  306 (313)
T d1ogqa_         279 NLCGEIPQGGNLQRFDVSAYANNKCLCG  306 (313)
T ss_dssp             EEEEECCCSTTGGGSCGGGTCSSSEEES
T ss_pred             cccccCCCcccCCCCCHHHhCCCccccC
Confidence            888888875  45666666666554443

PyMOL of d1ogqa_

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure