Citrus Sinensis ID: 039679

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230

MWYLCVFFHRLLDYRKPEVESLAYLFGVNDALEWKLPKHHHPDSPFHFVNLPSEDIARSIANRIWITNAYWFAKADNNLPPWRPGLKEVFDAIICDPPYGVRASGRKLLKGVLDPYTVPDDKRVGHIPSTAPYCLSECVHDLLDLAGRILVMGGRLVYFYPVLREDSTRNPFPEHLCFKLVASSEQILSSRYSRVLLTMVKIGLYTEEIAETARRNHLEFRENHLKWLED

ccHHHHHHHHHHccccHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccEEccccccccccccccccEEEEEcccccccccHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEEEEEcccccccccccccccEEEEccccccccccEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHccccc

cHHHHHHHHHHHHccHHHHHHHHHHHccccccEEEccccccccccEEEEEcccHHHHHHHHHHcccccccEEEEEccccccHccccHHHEEEEEccccccHHHHHHEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEEEcccccccHHcccccccEEEEEEccccccHHccEEEEEEEEcccccccHHHHcHccHHHHHHHHHHHHHc

MWYLCVFFHRlldyrkpevESLAYLFGVNdalewklpkhhhpdspfhfvnlpseDIARSIANRIWITNAYWfakadnnlppwrpglkEVFDaiicdppygvrasgRKLLkgvldpytvpddkrvghipstapyclSECVHDLLDLAGRILVMGGRLvyfypvlredstrnpfpehlcfkLVASSEQILSSRYSRVLLTMVKIGLYTEEIAETARRNHLEFRENHLKWLED

*WYLCVFFHRLLDYRKPEVESLAYLFGVNDALEWKLPKHHHPDSPFHFVNLPSEDIARSIANRIWITNAYWFAKADNNLPPWRPGLKEVFDAIICDPPYGVRASGRKLLKGVLDPYTVPDDKRVGHIPSTAPYCLSECVHDLLDLAGRILVMGGRLVYFYPVLREDSTRNPFPEHLCFKLVASSEQILSSRYSRVLLTMVKIGLYTEEIAETARRNHLEFRENHL*****

MWYLCVFFHRLLDYRKPEVESLAYLFGVNDALEW*************FVNLPSEDIARSIANRIWITNAYWFAKADNNLPPWRPGLKEVFDAIICDPPYGVRA*****************DKRVGHIPSTAPYCLSECVHDLLDLAGRILVMGGRLVYFYPVLREDSTRNPFPEHLCFKLVASSEQILSSRYSRVLLTMVK*****************EFRENHLKW***

MWYLCVFFHRLLDYRKPEVESLAYLFGVNDALEWKLPKHHHPDSPFHFVNLPSEDIARSIANRIWITNAYWFAKADNNLPPWRPGLKEVFDAIICDPPYGVRASGRKLLKGV**********RVGHIPSTAPYCLSECVHDLLDLAGRILVMGGRLVYFYPVLREDSTRNPFPEHLCFKLVASSEQILSSRYSRVLLTMVKIGLYTEEIAETARRNHLEFRENHLKWLED

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		230	2.2.26 [Sep-21-2011]
Q54QA6		507	tRNA (guanine(10)-N2)-met	yes	no	0.573	0.260	0.430	1e-21
Q6NS23		478	tRNA (guanine(10)-N2)-met	N/A	no	0.647	0.311	0.381	5e-21
Q6YJI5		461	tRNA (guanine(10)-N2)-met	yes	no	0.643	0.321	0.364	1e-20
Q7Z4G4		463	tRNA (guanine(10)-N2)-met	yes	no	0.530	0.263	0.425	2e-19
Q5R962		463	tRNA (guanine(10)-N2)-met	yes	no	0.530	0.263	0.417	3e-19
Q05B63		460	tRNA (guanine(10)-N2)-met	yes	no	0.543	0.271	0.421	3e-19
Q7TNK6		463	tRNA (guanine(10)-N2)-met	yes	no	0.517	0.257	0.417	5e-19
Q9CWH5		460	tRNA (guanine(10)-N2)-met	yes	no	0.543	0.271	0.414	1e-18
O94636		469	tRNA (guanine(10)-N2)-met	yes	no	0.513	0.251	0.360	3e-11
Q12463		433	tRNA (guanine(10)-N2)-met	yes	no	0.586	0.311	0.277	2e-05

>sp\|Q54QA6\|TRM11_DICDI tRNA (guanine(10)-N2)-methyltransferase homolog OS=Dictyostelium discoideum GN=trmt11 PE=3 SV=1	Back alignment and function desciption

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 81/137 (59%), Gaps = 5/137 (3%)

Query: 75  ADNNLPPWRPGLKEVFDAIICDPPYGVRASGRKL-LKGVLDPYTVPDDKRVGHIPSTAPY 133
            DN+ PPWR  +  +FD+II DPPYG+RA  RK+  K       VP+  R  HIP    Y
Sbjct: 292 CDNSCPPWR--VNSMFDSIITDPPYGIRAGARKIGFKENRKFVPVPEGLRRDHIPQCIDY 349

Query: 134 CLSECVHDLLDLAGRILVMGGRLVYFYPVLREDSTRNPFPEHLCFKLV-ASSEQILSSRY 192
            + + + DLL+LA + L++GGRLVY+ P    D      P H C +L+ AS  QIL++R+
Sbjct: 350 SVPDVMADLLELAAKTLIVGGRLVYWLPT-TPDYKETDLPRHPCLRLITASCLQILTNRW 408

Query: 193 SRVLLTMVKIGLYTEEI 209
            R L+TM KI  Y + I
Sbjct: 409 GRRLVTMEKIIEYNDSI 425

Catalytic subunit of an S-adenosyl-L-methionine-dependent tRNA methyltransferase complex that mediates the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs.
Dictyostelium discoideum (taxid: 44689)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -

>sp\|Q6NS23\|TRM11_XENLA tRNA (guanine(10)-N2)-methyltransferase homolog OS=Xenopus laevis GN=trmt11 PE=2 SV=1	Back alignment and function description

>sp\|Q6YJI5\|TRM11_CHICK tRNA (guanine(10)-N2)-methyltransferase homolog OS=Gallus gallus GN=TRMT11 PE=2 SV=1	Back alignment and function description

>sp\|Q7Z4G4\|TRM11_HUMAN tRNA (guanine(10)-N2)-methyltransferase homolog OS=Homo sapiens GN=TRMT11 PE=1 SV=1	Back alignment and function description

>sp\|Q5R962\|TRM11_PONAB tRNA (guanine(10)-N2)-methyltransferase homolog OS=Pongo abelii GN=TRMT11 PE=2 SV=1	Back alignment and function description

>sp\|Q05B63\|TRM11_BOVIN tRNA (guanine(10)-N2)-methyltransferase homolog OS=Bos taurus GN=TRMT11 PE=2 SV=1	Back alignment and function description

>sp\|Q7TNK6\|TRM11_RAT tRNA (guanine(10)-N2)-methyltransferase homolog OS=Rattus norvegicus GN=Trmt11 PE=2 SV=1	Back alignment and function description

>sp\|Q9CWH5\|TRM11_MOUSE tRNA (guanine(10)-N2)-methyltransferase homolog OS=Mus musculus GN=Trmt11 PE=2 SV=1	Back alignment and function description

>sp\|O94636\|TRM11_SCHPO tRNA (guanine(10)-N2)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm11 PE=3 SV=2	Back alignment and function description

>sp\|Q12463\|TRM11_YEAST tRNA (guanine(10)-N2)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM11 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		230
147789091		477	hypothetical protein VITISV_002923 [Viti	0.682	0.329	0.803	1e-68
225447846		477	PREDICTED: tRNA guanosine-2'-O-methyltra	0.682	0.329	0.797	6e-68
356524876		483	PREDICTED: tRNA guanosine-2'-O-methyltra	0.682	0.325	0.773	2e-66
224054310		474	predicted protein [Populus trichocarpa]	0.678	0.329	0.759	2e-65
356512097		483	PREDICTED: tRNA guanosine-2'-O-methyltra	0.682	0.325	0.748	5e-65
413937260		320	hypothetical protein ZEAMMB73_610590 [Ze	0.682	0.490	0.743	1e-62
413937262		472	hypothetical protein ZEAMMB73_610590 [Ze	0.682	0.332	0.743	2e-62
326508802		475	predicted protein [Hordeum vulgare subsp	0.682	0.330	0.713	1e-61
357149526		475	PREDICTED: tRNA guanosine-2'-O-methyltra	0.682	0.330	0.725	2e-61
18404931		477	methyltransferase / nucleic acid binding	0.682	0.329	0.717	2e-61

>gi\|147789091\|emb\|CAN78018.1\| hypothetical protein VITISV_002923 [Vitis vinifera]	Back alignment and taxonomy information

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 141/163 (86%), Gaps = 6/163 (3%)

Query: 74  KADNNLPPWRPGLKEVFDAIICDPPYGVRASGRK-----LLKGVLDPYTVPDDKRVGHIP 128
           +ADNNLPPWRPGLKEVFDAIICDPPYGVRA GRK     LLKGV+ PYTVPDDKR  HIP
Sbjct: 279 RADNNLPPWRPGLKEVFDAIICDPPYGVRAGGRKSGGRKLLKGVIGPYTVPDDKRTDHIP 338

Query: 129 STAPYCLSECVHDLLDLAGRILVMGGRLVYFYPVLRE-DSTRNPFPEHLCFKLVASSEQI 187
           STA Y L+ECVHDLLD+A ++LVMGGRLVYFYPVLRE DST   FPEH CFKL+A+ EQI
Sbjct: 339 STAAYSLAECVHDLLDVAAKMLVMGGRLVYFYPVLREDDSTETHFPEHPCFKLIATCEQI 398

Query: 188 LSSRYSRVLLTMVKIGLYTEEIAETARRNHLEFRENHLKWLED 230
           LS RYSRVLLTMVKIG YTEEIAETAR  HLEF+ENHLKWLE+
Sbjct: 399 LSLRYSRVLLTMVKIGPYTEEIAETARLKHLEFKENHLKWLEE 441

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225447846\|ref\|XP_002271199.1\| PREDICTED: tRNA guanosine-2'-O-methyltransferase TRM11 homolog [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356524876\|ref\|XP_003531054.1\| PREDICTED: tRNA guanosine-2'-O-methyltransferase TRM11 homolog [Glycine max]	Back alignment and taxonomy information

>gi\|224054310\|ref\|XP_002298196.1\| predicted protein [Populus trichocarpa] gi\|118486632\|gb\|ABK95153.1\| unknown [Populus trichocarpa] gi\|222845454\|gb\|EEE83001.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356512097\|ref\|XP_003524757.1\| PREDICTED: tRNA guanosine-2'-O-methyltransferase TRM11 homolog [Glycine max]	Back alignment and taxonomy information

>gi\|413937260\|gb\|AFW71811.1\| hypothetical protein ZEAMMB73_610590 [Zea mays]	Back alignment and taxonomy information

>gi\|413937262\|gb\|AFW71813.1\| hypothetical protein ZEAMMB73_610590 [Zea mays]	Back alignment and taxonomy information

>gi\|326508802\|dbj\|BAJ95923.1\| predicted protein [Hordeum vulgare subsp. vulgare]	Back alignment and taxonomy information

>gi\|357149526\|ref\|XP_003575142.1\| PREDICTED: tRNA guanosine-2'-O-methyltransferase TRM11 homolog [Brachypodium distachyon]	Back alignment and taxonomy information

>gi|18404931|ref|NP_566792.1| methyltransferase / nucleic acid binding protein [Arabidopsis thaliana] gi|13430750|gb|AAK25997.1|AF360287_1 unknown protein [Arabidopsis thaliana] gi|9294300|dbj|BAB02202.1| unnamed protein product [Arabidopsis thaliana] gi|15293219|gb|AAK93720.1| unknown protein [Arabidopsis thaliana] gi|332643633|gb|AEE77154.1| methyltransferase / nucleic acid binding protein [Arabidopsis thaliana]

Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		230
TAIR\|locus:2079261		477	TRM11 "tRNA modification 11" [	0.682	0.329	0.717	1.2e-83
UNIPROTKB\|F1S2W7		460	TRMT11 "Uncharacterized protei	0.543	0.271	0.421	1.5e-27
DICTYBASE\|DDB_G0283969		507	trmt11 "tRNA guanosine-2'-O-me	0.569	0.258	0.433	7.7e-27
UNIPROTKB\|Q7Z4G4		463	TRMT11 "tRNA (guanine(10)-N2)-	0.547	0.272	0.423	7.7e-27
UNIPROTKB\|Q05B63		460	TRMT11 "tRNA (guanine(10)-N2)-	0.543	0.271	0.421	9e-27
UNIPROTKB\|F1NB37		461	TRMT11 "tRNA (guanine(10)-N2)-	0.660	0.329	0.383	1.2e-26
UNIPROTKB\|Q6YJI5		461	TRMT11 "tRNA (guanine(10)-N2)-	0.660	0.329	0.383	1.2e-26
UNIPROTKB\|E2RRG7		463	TRMT11 "Uncharacterized protei	0.530	0.263	0.425	3e-26
RGD\|727798		463	Trmt11 "tRNA methyltransferase	0.517	0.257	0.417	5.4e-26
UNIPROTKB\|Q7TNK6		463	Trmt11 "tRNA (guanine(10)-N2)-	0.517	0.257	0.417	5.4e-26

TAIR\|locus:2079261 TRM11 "tRNA modification 11" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 610 (219.8 bits), Expect = 1.2e-83, Sum P(2) = 1.2e-83
 Identities = 117/163 (71%), Positives = 133/163 (81%)

Query:    74 KADNNLPPWRPGLKEVFDAIICDPPYGVRASGRK-----LLKGVLDPYTVPDDKRVGHIP 128
             + DNN+PPWR GLKE+FDAIICDPPYGVRA GRK     +L+G +DPYTVPDDKR  HIP
Sbjct:   280 RMDNNVPPWRSGLKEIFDAIICDPPYGVRAGGRKSGGRKILRGTVDPYTVPDDKRTDHIP 339

Query:   129 STAPYCLSECVHDLLDLAGRILVMGGRLVYFYPVLREDS-TRNPFPEHLCFKLVASSEQI 187
             ST  Y L ECVHDLL LA R+LVM GRLV+F+PVLR+++ +   FPEH CFKLVA SEQI
Sbjct:   340 STGAYSLVECVHDLLHLAARMLVMKGRLVFFFPVLRDETGSEVKFPEHPCFKLVAVSEQI 399

Query:   188 LSSRYSRVLLTMVKIGLYTEEIAETARRNHLEFRENHLKWLED 230
             LSSRYSRVLLTMVK+  Y+EE+ E AR  HLEFRENHLKWLED
Sbjct:   400 LSSRYSRVLLTMVKVEPYSEEVEEAARLMHLEFRENHLKWLED 442

GO:0003676 "nucleic acid binding" evidence=IEA

GO:0005737 "cytoplasm" evidence=ISM

GO:0008168 "methyltransferase activity" evidence=IEA

GO:0032259 "methylation" evidence=IEA

GO:0006400 "tRNA modification" evidence=IMP

GO:0080180 "2-methylguanosine metabolic process" evidence=IMP

GO:0006626 "protein targeting to mitochondrion" evidence=RCA

UNIPROTKB\|F1S2W7 TRMT11 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0283969 trmt11 "tRNA guanosine-2'-O-methyltransferase 11" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|Q7Z4G4 TRMT11 "tRNA (guanine(10)-N2)-methyltransferase homolog" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q05B63 TRMT11 "tRNA (guanine(10)-N2)-methyltransferase homolog" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NB37 TRMT11 "tRNA (guanine(10)-N2)-methyltransferase homolog" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q6YJI5 TRMT11 "tRNA (guanine(10)-N2)-methyltransferase homolog" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RRG7 TRMT11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

RGD\|727798 Trmt11 "tRNA methyltransferase 11 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q7TNK6 Trmt11 "tRNA (guanine(10)-N2)-methyltransferase homolog" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.1.1	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	estExt_fgenesh4_pm.C_LG_I0505	SubName- Full=Putative uncharacterized protein; (474 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
	estExt_fgenesh4_pm.C_1070023	hypothetical protein (554 aa)	•			0.571
	gw1.X.2964.1	hypothetical protein (516 aa)	•			0.568
	gw1.170.45.1	SubName- Full=Putative uncharacterized protein; (274 aa)	•			0.565
	estExt_fgenesh4_pm.C_280108	hypothetical protein (960 aa)	•			0.565
	estExt_Genewise1_v1.C_LG_VII2715	hypothetical protein (380 aa)	•			0.554
	estExt_fgenesh4_pg.C_LG_VII0458	hypothetical protein (799 aa)	•	•	•	0.553
	estExt_Genewise1_v1.C_LG_IV0024	SubName- Full=Putative uncharacterized protein; (604 aa)	•			0.551
	fgenesh4_pg.C_LG_XVII000484	hypothetical protein (433 aa)	•			0.547
	gw1.II.4059.1	hypothetical protein (592 aa)	•		•	0.544
	gw1.XIX.1572.1	hypothetical protein (303 aa)	•		•	0.545

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		230
COG1041		347	COG1041, COG1041, Predicted DNA modification methy	7e-04

>gnl\|CDD\|223971 COG1041, COG1041, Predicted DNA modification methylase [DNA replication, recombination, and repair]	Back alignment and domain information

 Score = 39.7 bits (93), Expect = 7e-04
 Identities = 25/116 (21%), Positives = 36/116 (31%), Gaps = 30/116 (25%)

Query: 87  KEVFDAIICDPPYGVRASGRKLLKGVLDPYTVPDDKRVGHIPSTAPYCLSECVHDLLDLA 146
               DAI  DPPYG                                  L E   + L+ A
Sbjct: 262 DNSVDAIATDPPYGRST-------------------------KIKGEGLDELYEEALESA 296

Query: 147 GRILVMGGRLVYFYPVLREDSTRNPFPEHLCFKLVASSEQILSSRYSRVLLTMVKI 202
             +L  GGR+V+  P            E L FK++      +    +RV+  + K 
Sbjct: 297 SEVLKPGGRIVFAAPRDPRHEL-----EELGFKVLGRFTMRVHGSLTRVIYVVRKK 347

Length = 347

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		230
KOG2671		421	consensus Putative RNA methylase [Replication, rec	100.0
COG1041		347	Predicted DNA modification methylase [DNA replicat	99.92
TIGR01177		329	conserved hypothetical protein TIGR01177. This fam	99.89
COG4123		248	Predicted O-methyltransferase [General function pr	98.92
PF01170		179	UPF0020: Putative RNA methylase family UPF0020; In	98.55
PF13659		117	Methyltransf_26: Methyltransferase domain; PDB: 3G	98.34
PRK13699		227	putative methylase; Provisional	98.03
PRK11524		284	putative methyltransferase; Provisional	97.82
PF01555		231	N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th	97.81
PF07669		106	Eco57I: Eco57I restriction-modification methylase;	97.61
TIGR00537		179	hemK_rel_arch HemK-related putative methylase. The	97.32
PF05175		170	MTS: Methyltransferase small domain; InterPro: IPR	97.25
TIGR03533		284	L3_gln_methyl protein-(glutamine-N5) methyltransfe	97.21
PF02384		311	N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T	97.19
PRK14967		223	putative methyltransferase; Provisional	97.18
PRK11783		702	rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi	97.15
TIGR03534		251	RF_mod_PrmC protein-(glutamine-N5) methyltransfera	97.08
PRK09328		275	N5-glutamine S-adenosyl-L-methionine-dependent met	97.07
COG0116		381	Predicted N6-adenine-specific DNA methylase [DNA r	97.02
TIGR03704		251	PrmC_rel_meth putative protein-(glutamine-N5) meth	96.87
PRK14968		188	putative methyltransferase; Provisional	96.86
PRK11805		307	N5-glutamine S-adenosyl-L-methionine-dependent met	96.86
PHA03412		241	putative methyltransferase; Provisional	96.82
PRK10901		427	16S rRNA methyltransferase B; Provisional	96.74
PRK14903		431	16S rRNA methyltransferase B; Provisional	96.72
TIGR02987		524	met_A_Alw26 type II restriction m6 adenine DNA met	96.68
PRK14966		423	unknown domain/N5-glutamine S-adenosyl-L-methionin	96.51
COG2890		280	HemK Methylase of polypeptide chain release factor	96.37
PRK14901		434	16S rRNA methyltransferase B; Provisional	96.33
PRK14902		444	16S rRNA methyltransferase B; Provisional	96.23
TIGR00446		264	nop2p NOL1/NOP2/sun family putative RNA methylase.	96.21
TIGR00536		284	hemK_fam HemK family putative methylases. The gene	96.2
PRK14904		445	16S rRNA methyltransferase B; Provisional	96.17
TIGR00563		426	rsmB ribosomal RNA small subunit methyltransferase	96.15
PF01861		243	DUF43: Protein of unknown function DUF43; InterPro	96.09
PRK15001		378	SAM-dependent 23S ribosomal RNA mG1835 methyltrans	96.02
PRK09489		342	rsmC 16S ribosomal RNA m2G1207 methyltransferase;	96.0
PRK15128		396	23S rRNA m(5)C1962 methyltransferase; Provisional	96.0
PRK01544		506	bifunctional N5-glutamine S-adenosyl-L-methionine-	95.76
COG0144		355	Sun tRNA and rRNA cytosine-C5-methylases [Translat	95.32
COG2813		300	RsmC 16S RNA G1207 methylase RsmC [Translation, ri	94.96
PHA03411		279	putative methyltransferase; Provisional	94.93
PRK11783		702	rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi	94.84
COG1743		875	Adenine-specific DNA methylase containing a Zn-rib	94.17
PRK11727		321	23S rRNA mA1618 methyltransferase; Provisional	94.1
COG0286		489	HsdM Type I restriction-modification system methyl	93.63
PF10237		162	N6-adenineMlase: Probable N6-adenine methyltransfe	93.5
PRK00107		187	gidB 16S rRNA methyltransferase GidB; Reviewed	93.19
COG2226		238	UbiE Methylase involved in ubiquinone/menaquinone	92.58
COG2521		287	Predicted archaeal methyltransferase [General func	92.57
PF10672		286	Methyltrans_SAM: S-adenosylmethionine-dependent me	92.23
PRK11188		209	rrmJ 23S rRNA methyltransferase J; Provisional	91.99
PRK11933		470	yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF;	91.3
TIGR00438		188	rrmJ cell division protein FtsJ.	90.4
PRK08287		187	cobalt-precorrin-6Y C(15)-methyltransferase; Valid	90.13
COG1092		393	Predicted SAM-dependent methyltransferases [Genera	90.07
TIGR00497		501	hsdM type I restriction system adenine methylase (	89.85
PRK00811		283	spermidine synthase; Provisional	89.84
PLN02672		1082	methionine S-methyltransferase	89.57
COG0863		302	DNA modification methylase [DNA replication, recom	88.0
PF03602		183	Cons_hypoth95: Conserved hypothetical protein 95;	87.85
TIGR00417		270	speE spermidine synthase. the SpeE subunit of sper	87.57
PF01209		233	Ubie_methyltran: ubiE/COQ5 methyltransferase famil	87.34
PLN02232		160	ubiquinone biosynthesis methyltransferase	86.94
PF05063		176	MT-A70: MT-A70 ; InterPro: IPR007757 N6-methyladen	86.92
KOG2904		328	consensus Predicted methyltransferase [General fun	86.68
cd02440		107	AdoMet_MTases S-adenosylmethionine-dependent methy	86.68
TIGR00138		181	gidB 16S rRNA methyltransferase GidB. GidB (glucos	86.63
PRK01581		374	speE spermidine synthase; Validated	86.33
PF01189		283	Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR	86.27
PRK03612		521	spermidine synthase; Provisional	85.47
COG1568		354	Predicted methyltransferases [General function pre	85.15
KOG3420		185	consensus Predicted RNA methylase [Translation, ri	84.47
TIGR02469		124	CbiT precorrin-6Y C5,15-methyltransferase (decarbo	84.13
PLN02233		261	ubiquinone biosynthesis methyltransferase	81.57
PRK10909		199	rsmD 16S rRNA m(2)G966-methyltransferase; Provisio	81.37
PF08241		95	Methyltransf_11: Methyltransferase domain; InterPr	80.73

>KOG2671 consensus Putative RNA methylase [Replication, recombination and repair]	Back alignment and domain information

Probab=100.00  E-value=1.9e-56  Score=403.69  Aligned_cols=217  Identities=39%  Similarity=0.597  Sum_probs=188.5

Q ss_pred             CceeeehhhhccCCCHHHHHHHHHHcCCCccccccCCCCCCCCCCEEEEecCCHHHHHHHHHHHHHHH-HH---------
Q 039679            1 MWYLCVFFHRLLDYRKPEVESLAYLFGVNDALEWKLPKHHHPDSPFHFVNLPSEDIARSIANRIWITN-AY---------   70 (230)
Q Consensus         1 m~Yl~~fs~~h~~fr~~El~sl~~l~gi~~~~~~~~~~~~~~~~pf~vV~lp~e~~a~~l~~Rsil~~-I~---------   70 (230)
                      |+||++|||+|.+||+||+||||+|||+.++.+    ++++-.+|||+|+++|+++|+.+++|||++| ||         
T Consensus         1 ~~yLl~~~q~hl~Fr~pE~eala~lF~~~i~~s----q~~~t~~PF~iv~~~s~~~Ar~~~kRSIl~kgiyEl~~~g~s~   76 (421)
T KOG2671|consen    1 LPYLLIFAQSHLDFRLPELEALASLFGLQIDES----QKLHTTSPFFIVEFESEEIARNLIKRSILVKGIYELWGEGTSY   76 (421)
T ss_pred             CcEEEEEehhhhccchHHHHHHHHHHhhhhhhh----hhhcCCCceEEEEeCchHHHHHHHHHHHHHHHHHHHhhcCCCH
Confidence            689999999999999999999999999977653    3367789999999999999999999999999 97         


Q ss_pred             --------------------------------------------------------------------------------
Q 039679           71 --------------------------------------------------------------------------------   70 (230)
Q Consensus        71 --------------------------------------------------------------------------------   70 (230)
                                                                                                      
T Consensus        77 ~elh~~i~n~p~~~~~~f~~~dssfki~fetfgk~~t~~e~~~~I~~f~ylpfeG~Vnlk~Pq~~f~viE~y~~~pn~~p  156 (421)
T KOG2671|consen   77 DELHESIQNYPEAQILPFFKSDSSFKIRFETFGKKLTQDEQVEIIESFDYLPFEGPVNLKNPQHVFFVIEEYELDPNVGP  156 (421)
T ss_pred             HHHHHHHHhCCcccccchhccCceeEEEEEEecccccHHHHHHHhhhheeccccceeccCCCceEEEEEEeeccCCCCCC
Confidence                                                                                            


Q ss_pred             --------------------------------------------------------------------------------
Q 039679           71 --------------------------------------------------------------------------------   70 (230)
Q Consensus        71 --------------------------------------------------------------------------------   70 (230)
                                                                                                      
T Consensus       157 ~~p~~IyFGr~ig~g~R~li~~y~LK~R~yiGnTSmDAeLSli~AN~Amv~pGdivyDPFVGTGslLvsaa~FGa~viGt  236 (421)
T KOG2671|consen  157 EEPKKIYFGRLIGEGQRELIEKYDLKKRCYIGNTSMDAELSLIMANQAMVKPGDIVYDPFVGTGSLLVSAAHFGAYVIGT  236 (421)
T ss_pred             CCcceeeehhhhccchHhHhhhcccccccccCCcccchhHHHHHhhhhccCCCCEEecCccccCceeeehhhhcceeecc
Confidence                                                                                            


Q ss_pred             -----------------H--------------HHhhcCCCCCCCCCcccccceeEeCCCCcccccccccccccCCCCCCC
Q 039679           71 -----------------W--------------FAKADNNLPPWRPGLKEVFDAIICDPPYGVRASGRKLLKGVLDPYTVP  119 (230)
Q Consensus        71 -----------------~--------------ll~~D~t~~p~r~~l~e~~DaIvtDPPYGiRa~~rk~~~~~~~~~~~~  119 (230)
                                       |              ++++|++++|||+++  .|||||||||||||||+||.+++.... +..
T Consensus       237 DIDyr~vragrg~~~si~aNFkQYg~~~~fldvl~~D~sn~~~rsn~--~fDaIvcDPPYGVRe~~rk~~~k~~~r-~~~  313 (421)
T KOG2671|consen  237 DIDYRTVRAGRGEDESIKANFKQYGSSSQFLDVLTADFSNPPLRSNL--KFDAIVCDPPYGVREGARKTGKKKSVR-TTE  313 (421)
T ss_pred             ccchheeecccCCCcchhHhHHHhCCcchhhheeeecccCcchhhcc--eeeEEEeCCCcchhhhhhhhcccCccc-Ccc
Confidence                             0              799999999999987  999999999999999999987653322 334


Q ss_pred             CCCccCCCCCCCCcchHHHHHHHHHHHhhccccCCEEEEEEeeccCCCCCCCccccCCceeEeeEEEecCCceeEEEEEE
Q 039679          120 DDKRVGHIPSTAPYCLSECVHDLLDLAGRILVMGGRLVYFYPVLREDSTRNPFPEHLCFKLVASSEQILSSRYSRVLLTM  199 (230)
Q Consensus       120 ~~~~~~~ip~~~~y~~~~~~~dLL~~Aa~~L~~gGRLvf~lP~~~~~~~~~~lp~h~gl~li~~~~Q~~~~k~sR~Lit~  199 (230)
                      ++.+.+|+|++.+|++.+|+.|||.++++.|+.|||||||+|+..+++.+.++|.||++.|+.+|+|.++ +|+|+|+||
T Consensus       314 ~~~~~~h~p~~~~ysl~~~v~dll~fss~~L~~ggrlv~w~p~~~e~~~~~~~P~h~~lsl~~ns~q~~~-~~srrllt~  392 (421)
T KOG2671|consen  314 ESSRGDHYPSTEQYSLSSLVYDLLCFSSRRLVDGGRLVFWLPTITEEYGEDDIPSHPYLSLIYNSEQPFT-HWSRRLLTY  392 (421)
T ss_pred             cccccccCCccchhHHHHHHhhHHHhhHhhhhcCceEEEecCchhhccCcccCCCCcchhhhhhhccccc-hhhhhheee
Confidence            4788999999999999999999999999999999999999999999998999999999999999999999 999999999


Q ss_pred             EEcCCCcHHHHHHHHhhhhHhHHhhhh
Q 039679          200 VKIGLYTEEIAETARRNHLEFRENHLK  226 (230)
Q Consensus       200 ~K~~~~~~~~~~~~~~~~~~fr~~~~~  226 (230)
                      +|..++........-+..++ |++||+
T Consensus       393 ~k~~~~~~~~S~~~v~~~~~-r~~~~~  418 (421)
T KOG2671|consen  393 QKLPRYSDSKSLNLVPKINN-RTRYFN  418 (421)
T ss_pred             eeccccCcccccccCCchhh-cchhhh
Confidence            99998743222111112223 777765

>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR01177 conserved hypothetical protein TIGR01177	Back alignment and domain information

>COG4123 Predicted O-methyltransferase [General function prediction only]	Back alignment and domain information

>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase	Back alignment and domain information

>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A	Back alignment and domain information

>PRK13699 putative methylase; Provisional	Back alignment and domain information

>PRK11524 putative methyltransferase; Provisional	Back alignment and domain information

>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases	Back alignment and domain information

>PF07669 Eco57I: Eco57I restriction-modification methylase; InterPro: IPR011639 This entry contains restriction modification methylases, which in the case of endonuclease Eco57I is found adjacent to the DNA cleavage domain, which recognises asymmetric DNA sequence 5'-CTGAAG [, ]	Back alignment and domain information

>TIGR00537 hemK_rel_arch HemK-related putative methylase	Back alignment and domain information

>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases	Back alignment and domain information

>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific	Back alignment and domain information

>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2	Back alignment and domain information

>PRK14967 putative methyltransferase; Provisional	Back alignment and domain information

>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional	Back alignment and domain information

>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific	Back alignment and domain information

>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific	Back alignment and domain information

>PRK14968 putative methyltransferase; Provisional	Back alignment and domain information

>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>PHA03412 putative methyltransferase; Provisional	Back alignment and domain information

>PRK10901 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PRK14903 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family	Back alignment and domain information

>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional	Back alignment and domain information

>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK14901 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PRK14902 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase	Back alignment and domain information

>TIGR00536 hemK_fam HemK family putative methylases	Back alignment and domain information

>PRK14904 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB	Back alignment and domain information

>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised	Back alignment and domain information

>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional	Back alignment and domain information

>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional	Back alignment and domain information

>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional	Back alignment and domain information

>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed	Back alignment and domain information

>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PHA03411 putative methyltransferase; Provisional	Back alignment and domain information

>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional	Back alignment and domain information

>COG1743 Adenine-specific DNA methylase containing a Zn-ribbon [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK11727 23S rRNA mA1618 methyltransferase; Provisional	Back alignment and domain information

>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms]	Back alignment and domain information

>PF10237 N6-adenineMlase: Probable N6-adenine methyltransferase; InterPro: IPR019369 This family of proteins, which are of approximately 200 residues in length, contain a highly conserved Glu-Phe-Trp (QFW) motif close to the N terminus and an Asp/Asn-Pro-Pro-Tyr/Phe motif in the centre	Back alignment and domain information

>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed	Back alignment and domain information

>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>COG2521 Predicted archaeal methyltransferase [General function prediction only]	Back alignment and domain information

>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species	Back alignment and domain information

>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional	Back alignment and domain information

>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed	Back alignment and domain information

>TIGR00438 rrmJ cell division protein FtsJ	Back alignment and domain information

>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated	Back alignment and domain information

>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only]	Back alignment and domain information

>TIGR00497 hsdM type I restriction system adenine methylase (hsdM)	Back alignment and domain information

>PRK00811 spermidine synthase; Provisional	Back alignment and domain information

>PLN02672 methionine S-methyltransferase	Back alignment and domain information

>COG0863 DNA modification methylase [DNA replication, recombination, and repair]	Back alignment and domain information

>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH	Back alignment and domain information

>TIGR00417 speE spermidine synthase	Back alignment and domain information

>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities []	Back alignment and domain information

>PLN02232 ubiquinone biosynthesis methyltransferase	Back alignment and domain information

>PF05063 MT-A70: MT-A70 ; InterPro: IPR007757 N6-methyladenosine (m6A) is present at internal sites in eukaryotic mRNA	Back alignment and domain information

>KOG2904 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy)	Back alignment and domain information

>TIGR00138 gidB 16S rRNA methyltransferase GidB	Back alignment and domain information

>PRK01581 speE spermidine synthase; Validated	Back alignment and domain information

>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins	Back alignment and domain information

>PRK03612 spermidine synthase; Provisional	Back alignment and domain information

>COG1568 Predicted methyltransferases [General function prediction only]	Back alignment and domain information

>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit	Back alignment and domain information

>PLN02233 ubiquinone biosynthesis methyltransferase	Back alignment and domain information

>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional	Back alignment and domain information

>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		230
3tma_A		354	Methyltransferase; thump domain; 2.05A {Thermus th	98.5
3lpm_A		259	Putative methyltransferase; structural genomics, p	98.34
2ozv_A		260	Hypothetical protein ATU0636; structural genomics,	98.07
3evz_A		230	Methyltransferase; NYSGXRC, NEW YORK SGX research	97.94
3tm4_A		373	TRNA (guanine N2-)-methyltransferase TRM14; rossma	97.93
3khk_A		544	Type I restriction-modification system methylation	97.76
3lkd_A		542	Type I restriction-modification system methyltrans	97.7
1boo_A		323	Protein (N-4 cytosine-specific methyltransferase P	97.64
2zig_A		297	TTHA0409, putative modification methylase; methylt	97.55
3ldg_A		384	Putative uncharacterized protein SMU.472; YPSC, me	97.5
2okc_A		445	Type I restriction enzyme stysji M protein; NP_813	97.5
2ih2_A		421	Modification methylase TAQI; DNA, DNA methyltransf	97.45
1eg2_A		319	Modification methylase RSRI; rossmann fold, exocyc	97.44
3s1s_A		878	Restriction endonuclease bpusi; PD--(D/E)XK cataly	97.35
4dzr_A		215	Protein-(glutamine-N5) methyltransferase, release	97.31
1g60_A		260	Adenine-specific methyltransferase MBOIIA; structu	97.31
3k0b_A		393	Predicted N6-adenine-specific DNA methylase; methy	97.3
3v97_A		703	Ribosomal RNA large subunit methyltransferase L; Y	97.27
2f8l_A		344	Hypothetical protein LMO1582; structural genomics,	97.22
3m6w_A		464	RRNA methylase; rRNA methyltransferase, 5-methylcy	97.17
2ar0_A		541	M.ecoki, type I restriction enzyme ecoki M protein	97.15
2b9e_A		309	NOL1/NOP2/SUN domain family, member 5 isoform 2; m	97.09
3ldu_A		385	Putative methylase; structural genomics, PSI-2, pr	97.08
1o9g_A		250	RRNA methyltransferase; antibiotic resistance, Se-	96.96
3ufb_A		530	Type I restriction-modification system methyltran	96.9
1sqg_A		429	SUN protein, FMU protein; rossmann-fold, mixed bet	96.83
2yxl_A		450	PH0851 protein, 450AA long hypothetical FMU protei	96.83
1nv8_A		284	HEMK protein; class I adoMet-dependent methyltrans	96.82
2b3t_A		276	Protein methyltransferase HEMK; translation termin	96.79
3ajd_A		274	Putative methyltransferase MJ0026; tRNA, M5C, ross	96.71
2b78_A		385	Hypothetical protein SMU.776; structure genomics,	96.41
3p9n_A		189	Possible methyltransferase (methylase); RV2966C, a	96.39
2frx_A		479	Hypothetical protein YEBU; rossmann-type S-adenosy	96.3
2igt_A		332	SAM dependent methyltransferase; alpha-beta sandwi	96.19
2qm3_A		373	Predicted methyltransferase; putative methyltransf	96.04
4dcm_A		375	Ribosomal RNA large subunit methyltransferase G; 2	95.94
1ws6_A		171	Methyltransferase; structural genomics, riken stru	95.86
2as0_A		396	Hypothetical protein PH1915; RNA methyltransferase	95.69
1wxx_A		382	TT1595, hypothetical protein TTHA1280; thermus the	95.62
3m4x_A		456	NOL1/NOP2/SUN family protein; mtase domain, PUA do	95.53
3q87_B		170	N6 adenine specific DNA methylase; SAM-methyltrans	95.51
2ift_A		201	Putative methylase HI0767; NESG, Y767_haein, struc	95.44
2fhp_A		187	Methylase, putative; alpha-beta-alpha sandwich, st	95.43
3v97_A		703	Ribosomal RNA large subunit methyltransferase L; Y	95.39
4fzv_A		359	Putative methyltransferase NSUN4; mterf fold, meth	95.37
2frn_A		278	Hypothetical protein PH0793; structural genomics,	95.29
2esr_A		177	Methyltransferase; structural genomics, hypothetic	95.29
4dmg_A		393	Putative uncharacterized protein TTHA1493; rRNA, m	95.27
3dmg_A		381	Probable ribosomal RNA small subunit methyltransf;	95.24
3g89_A		249	Ribosomal RNA small subunit methyltransferase G; 1	95.0
1dus_A		194	MJ0882; hypothetical protein, methanococcus jannas	95.0
3dou_A		191	Ribosomal RNA large subunit methyltransferase J; c	94.89
3c0k_A		396	UPF0064 protein YCCW; PUA domain, adoMet dependent	94.86
2fpo_A		202	Methylase YHHF; structural genomics, putative meth	94.78
2pjd_A		343	Ribosomal RNA small subunit methyltransferase C; g	94.71
1ixk_A		315	Methyltransferase; open beta sheet; 1.90A {Pyrococ	94.69
3eey_A		197	Putative rRNA methylase; rRNA methylation, S-adeno	94.38
1ej0_A		180	FTSJ; methyltransferase, adoMet, adenosyl methioni	93.94
3cgg_A		195	SAM-dependent methyltransferase; NP_600671.1, meth	93.81
3orh_A		236	Guanidinoacetate N-methyltransferase; structura ge	93.45
2xyq_A		290	Putative 2'-O-methyl transferase; transferase-vira	93.44
2oo3_A		283	Protein involved in catabolism of external DNA; st	92.99
2yx1_A		336	Hypothetical protein MJ0883; methyl transferase, t	92.48
1yub_A		245	Ermam, rRNA methyltransferase; MLS antibiotics; NM	92.46
2h00_A		254	Methyltransferase 10 domain containing protein; st	92.41
1ve3_A		227	Hypothetical protein PH0226; dimer, riken structur	92.16
2qfm_A		364	Spermine synthase; spermidine aminopropyltransfera	91.96
3grz_A		205	L11 mtase, ribosomal protein L11 methyltransferase	91.93
3a27_A		272	TYW2, uncharacterized protein MJ1557; wybutosine m	91.86
1iy9_A		275	Spermidine synthase; rossmann fold, structural gen	91.77
1wy7_A		207	Hypothetical protein PH1948; seven-stranded beta s	91.34
2nyu_A		196	Putative ribosomal RNA methyltransferase 2; SAM, s	91.28
2pxx_A		215	Uncharacterized protein MGC2408; structural genomi	91.12
1yb2_A		275	Hypothetical protein TA0852; structural genomics,	90.76
2pwy_A		258	TRNA (adenine-N(1)-)-methyltransferase; mtase, ado	90.59
3adn_A		294	Spermidine synthase; aminopropyltransferase, polya	90.46
1zx0_A		236	Guanidinoacetate N-methyltransferase; structural g	90.29
1l3i_A		192	Precorrin-6Y methyltransferase/putative decarboxyl	90.27
3e05_A		204	Precorrin-6Y C5,15-methyltransferase (decarboxyla;	90.22
3mti_A		185	RRNA methylase; SAM-dependent, PSI, MCSG, structur	89.99
2plw_A		201	Ribosomal RNA methyltransferase, putative; malaria	89.93
3mb5_A		255	SAM-dependent methyltransferase; RNA methyltransfe	89.69
2pt6_A		321	Spermidine synthase; transferase, structural genom	89.42
1mjf_A		281	Spermidine synthase; spermidine synthetase, struct	89.4
3e23_A		211	Uncharacterized protein RPA2492; alpha-beta protei	89.39
2nxc_A		254	L11 mtase, ribosomal protein L11 methyltransferase	89.38
1o54_A		277	SAM-dependent O-methyltransferase; TM0748, structu	89.21
1jsx_A		207	Glucose-inhibited division protein B; methyltransf	89.04
3bwc_A		304	Spermidine synthase; SAM, SGPP, structura genomics	88.75
3id6_C		232	Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase;	88.75
1inl_A		296	Spermidine synthase; beta-barrel, rossman fold, st	88.67
2avd_A		229	Catechol-O-methyltransferase; structural genomics,	88.47
3tr6_A		225	O-methyltransferase; cellular processes; HET: SAH;	87.99
2ipx_A		233	RRNA 2'-O-methyltransferase fibrillarin; FBL, stru	87.91
3dr5_A		221	Putative O-methyltransferase; Q8NRD3, CGL1119, PF0	87.81
2fyt_A		340	Protein arginine N-methyltransferase 3; structural	87.76
1g8a_A		227	Fibrillarin-like PRE-rRNA processing protein; rRNA	87.68
3gdh_A		241	Trimethylguanosine synthase homolog; M7G, CAP, dim	87.34
3duw_A		223	OMT, O-methyltransferase, putative; alternating of	87.06
1i9g_A		280	Hypothetical protein RV2118C; mtase, adoMet, cryst	87.01
1nt2_A		210	Fibrillarin-like PRE-rRNA processing protein; adeM	86.79
2o07_A		304	Spermidine synthase; structural genomics, structur	86.76
2p8j_A		209	S-adenosylmethionine-dependent methyltransferase;	86.66
3ntv_A		232	MW1564 protein; rossmann fold, putative methyltran	86.57
2yvl_A		248	TRMI protein, hypothetical protein; tRNA, methyltr	86.5
3hm2_A		178	Precorrin-6Y C5,15-methyltransferase; alpha-beta-s	86.5
3axs_A		392	Probable N(2),N(2)-dimethylguanosine tRNA methylt	86.35
2b2c_A		314	Spermidine synthase; beta-alpha, transferase; 2.50	86.19
3bt7_A		369	TRNA (uracil-5-)-methyltransferase; methyluridine,	86.1
2gpy_A		233	O-methyltransferase; structural genomics, PSI, pro	86.08
2i7c_A		283	Spermidine synthase; transferase, structural genom	85.89
1xj5_A		334	Spermidine synthase 1; structural genomics, protei	85.76
1uir_A		314	Polyamine aminopropyltransferase; spermidien synth	85.73
3kkz_A		267	Uncharacterized protein Q5LES9; putative methyltra	85.69
2gs9_A		211	Hypothetical protein TT1324; methyl transferase, s	85.66
1xdz_A		240	Methyltransferase GIDB; MCSG, protein structure in	85.62
2zfu_A		215	Nucleomethylin, cerebral protein 1; nucleolar prot	85.07
3tfw_A		248	Putative O-methyltransferase; PSI-biology, nysgrc,	84.99
1yzh_A		214	TRNA (guanine-N(7)-)-methyltransferase; alpha-beta	84.85
1i1n_A		226	Protein-L-isoaspartate O-methyltransferase; S-aden	84.51
1fbn_A		230	MJ fibrillarin homologue; MJ proteins, ribosomal R	84.37
2kw5_A		202	SLR1183 protein; structural genomics, northeast st	84.05
1g6q_1		328	HnRNP arginine N-methyltransferase; SAM-binding do	84.05
3gjy_A		317	Spermidine synthase; APC62791, structural genomics	84.02
3r3h_A		242	O-methyltransferase, SAM-dependent; structural gen	83.72
3m70_A		286	Tellurite resistance protein TEHB homolog; structu	83.59
3f4k_A		257	Putative methyltransferase; structural genomics, P	83.51
1ri5_A		298	MRNA capping enzyme; methyltransferase, M7G, messe	82.99
1sui_A		247	Caffeoyl-COA O-methyltransferase; rossmann fold, p	82.96
3dlc_A		219	Putative S-adenosyl-L-methionine-dependent methylt	82.63
2dul_A		378	N(2),N(2)-dimethylguanosine tRNA methyltransferas;	82.21
2xvm_A		199	Tellurite resistance protein TEHB; antibiotic resi	82.02
1nkv_A		256	Hypothetical protein YJHP; structural genomics, PS	81.85
3c3p_A		210	Methyltransferase; NP_951602.1, structural genomic	81.19
4df3_A		233	Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase;	80.92
3bkw_A		243	MLL3908 protein, S-adenosylmethionine dependent me	80.78
3sm3_A		235	SAM-dependent methyltransferases; NESG, structural	80.7
3dxy_A		218	TRNA (guanine-N(7)-)-methyltransferase; rossmann f	80.54
3dtn_A		234	Putative methyltransferase MM_2633; structural gen	80.48

>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus}	Back alignment and structure

Probab=98.50  E-value=9.7e-08  Score=85.70  Aligned_cols=96  Identities=21%  Similarity=0.185  Sum_probs=64.8

Q ss_pred             HhhcCCCCCCCCCcccccceeEeCCCCcccccccccccccCCCCCCCCCCccCCCCCCCCcchHHHHHHHHHHHhhcccc
Q 039679           73 AKADNNLPPWRPGLKEVFDAIICDPPYGVRASGRKLLKGVLDPYTVPDDKRVGHIPSTAPYCLSECVHDLLDLAGRILVM  152 (230)
Q Consensus        73 l~~D~t~~p~r~~l~e~~DaIvtDPPYGiRa~~rk~~~~~~~~~~~~~~~~~~~ip~~~~y~~~~~~~dLL~~Aa~~L~~  152 (230)
                      ...|....+...   +.||.||||||||.|-+..                          -.+.+++..+++.+.++|++
T Consensus       259 ~~~D~~~~~~~~---~~~D~Ii~npPyg~r~~~~--------------------------~~~~~~~~~~~~~~~~~Lkp  309 (354)
T 3tma_A          259 LRADARHLPRFF---PEVDRILANPPHGLRLGRK--------------------------EGLFHLYWDFLRGALALLPP  309 (354)
T ss_dssp             EECCGGGGGGTC---CCCSEEEECCCSCC----C--------------------------HHHHHHHHHHHHHHHHTSCT
T ss_pred             EeCChhhCcccc---CCCCEEEECCCCcCccCCc--------------------------ccHHHHHHHHHHHHHHhcCC
Confidence            444555433332   2589999999999976542                          14677889999999999999


Q ss_pred             CCEEEEEEeeccCCCCCCCccccCCceeEeeEEEecCCceeEEEEEEEEc
Q 039679          153 GGRLVYFYPVLREDSTRNPFPEHLCFKLVASSEQILSSRYSRVLLTMVKI  202 (230)
Q Consensus       153 gGRLvf~lP~~~~~~~~~~lp~h~gl~li~~~~Q~~~~k~sR~Lit~~K~  202 (230)
                      ||+++++.|...  . ...+.. .||+.... ....+++..+.+++++|.
T Consensus       310 gG~l~i~t~~~~--~-~~~~~~-~g~~~~~~-~~l~~g~l~~~i~vl~rl  354 (354)
T 3tma_A          310 GGRVALLTLRPA--L-LKRALP-PGFALRHA-RVVEQGGVYPRVFVLEKL  354 (354)
T ss_dssp             TCEEEEEESCHH--H-HHHHCC-TTEEEEEE-EECCBTTBCCEEEEEEEC
T ss_pred             CcEEEEEeCCHH--H-HHHHhh-cCcEEEEE-EEEEeCCEEEEEEEEEcC
Confidence            999999977431  1 112233 68887654 344577888889998873

PyMOL of 3tma

>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes}	Back alignment and structure

>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str}	Back alignment and structure

>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus}	Back alignment and structure

>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A*	Back alignment and structure

>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei}	Back alignment and structure

>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus}	Back alignment and structure

>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11	Back alignment and structure

>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A	Back alignment and structure

>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans}	Back alignment and structure

>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45	Back alignment and structure

>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A*	Back alignment and structure

>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A	Back alignment and structure

>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus}	Back alignment and structure

>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11	Back alignment and structure

>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str}	Back alignment and structure

>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A*	Back alignment and structure

>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45	Back alignment and structure

>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A*	Back alignment and structure

>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B*	Back alignment and structure

>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38	Back alignment and structure

>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile}	Back alignment and structure

>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A	Back alignment and structure

>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus}	Back alignment and structure

>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A	Back alignment and structure

>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii}	Back alignment and structure

>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A*	Back alignment and structure

>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A*	Back alignment and structure

>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A	Back alignment and structure

>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A*	Back alignment and structure

>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis}	Back alignment and structure

>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli}	Back alignment and structure

>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51	Back alignment and structure

>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638}	Back alignment and structure

>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli}	Back alignment and structure

>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46	Back alignment and structure

>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51	Back alignment and structure

>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A*	Back alignment and structure

>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium}	Back alignment and structure

>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi}	Back alignment and structure

>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46	Back alignment and structure

>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46	Back alignment and structure

>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A*	Back alignment and structure

>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A*	Back alignment and structure

>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A*	Back alignment and structure

>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46	Back alignment and structure

>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus}	Back alignment and structure

>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A*	Back alignment and structure

>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A*	Back alignment and structure

>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4	Back alignment and structure

>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0	Back alignment and structure

>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12}	Back alignment and structure

>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46	Back alignment and structure

>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli}	Back alignment and structure

>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38	Back alignment and structure

>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405}	Back alignment and structure

>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A*	Back alignment and structure

>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*	Back alignment and structure

>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A*	Back alignment and structure

>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59	Back alignment and structure

>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A*	Back alignment and structure

>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24	Back alignment and structure

>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54	Back alignment and structure

>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43	Back alignment and structure

>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp}	Back alignment and structure

>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii}	Back alignment and structure

>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17	Back alignment and structure

>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32	Back alignment and structure

>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens}	Back alignment and structure

>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens}	Back alignment and structure

>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13	Back alignment and structure

>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus}	Back alignment and structure

>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*	Back alignment and structure

>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A*	Back alignment and structure

>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0	Back alignment and structure

>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A*	Back alignment and structure

>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum}	Back alignment and structure

>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C*	Back alignment and structure

>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A*	Back alignment and structure

>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A*	Back alignment and structure

>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris}	Back alignment and structure

>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A*	Back alignment and structure

>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13	Back alignment and structure

>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20	Back alignment and structure

>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A*	Back alignment and structure

>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E*	Back alignment and structure

>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A*	Back alignment and structure

>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1	Back alignment and structure

>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0	Back alignment and structure

>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens}	Back alignment and structure

>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum}	Back alignment and structure

>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A*	Back alignment and structure

>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A	Back alignment and structure

>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A*	Back alignment and structure

>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A*	Back alignment and structure

>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13	Back alignment and structure

>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3	Back alignment and structure

>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A*	Back alignment and structure

>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum}	Back alignment and structure

>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus}	Back alignment and structure

>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus}	Back alignment and structure

>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae}	Back alignment and structure

>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A*	Back alignment and structure

>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17	Back alignment and structure

>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli}	Back alignment and structure

>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans}	Back alignment and structure

>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A*	Back alignment and structure

>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A	Back alignment and structure

>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A*	Back alignment and structure

>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A*	Back alignment and structure

>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus}	Back alignment and structure

>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20	Back alignment and structure

>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens}	Back alignment and structure

>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp}	Back alignment and structure

>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53	Back alignment and structure

>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A*	Back alignment and structure

>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A	Back alignment and structure

>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A	Back alignment and structure

>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6	Back alignment and structure

>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp}	Back alignment and structure

>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae}	Back alignment and structure

>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A*	Back alignment and structure

>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A*	Back alignment and structure

>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A*	Back alignment and structure

>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis}	Back alignment and structure

>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A*	Back alignment and structure

>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A*	Back alignment and structure

>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21	Back alignment and structure

>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca}	Back alignment and structure

>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix}	Back alignment and structure

>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti}	Back alignment and structure

>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei}	Back alignment and structure

>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A*	Back alignment and structure

>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		230
d1eg2a_		279	m.RsrI N6 adenosine-specific DNA methyltransferase	97.85
d2f8la1		328	Hypothetical protein Lmo1582 {Listeria monocytogen	97.79
d1g60a_		256	Methyltransferase mboII {Moraxella bovis [TaxId: 4	97.74
d2okca1		425	Type I restriction enzyme StySJI M protein {Bacter	97.61
d1booa_		320	m.PvuII N4 cytosine-specific DNA methyltransferase	97.5
d2ar0a1		524	M.EcoKI {Escherichia coli [TaxId: 562]}	97.46
d2as0a2		324	Hypothetical protein PH1915, middle and C-terminal	97.03
d2b78a2		317	Hypothetical protein SMu776, middle and C-terminal	96.98
d1ws6a1		171	Methyltransferase TTHA0928 {Thermus thermophilus [	96.97
d2ih2a1		223	DNA methylase TaqI, N-terminal domain {Thermus aqu	96.94
d1dusa_		194	Hypothetical protein MJ0882 {Archaeon Methanococcu	96.83
d1wxxa2		318	Hypothetical protein TTHA1280, middle and C-termin	96.78
d2b3ta1		274	N5-glutamine methyltransferase, HemK {Escherichia	96.56
d2igta1		309	Putative methyltransferase Atu0340 {Agrobacterium	95.88
d1o9ga_		249	rRNA methyltransferase AviRa {Streptomyces viridoc	94.99
d2fpoa1		183	Methylase YhhF {Escherichia coli [TaxId: 562]}	94.46
d2fhpa1		182	Putative methylase EF2452 {Enterococcus faecalis [	94.28
d1yb2a1		250	Hypothetical protein Ta0852 {Thermoplasma acidophi	94.09
d1ixka_		313	Hypothetical methyltransferase PH1374 {Archaeon Py	93.52
d1sqga2		284	Ribosomal RNA small subunit methyltransferase B, R	93.37
d1nv8a_		271	N5-glutamine methyltransferase, HemK {Thermotoga m	93.22
d2esra1		152	Putative methyltransferase SPy1538 {Streptococcus	92.88
d2h00a1		250	Methyltransferase 10 domain containing protein MET	92.58
d1wy7a1		201	Hypothetical protein PH1948 {Archaeon Pyrococcus h	92.33
d2ifta1		183	Putative methylase HI0767 {Haemophilus influenzae	91.73
d1l3ia_		186	Precorrin-6Y methyltransferase (CbiT) {Archaeon Me	91.66
d1uira_		312	Spermidine synthase {Thermus thermophilus [TaxId:	91.48
d1ne2a_		197	Hypothetical protein Ta1320 {Archaeon Thermoplasma	89.99
d1i9ga_		264	Probable methyltransferase Rv2118c {Mycobacterium	89.22
d2b9ea1		293	NOL1R {Human (Homo sapiens) [TaxId: 9606]}	86.59
d1zx0a1		229	Guanidinoacetate methyltransferase {Human (Homo sa	85.15
d2o57a1		282	Putative sarcosine dimethylglycine methyltransfera	83.78
d1inla_		295	Spermidine synthase {Thermotoga maritima [TaxId: 2	82.76

>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Type II DNA methylase
domain: m.RsrI N6 adenosine-specific DNA methyltransferase
species: Rhodobacter sphaeroides [TaxId: 1063]

Probab=97.85  E-value=6.9e-06  Score=67.87  Aligned_cols=51  Identities=25%  Similarity=0.397  Sum_probs=38.1

Q ss_pred             cccceeEeCCCCcccccccccccccCCCCCCCCCCccCCCCCCCCcchHHHHHHHHHHHhhccccCCEEEEEEe
Q 039679           88 EVFDAIICDPPYGVRASGRKLLKGVLDPYTVPDDKRVGHIPSTAPYCLSECVHDLLDLAGRILVMGGRLVYFYP  161 (230)
Q Consensus        88 e~~DaIvtDPPYGiRa~~rk~~~~~~~~~~~~~~~~~~~ip~~~~y~~~~~~~dLL~~Aa~~L~~gGRLvf~lP  161 (230)
                      +++|.|+||||||+--+-.+                       ..-+..+.+...+..+.++|++||.++++.-
T Consensus        22 ~SIDliitDPPYn~~~~~~~-----------------------~~~~y~~~~~~~~~e~~rvLk~~G~~~~~~~   72 (279)
T d1eg2a_          22 DSVQLIICDPPYNIMLADWD-----------------------DHMDYIGWAKRWLAEAERVLSPTGSIAIFGG   72 (279)
T ss_dssp             TCEEEEEECCCSBCCGGGGG-----------------------TCSSHHHHHHHHHHHHHHHEEEEEEEEEEEC
T ss_pred             CCccEEEECCCCCCCccccc-----------------------CHHHHHHHHHHHHHHHHHHhCCCccEEEecC
Confidence            48999999999997311100                       0123567788899999999999999988754

PyMOL of d1eg2a_

>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]}	Back information, alignment and structure

>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]}	Back information, alignment and structure

>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]}	Back information, alignment and structure

>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]}	Back information, alignment and structure

>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]}	Back information, alignment and structure

>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]}	Back information, alignment and structure

>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure