Citrus Sinensis ID: 039778


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46
LSNLKFLDLSHNSFNNSVLSSLAGLSSLKNLSLAYNRLEGSINIEGMNMLESLDLSGNKFNSSILSSLTALSSLRKLNLMATGFKGTFDVQELDSLSNLEELDMSDNEIDNLVVPKDYRGLRKLRFLDLSGLRIRDGSKVLHSIGSFPSLKTLYLKSNNFAKTVTTTQGLCELVHLQDLYIDRNDFIGSLPWCLANLTSLRVLHVPDNQLTGNLSSSPLMHLTSIEVLLLSNNHFQIPISLEPFFNYSKLKIFHANNSLSGPFRLPTRSRKNIIALDISYNKLQGHIPVEIGKVLPNLGFLSITFNAFNGSIPSSFGDMNSLIYLDLSNNQLTGEIPEHLAMGCFNLEYLLLSNNSLQGQLFSKKNNLTKLKRLNLDGNHFIGDIPESLSNCSSLQGLYISDNDITGSIPTWIGNISFLDAIIMPDNHLEGPIPSEFCQLDYLEILDLSKNNIAGSLPS
cccccEEEcccccccccccHHHHccccccEEEcccccEEEEccccccccccEEEcccccccccccHHHHccccccEEEccccccEEEccHHHHcccccccEEEccccccccccccHHccccccccEEEcccccccccccccccccccccccEEEcccccccccccccccccccccccEEEccccccEEcccHHccccccccEEEccccccccccccccccccccccEEEccccEEEEccccccccccccEEEEccccEEEEcccccccccccccEEEccccEEEEcccHHHHHccccccEEEccccEEEEcccccccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccHHHHHccccccEEEccccccccccHHHHHccccccEEEcccccccccccc
ccccEEEEEccccccccccHHHcccccccEEEEccccccccccccccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHHcccccccEEEEcccccccccccHHHccccccEEEEEccccccccccccHHHcccccccEEEEccccccccccHHHcccccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHHHccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEEccccccccccHHHHHHHHcccEEEcccccccccccHHHccccccEEEEEccccccccccHHHHHHcccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccc
lsnlkfldlshnsfnnSVLSSLAGLSSLKNLSLAYNRLEGSINIEGMNMLESldlsgnkfnSSILSSLTALSSLRKLNLMAtgfkgtfdvqeldslsnleeldmsdneidnlvvpkdyrglrklrfldlsglrirdgskvlhsigsfpslktlYLKSNNFAKTVTTTQGLCELVHLqdlyidrndfigsLPWCLAnltslrvlhvpdnqltgnlsssplmHLTSIEVLLLsnnhfqipislepffnysklkifhannslsgpfrlptrsrknIIALDISYnklqghipveigkvlpnlgflsitfnafngsipssfgdmnSLIYLdlsnnqltgeipehlamGCFNLEYLLLSNNslqgqlfskknnltklkrlnldgnhfigdipeslsncsslqglyisdnditgsiptwignisfldaiimpdnhlegpipsefcqlDYLEILDlsknniagslps
lsnlkfldLSHNSFNNSVLSSLAGLSSLKNLSLAYNRLEGSINIEGMNMLESLDLSGNKFNSSILSSLTALSSLRKLNLMATGFKGTFDVQELDSLSNleeldmsdneidnlvvpkdyrglrKLRFLDLSGLRIRDGSKVLHSIGSFPSLKTLYLKSNNFAKTVTTTQGLCELVHLQDLYIDRNDFIGSLPWCLANLTSLRVLHVPDNQLTGNLSSSPLMHLTSIEVLLLSNNHFQIPISLEPFFNYSKLKIFHANnslsgpfrlpTRSRKNIIALDISYNKLQGHIPVEIGKVLPNLGFLSITFNAFNGSIPSSFGDMNSLIYLDLSNNQLTGEIPEHLAMGCFNLEYLLLSNNSLQGQLFSKKNNLTKLKRLNLDGNHFIGDIPESLSNCSSLQGLYISDNDITGSIPTWIGNISFLDAIIMPDNHLEGPIPSEFCQLDYLEILDLsknniagslps
LSNLKFLDLSHNSFnnsvlsslaglsslknlslAYNRLEGSINIEGMNMLESLDLSGNKFNssilssltalsslrklNLMATGFKGTFDVQeldslsnleeldmsdNEIDNLVVPKDYRGLRKLRFLDLSGLRIRDGSKVLHSIGSFPSLKTLYLKSNNFAKTVTTTQGLCELVHLQDLYIDRNDFIGSLPWCLANLTSLRVLHVPDNQLTGNLSSSPLMHLTSIEVLLLSNNHFQIPISLEPFFNYSKLKIFHANNSLSGPFRLPTRSRKNIIALDISYNKLQGHIPVEIGKVLPNLGFLSITFNAFNGSIPSSFGDMNSLIYLDLSNNQLTGEIPEHLAMGCFNLEYlllsnnslqgqlFSkknnltklkrlnlDGNHFIGDIPESLSNCSSLQGLYISDNDITGSIPTWIGNISFLDAIIMPDNHLEGPIPSEFCQLDYLEILDLSKNNIAGSLPS
****************SVLSSLAGLSSLKNLSLAYNRLEGSINIEGMNMLESLDLSGNKFNSSILSSLTALSSLRKLNLMATGFKGTFDVQELDSLSNLEELDMSDNEIDNLVVPKDYRGLRKLRFLDLSGLRIRDGSKVLHSIGSFPSLKTLYLKSNNFAKTVTTTQGLCELVHLQDLYIDRNDFIGSLPWCLANLTSLRVLHVPDNQLTGNLSSSPLMHLTSIEVLLLSNNHFQIPISLEPFFNYSKLKIFHANNSLSGPFRLPTRSRKNIIALDISYNKLQGHIPVEIGKVLPNLGFLSITFNAFNGSIPSSFGDMNSLIYLDLSNNQLTGEIPEHLAMGCFNLEYLLLSNNSLQGQLFSKKNNLTKLKRLNLDGNHFIGDIPESLSNCSSLQGLYISDNDITGSIPTWIGNISFLDAIIMPDNHLEGPIPSEFCQLDYLEILDLS**********
LSNLKFLDLSHNSFNNSVLSSLAGLSSLKNLSLAYNRLEGSINIEGMNMLESLDLSGNKFNSSILSSLTALSSLRKLNLMATGFKGTFDVQELDSLSNLEELDMSDNEIDNLVVPKDYRGLRKLRFLDLSGLRIRDGSKVLHSIGSFPSLKTLYLKSNNFAKTVTTTQGLCELVHLQDLYIDRNDFIGSLPWCLANLTSLRVLHVPDNQLTGNLSSSPLMHLTSIEVLLLSNNHFQIPISLEPFFNYSKLKIFHANNSLSGPFRLPTRSRKNIIALDISYNKLQGHIPVEIGKVLPNLGFLSITFNAFNGSIPSSFGDMNSLIYLDLSNNQLTGEIPEHLAMGCFNLEYLLLSNNSLQGQLFSKKNNLTKLKRLNLDGNHFIGDIPESLSNCSSLQGLYISDNDITGSIPTWIGNISFLDAIIMPDNHLEGPIPSEFCQLDYLEILDLSKNNIAGSLP*
LSNLKFLDLSHNSFNNSVLSSLAGLSSLKNLSLAYNRLEGSINIEGMNMLESLDLSGNKFNSSILSSLTALSSLRKLNLMATGFKGTFDVQELDSLSNLEELDMSDNEIDNLVVPKDYRGLRKLRFLDLSGLRIRDGSKVLHSIGSFPSLKTLYLKSNNFAKTVTTTQGLCELVHLQDLYIDRNDFIGSLPWCLANLTSLRVLHVPDNQLTGNLSSSPLMHLTSIEVLLLSNNHFQIPISLEPFFNYSKLKIFHANNSLSGPFRLPTRSRKNIIALDISYNKLQGHIPVEIGKVLPNLGFLSITFNAFNGSIPSSFGDMNSLIYLDLSNNQLTGEIPEHLAMGCFNLEYLLLSNNSLQGQLFSKKNNLTKLKRLNLDGNHFIGDIPESLSNCSSLQGLYISDNDITGSIPTWIGNISFLDAIIMPDNHLEGPIPSEFCQLDYLEILDLSKNNIAGSLPS
*SNLKFLDLSHNSFNNSVLSSLAGLSSLKNLSLAYNRLEGSINIEGMNMLESLDLSGNKFNSSILSSLTALSSLRKLNLMATGFKGTFDVQELDSLSNLEELDMSDNEIDNLVVPKDYRGLRKLRFLDLSGLRIRDGSKVLHSIGSFPSLKTLYLKSNNFAKTVTTTQGLCELVHLQDLYIDRNDFIGSLPWCLANLTSLRVLHVPDNQLTGNLSSSPLMHLTSIEVLLLSNNHFQIPISLEPFFNYSKLKIFHANNSLSGPFRLPTRSRKNIIALDISYNKLQGHIPVEIGKVLPNLGFLSITFNAFNGSIPSSFGDMNSLIYLDLSNNQLTGEIPEHLAMGCFNLEYLLLSNNSLQGQLFSKKNNLTKLKRLNLDGNHFIGDIPESLSNCSSLQGLYISDNDITGSIPTWIGNISFLDAIIMPDNHLEGPIPSEFCQLDYLEILDLSKNNIA*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LSNLKFLDLSHNSFNNSVLSSLAGLSSLKNLSLAYNRLEGSINIEGMNMLESLDLSGNKFNSSILSSLTALSSLRKLNLMATGFKGTFDVQELDSLSNLEELDMSDNEIDNLVVPKDYRGLRKLRFLDLSGLRIRDGSKVLHSIGSFPSLKTLYLKSNNFAKTVTTTQGLCELVHLQDLYIDRNDFIGSLPWCLANLTSLRVLHVPDNQLTGNLSSSPLMHLTSIEVLLLSNNHFQIPISLEPFFNYSKLKIFHANNSLSGPFRLPTRSRKNIIALDISYNKLQGHIPVEIGKVLPNLGFLSITFNAFNGSIPSSFGDMNSLIYLDLSNNQLTGEIPEHLAMGCFNLEYLLLSNNSLQGQLFSKKNNLTKLKRLNLDGNHFIGDIPESLSNCSSLQGLYISDNDITGSIPTWIGNISFLDAIIMPDNHLEGPIPSEFCQLDYLEILDLSKNNIAGSLPS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query459 2.2.26 [Sep-21-2011]
C0LGQ5 1249 LRR receptor-like serine/ no no 0.973 0.357 0.318 6e-44
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.971 0.356 0.317 2e-43
Q9FL28 1173 LRR receptor-like serine/ no no 0.980 0.383 0.314 6e-43
C0LGS2 1136 Probable LRR receptor-lik no no 0.941 0.380 0.316 2e-40
Q9LYN8 1192 Leucine-rich repeat recep no no 0.973 0.375 0.317 3e-40
Q9M0G7 1013 Leucine-rich repeat recep no no 0.969 0.439 0.318 3e-39
P93194 1109 Receptor-like protein kin N/A no 0.962 0.398 0.310 7e-39
Q9LHP4 1141 Receptor-like protein kin no no 0.978 0.393 0.317 7e-38
Q9LVP0 1102 Probable leucine-rich rep no no 0.962 0.401 0.301 2e-37
C0LGJ1 1106 Probable LRR receptor-lik no no 0.982 0.407 0.297 4e-37
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function desciption
 Score =  178 bits (452), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 155/486 (31%), Positives = 240/486 (49%), Gaps = 39/486 (8%)

Query: 1   LSNLKFLDLSHNSFNNSVLSSLAGLSSLKNLSLAYNRLEGSI--NIEGMNM-LESLDLSG 57
           L NL+ LDLS N+    +      +S L +L LA N L GS+  +I   N  LE L LSG
Sbjct: 286 LGNLQTLDLSANNLTGEIPEEFWNMSQLLDLVLANNHLSGSLPKSICSNNTNLEQLVLSG 345

Query: 58  NKFNSSILSSLTALSSLRKLNLMATGFKGT-----FDVQEL------------------D 94
            + +  I   L+   SL++L+L      G+     F++ EL                   
Sbjct: 346 TQLSGEIPVELSKCQSLKQLDLSNNSLAGSIPEALFELVELTDLYLHNNTLEGTLSPSIS 405

Query: 95  SLSNLEELDMSDNEIDNLVVPKDYRGLRKLRFLDLSGLRIRDGSKVLHSIGSFPSLKTLY 154
           +L+NL+ L +  N ++   +PK+   LRKL  L L     R   ++   IG+  SLK + 
Sbjct: 406 NLTNLQWLVLYHNNLEG-KLPKEISALRKLEVLFL--YENRFSGEIPQEIGNCTSLKMID 462

Query: 155 LKSNNFAKTVTTTQGLCELVHLQDLYIDRNDFIGSLPWCLANLTSLRVLHVPDNQLTGNL 214
           +  N+F   +  + G   L  L  L++ +N+ +G LP  L N   L +L + DNQL+G++
Sbjct: 463 MFGNHFEGEIPPSIG--RLKELNLLHLRQNELVGGLPASLGNCHQLNILDLADNQLSGSI 520

Query: 215 SSSPLMHLTSIEVLLLSNNHFQ--IPISLEPFFNYSKLKIFHANNSLSGPFRLPTRSRKN 272
            SS    L  +E L+L NN  Q  +P SL    N +++ + H  N L+G    P     +
Sbjct: 521 PSS-FGFLKGLEQLMLYNNSLQGNLPDSLISLRNLTRINLSH--NRLNGTIH-PLCGSSS 576

Query: 273 IIALDISYNKLQGHIPVEIGKVLPNLGFLSITFNAFNGSIPSSFGDMNSLIYLDLSNNQL 332
            ++ D++ N  +  IP+E+G    NL  L +  N   G IP + G +  L  LD+S+N L
Sbjct: 577 YLSFDVTNNGFEDEIPLELGNS-QNLDRLRLGKNQLTGKIPWTLGKIRELSLLDMSSNAL 635

Query: 333 TGEIPEHLAMGCFNLEYLLLSNNSLQGQLFSKKNNLTKLKRLNLDGNHFIGDIPESLSNC 392
           TG IP  L + C  L ++ L+NN L G +      L++L  L L  N F+  +P  L NC
Sbjct: 636 TGTIPLQLVL-CKKLTHIDLNNNFLSGPIPPWLGKLSQLGELKLSSNQFVESLPTELFNC 694

Query: 393 SSLQGLYISDNDITGSIPTWIGNISFLDAIIMPDNHLEGPIPSEFCQLDYLEILDLSKNN 452
           + L  L +  N + GSIP  IGN+  L+ + +  N   G +P    +L  L  L LS+N+
Sbjct: 695 TKLLVLSLDGNSLNGSIPQEIGNLGALNVLNLDKNQFSGSLPQAMGKLSKLYELRLSRNS 754

Query: 453 IAGSLP 458
           + G +P
Sbjct: 755 LTGEIP 760




Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9M0G7|PXL2_ARATH Leucine-rich repeat receptor-like protein kinase PXL2 OS=Arabidopsis thaliana GN=PXL2 PE=2 SV=1 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|C0LGJ1|Y1743_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g74360 OS=Arabidopsis thaliana GN=At1g74360 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query459
359476165 1464 PREDICTED: LRR receptor-like serine/thre 0.969 0.303 0.436 7e-73
296082108 975 unnamed protein product [Vitis vinifera] 0.908 0.427 0.418 2e-71
255581263 912 serine-threonine protein kinase, plant-t 0.932 0.469 0.426 4e-69
224113693 949 predicted protein [Populus trichocarpa] 0.928 0.448 0.391 4e-63
224124490 981 predicted protein [Populus trichocarpa] 0.928 0.434 0.340 4e-61
224120284 929 predicted protein [Populus trichocarpa] 0.991 0.489 0.343 1e-60
296084515 798 unnamed protein product [Vitis vinifera] 0.784 0.451 0.387 6e-59
224106950 863 predicted protein [Populus trichocarpa] 0.934 0.497 0.366 7e-58
224142723 923 predicted protein [Populus trichocarpa] 0.971 0.483 0.344 1e-56
224144186 973 predicted protein [Populus trichocarpa] 0.930 0.438 0.351 6e-56
>gi|359476165|ref|XP_002283141.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  281 bits (718), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 208/476 (43%), Positives = 267/476 (56%), Gaps = 31/476 (6%)

Query: 1    LSNLKFLDLSHNSFNNSVLSSLAGLSSLKNLSLAYNRLEGSINIEGMNML---ESLDLSG 57
            L  L+ L L  N FN S L SL  LS LK L L  N+LEGS+ +  +N L   E LDLS 
Sbjct: 642  LRKLRVLHLETNDFNISTLKSLGRLSLLKELYLGGNKLEGSVTLRELNNLRNLEVLDLSS 701

Query: 58   NKFNSSILSSLTALSSLRKLNLMATGFKGT-FDVQELDSLSNLEELDMSDNEIDNLVVPK 116
               +SSIL  +  ++SL+ L+L + G  G+   +Q L  L NL+ELD+SDN  +  V P 
Sbjct: 702  TNISSSILQIVEVMTSLKALSLRSNGINGSQTALQGLCKLKNLQELDLSDNGFEGSVSPC 761

Query: 117  DYRGLRKLRFLDLSGLRIRDGSKVLHSIGSFPSLKTLYLKSNNFAKTVTTTQGLCELVHL 176
                L  LR LDLS  R   G+           L+ L L  N F +T        +   L
Sbjct: 762  -LGNLTSLRALDLSKNRF-SGNLDSSLFAGLMKLEFLSLSHNVF-QTFPPISSFAKHSKL 818

Query: 177  Q--DLYIDRNDFIGSLPWCLANLTSLRVLHVPDNQLTGNLSSSPLMHLTSI--------- 225
            +  DL    N  +         L S     VP  QL     SS ++   SI         
Sbjct: 819  EVLDLICGNNTLL---------LESEDQTWVPSFQLKVFRLSSCILKTGSIPSFLHYQHD 869

Query: 226  -EVLLLSNNHFQIPISLEPFFNYSKLKIFH-ANNSLSGPFRLPTRSRKNIIALDISYNKL 283
              V+ LSN+  +         N ++L+  +  NNSL+G F LP R      A+DIS N L
Sbjct: 870  LRVVDLSNSSLEEDFPTWLMKNNTRLEELNLKNNSLTGYFHLPYRPNIFTSAIDISNNLL 929

Query: 284  QGHIPVEIGKVLPNLGFLSITFNAFNGSIPSSFGDMNSLIYLDLSNNQLTGEIPEHLAMG 343
            QG +P  I   LPNL FL+++ N+F GSIPS FG M  L++LDLSNN  TG IPE LAMG
Sbjct: 930  QGQMPSNISVSLPNLMFLNVSRNSFEGSIPS-FGGMRKLLFLDLSNNLFTGGIPEDLAMG 988

Query: 344  CFNLEYLLLSNNSLQGQLFSKKNNLTKLKRLNLDGNHFIGDIPESLSNCSSLQGLYISDN 403
            C +LEYL+LS N L GQ+F + +NL  L+ L LD NHF G IP+ LSN S L+ LY+S N
Sbjct: 989  CPSLEYLILSKNDLHGQMFPRVSNLPSLRHLELDDNHFSGKIPD-LSNSSGLERLYVSHN 1047

Query: 404  DITGSIPTWIGNISFLDAIIMPDNHLEGPIPSEFCQLDYLEILDLSKNNIAGSLPS 459
             I+G +P WIGN+S L A++MP+N LEGPIP EFC LD LE+LDLS NN++GSLPS
Sbjct: 1048 SISGKLPGWIGNMSNLAALVMPNNSLEGPIPVEFCSLDALELLDLSNNNLSGSLPS 1103




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|296082108|emb|CBI21113.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255581263|ref|XP_002531443.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223528936|gb|EEF30930.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224113693|ref|XP_002332513.1| predicted protein [Populus trichocarpa] gi|222832619|gb|EEE71096.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224124490|ref|XP_002330036.1| predicted protein [Populus trichocarpa] gi|222871461|gb|EEF08592.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224120284|ref|XP_002331010.1| predicted protein [Populus trichocarpa] gi|222872940|gb|EEF10071.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296084515|emb|CBI25536.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224106950|ref|XP_002333589.1| predicted protein [Populus trichocarpa] gi|222837497|gb|EEE75876.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142723|ref|XP_002324704.1| predicted protein [Populus trichocarpa] gi|222866138|gb|EEF03269.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224144186|ref|XP_002336117.1| predicted protein [Populus trichocarpa] gi|222873047|gb|EEF10178.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query459
TAIR|locus:2040075 935 RLP21 "AT2G25470" [Arabidopsis 0.982 0.482 0.274 2.5e-44
TAIR|locus:2037313 1000 RLP13 "AT1G74170" [Arabidopsis 0.976 0.448 0.273 9.2e-40
TAIR|locus:2019662 965 RLP15 "AT1G74190" [Arabidopsis 0.962 0.458 0.281 9.4e-38
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.976 0.394 0.276 9.6e-37
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.893 0.327 0.274 1.4e-36
TAIR|locus:2161825 1090 AT5G56040 [Arabidopsis thalian 0.732 0.308 0.324 2.3e-36
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.808 0.331 0.302 1.8e-35
TAIR|locus:2041150 1143 BRL2 "BRI1-like 2" [Arabidopsi 0.718 0.288 0.304 1.9e-24
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.893 0.328 0.281 9.6e-35
TAIR|locus:2101943 891 RLP45 "AT3G53240" [Arabidopsis 0.978 0.503 0.268 1e-34
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 428 (155.7 bits), Expect = 2.5e-44, Sum P(2) = 2.5e-44
 Identities = 127/463 (27%), Positives = 204/463 (44%)

Query:     1 LSNLKFLDLSHNSFXXXXXXXXXXXXXXXXXXXAYNRLEGSINIEGMN---MLESLDLSG 57
             L NLK +DLS N F                    YN ++G   I+G+     LE LDL  
Sbjct:   123 LRNLKIMDLSTNYFNYSTFPFLNAATSLTTLILTYNEMDGPFPIKGLKDLTNLELLDLRA 182

Query:    58 NKFNXXXXXXXXXXXXXXXXNLMATGFKGTFDVQXXXXXXXXXXXXXXXNEIDNLVVPKD 117
             NK N                +L +  F  + ++Q               N +D  +  + 
Sbjct:   183 NKLNGSMQELIHLKKLKAL-DLSSNKFSSSMELQELQNLINLEVLGLAQNHVDGPIPIEV 241

Query:   118 YRGLRKLRFLDLSGLRIRDGSKVLHSIGSFPSLKTLYLKSNNFAKTVTTTQGLCELVHLQ 177
             +  L+ LR LDL G       ++   +GS   L+ L L SN  +  + ++     L  L+
Sbjct:   242 FCKLKNLRDLDLKGNHFV--GQIPLCLGSLKKLRVLDLSSNQLSGDLPSS--FSSLESLE 297

Query:   178 DLYIDRNDFIGSLPWC-LANLTSLRVLHVPDNQLTGNLSSSPLMHLTSIEVLLLSNNHFQ 236
              L +  N+F GS     L NLT+L+ + V        + S  L++   + ++ LS+N+  
Sbjct:   298 YLSLSDNNFDGSFSLNPLTNLTNLKFVVVLRFCSLEKIPSF-LLYQKKLRLVDLSSNNLS 356

Query:   237 IPISLEPFFNYSKLKIFHANNSLSGPFRLPTRSRKNIIALDISYNKLQGHIPVEIGKVLP 296
               I      N  +L++    N+    F +PT    N+   D S N + G  P ++   LP
Sbjct:   357 GNIPTWLLTNNPELEVLQLQNNSFTIFPIPTMVH-NLQIFDFSANNI-GKFPDKMDHALP 414

Query:   297 NLGFLSITFNAFNGSIPSSFGDMNSLIYLDLSNNQLTGEIPEHLAMGCFNLEYXXXXXXX 356
             NL  L+ + N F G  P+S G+M ++ +LDLS N  +G++P     GC ++ +       
Sbjct:   415 NLVRLNGSNNGFQGYFPTSIGEMKNISFLDLSYNNFSGKLPRSFVTGCVSIMFLKLSHNK 474

Query:   357 XXXXXFSXXXXXXXXXXXXXDGNHFIGDIPESLSNCSSLQGLYISDNDITGSIPTWIGNI 416
                                 D N F G+I   LSN + L+ L +S+N ++G+IP W+   
Sbjct:   475 FSGRFLPRETNFPSLDVLRMDNNLFTGNIGGGLSNSTMLRILDMSNNGLSGAIPRWLFEF 534

Query:   417 SFLDAIIMPDNHLEGPIPSEFCQLDYLEILDLSKNNIAGSLPS 459
              +LD +++ +N LEG IP     + +L  LDLS N  +G+LPS
Sbjct:   535 PYLDYVLISNNFLEGTIPPSLLGMPFLSFLDLSGNQFSGALPS 577


GO:0007165 "signal transduction" evidence=IC
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161825 AT5G56040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041150 BRL2 "BRI1-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query459
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-41
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-41
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-35
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-18
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-10
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.002
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.003
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  157 bits (399), Expect = 2e-41
 Identities = 145/460 (31%), Positives = 215/460 (46%), Gaps = 36/460 (7%)

Query: 2   SNLKFLDLSHNSFNNSVLSSLAGLSSLKNLSLAYNRLEGSINIE--GMNMLESLDLSGNK 59
           S+LK LDL  N     + +SL  L+SL+ L+LA N+L G I  E   M  L+ + L  N 
Sbjct: 164 SSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNN 223

Query: 60  FNSSILSSLTALSSLRKLNLMATGFKGTFDVQELDSLSNLEELDMSDNEIDNLVVPKDYR 119
            +  I   +  L+SL  L+L+     G      L +L NL+ L +  N++    +P    
Sbjct: 224 LSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSS-LGNLKNLQYLFLYQNKLSG-PIPPSIF 281

Query: 120 GLRKLRFLDLSGLRIRDGSKVLHSIGSFPSLKTLYLKSNNFAKTVTTTQGLCELVHLQDL 179
            L+KL  LDLS   +    ++   +    +L+ L+L SNNF  T      L  L  LQ L
Sbjct: 282 SLQKLISLDLSDNSL--SGEIPELVIQLQNLEILHLFSNNF--TGKIPVALTSLPRLQVL 337

Query: 180 YIDRNDFIGSLPWCLANLTSLRVLHVPDNQLTGNLSSSPLMHLTSIEVLLLSNNHFQIPI 239
            +  N F G +P  L    +L VL +  N LTG                       +IP 
Sbjct: 338 QLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTG-----------------------EIPE 374

Query: 240 SLEPFFNYSKLKIFHANNSLSGPFRLPTRSRKNIIALDISYNKLQGHIPVEIGKVLPNLG 299
            L    N  KL +F  +NSL G       + +++  + +  N   G +P E  K LP + 
Sbjct: 375 GLCSSGNLFKLILF--SNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTK-LPLVY 431

Query: 300 FLSITFNAFNGSIPSSFGDMNSLIYLDLSNNQLTGEIPEHLAMGCFNLEYLLLSNNSLQG 359
           FL I+ N   G I S   DM SL  L L+ N+  G +P+  + G   LE L LS N   G
Sbjct: 432 FLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPD--SFGSKRLENLDLSRNQFSG 489

Query: 360 QLFSKKNNLTKLKRLNLDGNHFIGDIPESLSNCSSLQGLYISDNDITGSIPTWIGNISFL 419
            +  K  +L++L +L L  N   G+IP+ LS+C  L  L +S N ++G IP     +  L
Sbjct: 490 AVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVL 549

Query: 420 DAIIMPDNHLEGPIPSEFCQLDYLEILDLSKNNIAGSLPS 459
             + +  N L G IP     ++ L  +++S N++ GSLPS
Sbjct: 550 SQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPS 589


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 459
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.95
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.94
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.94
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
KOG4237498 consensus Extracellular matrix protein slit, conta 99.83
KOG4237498 consensus Extracellular matrix protein slit, conta 99.79
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.79
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.71
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.67
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.66
KOG0617264 consensus Ras suppressor protein (contains leucine 99.55
KOG0617264 consensus Ras suppressor protein (contains leucine 99.54
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.33
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.32
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.31
KOG4341483 consensus F-box protein containing LRR [General fu 99.3
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.28
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.24
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.19
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.14
KOG4341483 consensus F-box protein containing LRR [General fu 99.14
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.09
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.06
PLN03150623 hypothetical protein; Provisional 99.05
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.0
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.99
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.98
PLN03150 623 hypothetical protein; Provisional 98.9
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.9
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.88
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.85
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.84
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.83
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.83
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.81
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.64
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.6
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.53
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.52
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.47
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.38
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.31
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.29
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.28
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.22
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.21
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.14
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.09
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.06
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.03
PRK15386 426 type III secretion protein GogB; Provisional 97.98
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.98
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.94
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.87
PRK15386 426 type III secretion protein GogB; Provisional 97.87
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.85
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.73
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.66
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.63
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.41
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.15
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.19
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.77
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.58
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.09
KOG4308 478 consensus LRR-containing protein [Function unknown 94.26
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 94.11
KOG4308 478 consensus LRR-containing protein [Function unknown 92.84
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 91.48
smart0037026 LRR Leucine-rich repeats, outliers. 91.3
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.3
KOG0473 326 consensus Leucine-rich repeat protein [Function un 90.87
smart0037026 LRR Leucine-rich repeats, outliers. 89.24
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.24
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 86.38
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 84.46
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=6.8e-47  Score=388.35  Aligned_cols=447  Identities=30%  Similarity=0.464  Sum_probs=301.3

Q ss_pred             CCCcEEEccCCcccccchhhhcCCccccEEEeccccccC--CcccccCccCceEEcCCCCCCcccccccccCCCCcEEEc
Q 039778            2 SNLKFLDLSHNSFNNSVLSSLAGLSSLKNLSLAYNRLEG--SINIEGMNMLESLDLSGNKFNSSILSSLTALSSLRKLNL   79 (459)
Q Consensus         2 ~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~--~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l   79 (459)
                      ++|++|++++|.+++..+..+..+++|++|++++|.+.+  +..+.++++|++|++++|.+....+..+.++++|++|++
T Consensus       140 ~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L  219 (968)
T PLN00113        140 PNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYL  219 (968)
T ss_pred             CCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEEC
Confidence            344445555554444445555555555555555554432  233455555555555555555445555555555555555


Q ss_pred             cCCcceeeeccccccCCCCCcEEECcccccCCccCcccccCCCCCcEEecCCCccCCCCcccccccCCCcccEEEccCCc
Q 039778           80 MATGFKGTFDVQELDSLSNLEELDMSDNEIDNLVVPKDYRGLRKLRFLDLSGLRIRDGSKVLHSIGSFPSLKTLYLKSNN  159 (459)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~  159 (459)
                      ++|.+.+..+ ..+..+++|++|++++|.+.... +..+..+++|++|++++|.+...  .+..+..+++|+.|++++|.
T Consensus       220 ~~n~l~~~~p-~~l~~l~~L~~L~L~~n~l~~~~-p~~l~~l~~L~~L~L~~n~l~~~--~p~~l~~l~~L~~L~Ls~n~  295 (968)
T PLN00113        220 GYNNLSGEIP-YEIGGLTSLNHLDLVYNNLTGPI-PSSLGNLKNLQYLFLYQNKLSGP--IPPSIFSLQKLISLDLSDNS  295 (968)
T ss_pred             cCCccCCcCC-hhHhcCCCCCEEECcCceecccc-ChhHhCCCCCCEEECcCCeeecc--CchhHhhccCcCEEECcCCe
Confidence            5555443222 24555555555555555554322 44555555666666655555432  44455555666666666655


Q ss_pred             ccccccccccccCcccccEEEccccccccccchhccCCCCCcEEEcCCCcCcCcCCCCcccCCCcccEEEeecceeeeec
Q 039778          160 FAKTVTTTQGLCELVHLQDLYIDRNDFIGSLPWCLANLTSLRVLHVPDNQLTGNLSSSPLMHLTSIEVLLLSNNHFQIPI  239 (459)
Q Consensus       160 ~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~  239 (459)
                      +....+.  .+..+++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+.+ +..+..+++|+.|++++|.+.+..
T Consensus       296 l~~~~p~--~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~-p~~l~~~~~L~~L~Ls~n~l~~~~  372 (968)
T PLN00113        296 LSGEIPE--LVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEI-PKNLGKHNNLTVLDLSTNNLTGEI  372 (968)
T ss_pred             eccCCCh--hHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcC-ChHHhCCCCCcEEECCCCeeEeeC
Confidence            5433222  3445566666666666665555656666666666666666655433 344556666666666666654322


Q ss_pred             ccccccccCCceeeec-CccccCCcccCcCCCCCccEEEeccCccccccchhhhhcCCCccEEEeecCcCCCCCCCcccC
Q 039778          240 SLEPFFNYSKLKIFHA-NNSLSGPFRLPTRSRKNIIALDISYNKLQGHIPVEIGKVLPNLGFLSITFNAFNGSIPSSFGD  318 (459)
Q Consensus       240 ~~~~~~~~~~l~~~~~-~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~~~~~~~~~  318 (459)
                      . ..+....+++.+.. .+...+.....+..+++|+.|++++|.+.+..|..+.. ++.|+.+++++|.+.+..+..+..
T Consensus       373 p-~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~-l~~L~~L~Ls~N~l~~~~~~~~~~  450 (968)
T PLN00113        373 P-EGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTK-LPLVYFLDISNNNLQGRINSRKWD  450 (968)
T ss_pred             C-hhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhc-CCCCCEEECcCCcccCccChhhcc
Confidence            1 22233344444432 22333333444566788888888888888777766554 888889999988888777777778


Q ss_pred             CCCCcEEEccCCccccccchhHHhcccccceeeccccccccccccccccccCCceEEccCCcccCCCcccccccCCCcEE
Q 039778          319 MNSLIYLDLSNNQLTGEIPEHLAMGCFNLEYLLLSNNSLQGQLFSKKNNLTKLKRLNLDGNHFIGDIPESLSNCSSLQGL  398 (459)
Q Consensus       319 ~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~i~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L  398 (459)
                      +++|+.|++++|.+.+.+|...  ..++|+.|++++|++.+..+..+..+++|++|++++|.+.+..|..+..+++|++|
T Consensus       451 l~~L~~L~L~~n~~~~~~p~~~--~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L  528 (968)
T PLN00113        451 MPSLQMLSLARNKFFGGLPDSF--GSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSL  528 (968)
T ss_pred             CCCCcEEECcCceeeeecCccc--ccccceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEE
Confidence            8899999999998876666543  36889999999999998888889999999999999999998899999999999999


Q ss_pred             EcccccccCCCcccccCcccccEEEcCCCcccCCCchhhcCCCcccEEeccCCcccccCCC
Q 039778          399 YISDNDITGSIPTWIGNISFLDAIIMPDNHLEGPIPSEFCQLDYLEILDLSKNNIAGSLPS  459 (459)
Q Consensus       399 ~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~p~  459 (459)
                      ++++|.+.+.+|..+..+++|+.|+|++|++++.+|..+..+++|+.+++++|++++.+|+
T Consensus       529 ~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~  589 (968)
T PLN00113        529 DLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPS  589 (968)
T ss_pred             ECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCC
Confidence            9999999999999999999999999999999999999999999999999999999999995



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query459
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-21
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-05
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 4e-21
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-05
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-07
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 6e-06
1ogq_A 313 The Crystal Structure Of Pgip (Polygalacturonase In 8e-05
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 3e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 89.7 bits (221), Expect = 3e-18, Method: Compositional matrix adjust. Identities = 97/341 (28%), Positives = 152/341 (44%), Gaps = 15/341 (4%) Query: 124 LRFLDLSGLRIRDGSKVLHSIGSFPSLKTLYLKSNNFAKTVTTTQGLCELVHLQDLYIDR 183 L FLD+S G L G +L+ L + N + + C L+ L I Sbjct: 199 LEFLDVSSNNFSTGIPFL---GDCSALQHLDISGNKLSGDFSRAISTC--TELKLLNISS 253 Query: 184 NDFIGSLPWCLANLTSLRVLHVPDNQLTGNLSSSPLMHLTSIEVLLLSNNHFQIPISLEP 243 N F+G +P L SL+ L + +N+ TG + ++ L LS NHF + P Sbjct: 254 NQFVGPIP--PLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAV--PP 309 Query: 244 FFNYSKLKIFHAN--NSLSGPFRLPTRSR-KNIIALDISYNKLQGHIPVEIGKVLPNLGF 300 FF L A N+ SG + T + + + LD+S+N+ G +P + + +L Sbjct: 310 FFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLT 369 Query: 301 LSITFNAFNGSIPSSFGD--MNSLIYLDLSNNQLTGEIPEHLAMGCFNLEYXXXXXXXXX 358 L ++ N F+G I + N+L L L NN TG+IP L+ C L Sbjct: 370 LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLS-NCSELVSLHLSFNYLS 428 Query: 359 XXXFSXXXXXXXXXXXXXDGNHFIGDIPESLSNCSSLQGLYISDNDITGSIPTWIGNISF 418 S N G+IP+ L +L+ L + ND+TG IP+ + N + Sbjct: 429 GTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTN 488 Query: 419 LDAIIMPDNHLEGPIPSEFCQLDYLEILDLSKNNIAGSLPS 459 L+ I + +N L G IP +L+ L IL LS N+ +G++P+ Sbjct: 489 LNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPA 529
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query459
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-92
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-84
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-82
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-78
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-64
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-55
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-41
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-55
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-50
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-49
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-42
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-41
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-25
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-53
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-51
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-51
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-45
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-25
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-20
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-52
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-52
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-51
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-49
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-38
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-20
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-50
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-49
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-47
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-50
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-47
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-44
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-38
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-30
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-22
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-17
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-15
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-49
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-44
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-33
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-32
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-32
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-26
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-21
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-46
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-45
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-43
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-39
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-40
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-40
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-37
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-36
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-36
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-24
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-23
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-33
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-16
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 6e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-32
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-26
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-20
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-26
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-23
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-16
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-15
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-13
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-26
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-19
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-13
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-25
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-12
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-23
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-24
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-24
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-22
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-21
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 3e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-22
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-22
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-22
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-17
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-20
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-20
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-19
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-20
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-18
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-20
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-10
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 5e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-07
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 9e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-10
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-10
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-11
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-07
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 6e-04
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-11
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-12
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-12
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-11
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 1e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-06
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 2e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 9e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 7e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 5e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  296 bits (759), Expect = 1e-92
 Identities = 137/473 (28%), Positives = 214/473 (45%), Gaps = 29/473 (6%)

Query: 1   LSNLKFLDLSHNSFNNSV--LSSLAGLSSLKNLSLAYNRLEGSINIE---GMNMLESLDL 55
            ++L  LDLS NS +  V  L+SL   S LK L+++ N L+    +     +N LE LDL
Sbjct: 99  SASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDL 158

Query: 56  SGNKFNSSILSSLTA---LSSLRKLNLMATGFKGTFDVQELDSLSNLEELDMSDNEIDNL 112
           S N  + + +           L+ L +      G     ++    NLE LD+S N   + 
Sbjct: 159 SANSISGANVVGWVLSDGCGELKHLAISGNKISGDV---DVSRCVNLEFLDVSSNNF-ST 214

Query: 113 VVPKDYRGLRKLRFLDLSGLRIRDGSKVLHSIGSFPSLKTLYLKSNNFAKTVTTTQGLCE 172
            +P        L+ LD+SG ++        +I +   LK L + SN F   +        
Sbjct: 215 GIP-FLGDCSALQHLDISGNKL--SGDFSRAISTCTELKLLNISSNQFVGPIPPLP---- 267

Query: 173 LVHLQDLYIDRNDFIGSLP-WCLANLTSLRVLHVPDNQLTGNLSSSPLMHLTSIEVLLLS 231
           L  LQ L +  N F G +P +      +L  L +  N   G +        + +E L LS
Sbjct: 268 LKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPF-FGSCSLLESLALS 326

Query: 232 NNHFQIPISLEPFFNYSKLKIFH-ANNSLSGPFRLPT---RSRKNIIALDISYNKLQGHI 287
           +N+F   + ++       LK+   + N  SG   LP        +++ LD+S N   G I
Sbjct: 327 SNNFSGELPMDTLLKMRGLKVLDLSFNEFSGE--LPESLTNLSASLLTLDLSSNNFSGPI 384

Query: 288 PVEIGKV-LPNLGFLSITFNAFNGSIPSSFGDMNSLIYLDLSNNQLTGEIPEHLAMGCFN 346
              + +     L  L +  N F G IP +  + + L+ L LS N L+G IP  L      
Sbjct: 385 LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGS-LSK 443

Query: 347 LEYLLLSNNSLQGQLFSKKNNLTKLKRLNLDGNHFIGDIPESLSNCSSLQGLYISDNDIT 406
           L  L L  N L+G++  +   +  L+ L LD N   G+IP  LSNC++L  + +S+N +T
Sbjct: 444 LRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLT 503

Query: 407 GSIPTWIGNISFLDAIIMPDNHLEGPIPSEFCQLDYLEILDLSKNNIAGSLPS 459
           G IP WIG +  L  + + +N   G IP+E      L  LDL+ N   G++P+
Sbjct: 504 GEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPA 556


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query459
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.98
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.83
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.82
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.82
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.76
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.76
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.73
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.72
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.72
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.71
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.7
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.7
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.68
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.68
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.67
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.67
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.67
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.61
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.59
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.59
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.59
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.58
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.57
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.54
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.52
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.51
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.51
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.47
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.46
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.45
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.38
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.37
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.35
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.33
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.33
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.32
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.31
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.3
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.01
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.01
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.0
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.0
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.82
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.74
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.71
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.66
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.3
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.24
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.78
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.72
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.54
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.8
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 89.78
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 86.66
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=6e-50  Score=399.80  Aligned_cols=447  Identities=30%  Similarity=0.427  Sum_probs=354.2

Q ss_pred             CCCCcEEEccCCcccccchhhhcCCccccEEEeccccccC--CcccccCccCceEEcCCCCCCcccccccccCCCCcEEE
Q 039778            1 LSNLKFLDLSHNSFNNSVLSSLAGLSSLKNLSLAYNRLEG--SINIEGMNMLESLDLSGNKFNSSILSSLTALSSLRKLN   78 (459)
Q Consensus         1 ~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~--~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~   78 (459)
                      +++|++|++++|.+++..+. +..+++|++|++++|.+.+  +..+..+++|++|++++|.+....+..  .+++|++|+
T Consensus       199 l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~L~~L~  275 (768)
T 3rgz_A          199 CVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLS  275 (768)
T ss_dssp             CTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC--CCTTCCEEE
T ss_pred             CCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc--ccCCCCEEE
Confidence            57889999999988876665 8889999999999998775  456888999999999999886554443  788899999


Q ss_pred             ccCCcceeeeccccccCCCCCcEEECcccccCCccCcccccCCCCCcEEecCCCccCCCCccccc-ccCCCcccEEEccC
Q 039778           79 LMATGFKGTFDVQELDSLSNLEELDMSDNEIDNLVVPKDYRGLRKLRFLDLSGLRIRDGSKVLHS-IGSFPSLKTLYLKS  157 (459)
Q Consensus        79 l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~-~~~~~~L~~L~l~~  157 (459)
                      +++|.+.+.++......+++|++|++++|.+.... +..+..+++|++|++++|.+.+.  ++.. +..+++|++|++++
T Consensus       276 L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~-p~~~~~l~~L~~L~L~~n~l~~~--ip~~~l~~l~~L~~L~Ls~  352 (768)
T 3rgz_A          276 LAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAV-PPFFGSCSLLESLALSSNNFSGE--LPMDTLLKMRGLKVLDLSF  352 (768)
T ss_dssp             CCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECC-CGGGGGCTTCCEEECCSSEEEEE--CCHHHHTTCTTCCEEECCS
T ss_pred             CcCCccCCccCHHHHhhcCcCCEEECcCCcCCCcc-chHHhcCCCccEEECCCCcccCc--CCHHHHhcCCCCCEEeCcC
Confidence            99888876555533333588999999988887543 67788889999999988887632  4544 77888899999988


Q ss_pred             CcccccccccccccCcc-cccEEEccccccccccchhccC--CCCCcEEEcCCCcCcCcCCCCcccCCCcccEEEeecce
Q 039778          158 NNFAKTVTTTQGLCELV-HLQDLYIDRNDFIGSLPWCLAN--LTSLRVLHVPDNQLTGNLSSSPLMHLTSIEVLLLSNNH  234 (459)
Q Consensus       158 ~~~~~~~~~~~~~~~~~-~L~~L~l~~~~~~~~~~~~l~~--~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~  234 (459)
                      |.+.+..+.  .+..++ +|++|++++|.+.+..+..+..  +++|++|++++|.+.+.+ +..+..+++|+.|++++|.
T Consensus       353 n~l~~~~p~--~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~-p~~l~~l~~L~~L~Ls~N~  429 (768)
T 3rgz_A          353 NEFSGELPE--SLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKI-PPTLSNCSELVSLHLSFNY  429 (768)
T ss_dssp             SEEEECCCT--THHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEEC-CGGGGGCTTCCEEECCSSE
T ss_pred             CccCccccH--HHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCcccccc-CHHHhcCCCCCEEECcCCc
Confidence            887643332  355565 7888888888887766666655  677888888888877544 5667788888888888887


Q ss_pred             eeeecccccccccCCceeeecC-ccccCCcccCcCCCCCccEEEeccCccccccchhhhhcCCCccEEEeecCcCCCCCC
Q 039778          235 FQIPISLEPFFNYSKLKIFHAN-NSLSGPFRLPTRSRKNIIALDISYNKLQGHIPVEIGKVLPNLGFLSITFNAFNGSIP  313 (459)
Q Consensus       235 ~~~~~~~~~~~~~~~l~~~~~~-~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~~~~  313 (459)
                      +.+. ....+..+++++.+... +...+.....+..+++|++|++++|.+.+.+|..+.. +++|+.|++++|.+.+..+
T Consensus       430 l~~~-~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~-l~~L~~L~L~~N~l~~~~p  507 (768)
T 3rgz_A          430 LSGT-IPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSN-CTNLNWISLSNNRLTGEIP  507 (768)
T ss_dssp             EESC-CCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGG-CTTCCEEECCSSCCCSCCC
T ss_pred             ccCc-ccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhc-CCCCCEEEccCCccCCcCC
Confidence            7632 23446666777777643 3444455556667788888888888888777776654 8888888888888887788


Q ss_pred             CcccCCCCCcEEEccCCccccccchhHHhcccccceeecccccccccccc------------------------------
Q 039778          314 SSFGDMNSLIYLDLSNNQLTGEIPEHLAMGCFNLEYLLLSNNSLQGQLFS------------------------------  363 (459)
Q Consensus       314 ~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~i~~~~~~------------------------------  363 (459)
                      ..+..+++|++|++++|.+.+.+|..+. .+++|+.|++++|++.+.+|.                              
T Consensus       508 ~~~~~l~~L~~L~L~~N~l~~~~p~~l~-~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  586 (768)
T 3rgz_A          508 KWIGRLENLAILKLSNNSFSGNIPAELG-DCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKE  586 (768)
T ss_dssp             GGGGGCTTCCEEECCSSCCEEECCGGGG-GCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTT
T ss_pred             hHHhcCCCCCEEECCCCcccCcCCHHHc-CCCCCCEEECCCCccCCcCChHHhcccchhhhhcccccccccccccccccc
Confidence            8888888888888888888877776554 488888888888877654433                              


Q ss_pred             ----------------------------------------ccccccCCceEEccCCcccCCCcccccccCCCcEEEcccc
Q 039778          364 ----------------------------------------KKNNLTKLKRLNLDGNHFIGDIPESLSNCSSLQGLYISDN  403 (459)
Q Consensus       364 ----------------------------------------~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~  403 (459)
                                                              .+..+++|++|++++|.+.+.+|..+..+++|+.|++++|
T Consensus       587 ~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N  666 (768)
T 3rgz_A          587 CHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHN  666 (768)
T ss_dssp             CCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSS
T ss_pred             ccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCC
Confidence                                                    2344678999999999999999999999999999999999


Q ss_pred             cccCCCcccccCcccccEEEcCCCcccCCCchhhcCCCcccEEeccCCcccccCCC
Q 039778          404 DITGSIPTWIGNISFLDAIIMPDNHLEGPIPSEFCQLDYLEILDLSKNNIAGSLPS  459 (459)
Q Consensus       404 ~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~p~  459 (459)
                      .+.+.+|..+..+++|+.|+|++|++++.+|..+..+++|+.|+|++|+++|.+|+
T Consensus       667 ~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~  722 (768)
T 3rgz_A          667 DISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPE  722 (768)
T ss_dssp             CCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCS
T ss_pred             ccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCC
Confidence            99999999999999999999999999999999999999999999999999999995



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 459
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-16
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-08
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-06
d1ogqa_ 313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-06
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 9e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 3e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 82.4 bits (202), Expect = 1e-17
 Identities = 76/388 (19%), Positives = 145/388 (37%), Gaps = 30/388 (7%)

Query: 23  AGLSSLKNLSLAYNRLEGSINIEGMNMLESLDLSGNKFNSSILSSLTALSSLRKLNLMAT 82
             L+      L    +  +++   ++ + +L        S  +  +  L++L ++N    
Sbjct: 19  TALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKS--IDGVEYLNNLTQINFSNN 76

Query: 83  GFKGTFDVQELDSLSNLEELDMSDNEIDNLVVPKDYRGLRKLRFLDLSGLRIRDGSKVLH 142
                  ++ L  L ++   +    +I  L    +  GL            +++ + +  
Sbjct: 77  QLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNR 136

Query: 143 SIGSFPSLKTL-------YLKSNNFAKTVTTTQGLCELVHLQDLYIDRNDFIGSLPWCLA 195
              S  ++  +        L+  +F   VT  + L  L  L+ L I  N         LA
Sbjct: 137 LELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSD--ISVLA 194

Query: 196 NLTSLRVLHVPDNQLTGNLSSSPLMHLTSIEVLLLSNNHFQIPISLEPFFNYSKLKIFHA 255
            LT+L  L   +NQ++     +PL  LT+++ L L+ N  +   +L    N + L +  A
Sbjct: 195 KLTNLESLIATNNQISD---ITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDL--A 249

Query: 256 NNSLSGPFRLPTRSRKNIIALDISYNKLQGHIPVEIGKVLPNLGFLSITFNAFNGSIPSS 315
           NN +S     P      +  L +  N++    P+     L  L  L +  N       S 
Sbjct: 250 NNQISNL--APLSGLTKLTELKLGANQISNISPLAG---LTALTNLELNENQLE--DISP 302

Query: 316 FGDMNSLIYLDLSNNQLTGEIPEHLAMGCFNLEYLLLSNNSLQGQLFSKKNNLTKLKRLN 375
             ++ +L YL L  N ++   P         L+ L  +NN +     S   NLT +  L+
Sbjct: 303 ISNLKNLTYLTLYFNNISDISP---VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLS 357

Query: 376 LDGNHFIGDIPESLSNCSSLQGLYISDN 403
              N      P  L+N + +  L ++D 
Sbjct: 358 AGHNQISDLTP--LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query459
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.92
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.88
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.84
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.81
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.79
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.75
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.68
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.67
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.64
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.56
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.52
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.51
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.47
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.44
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.28
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.21
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.19
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.44
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.29
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.28
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.07
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.83
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.73
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.95  E-value=1.6e-25  Score=204.23  Aligned_cols=353  Identities=22%  Similarity=0.294  Sum_probs=213.1

Q ss_pred             cccccCCcccccCccCceEEcCCCCCCcccccccccCCCCcEEEccCCcceeeeccccccCCCCCcEEECcccccCCccC
Q 039778           35 YNRLEGSINIEGMNMLESLDLSGNKFNSSILSSLTALSSLRKLNLMATGFKGTFDVQELDSLSNLEELDMSDNEIDNLVV  114 (459)
Q Consensus        35 ~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~  114 (459)
                      ...+.+......+.+|++|+++++.+++  ...+..+++|++|++++|.+. .++  .+..+++|++|++++|.+..+. 
T Consensus        31 ~~~~~~~~~~~~l~~l~~L~l~~~~I~~--l~gl~~L~nL~~L~Ls~N~l~-~l~--~l~~L~~L~~L~L~~n~i~~i~-  104 (384)
T d2omza2          31 KTNVTDTVSQTDLDQVTTLQADRLGIKS--IDGVEYLNNLTQINFSNNQLT-DIT--PLKNLTKLVDILMNNNQIADIT-  104 (384)
T ss_dssp             CSSTTSEECHHHHTTCCEEECCSSCCCC--CTTGGGCTTCCEEECCSSCCC-CCG--GGTTCTTCCEEECCSSCCCCCG-
T ss_pred             CCCCCCccCHHHhCCCCEEECCCCCCCC--ccccccCCCCCEEeCcCCcCC-CCc--cccCCccccccccccccccccc-
Confidence            3333333334455566666666666643  234566666666666666655 222  3566666666666666665542 


Q ss_pred             cccccCCCCCcEEecCCCccCCCCcccccccCCCcccEEEccCCcccccccccccccCcccccEEEccccccccccchhc
Q 039778          115 PKDYRGLRKLRFLDLSGLRIRDGSKVLHSIGSFPSLKTLYLKSNNFAKTVTTTQGLCELVHLQDLYIDRNDFIGSLPWCL  194 (459)
Q Consensus       115 ~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l  194 (459)
                        .++.+++|+.+++.++.+.+.   . .......+.......+.+.......  ..............     .....+
T Consensus       105 --~l~~l~~L~~L~~~~~~~~~~---~-~~~~~~~~~~~~~~~~~l~~~~~~~--~~~~~~~~~~~~~~-----~~~~~~  171 (384)
T d2omza2         105 --PLANLTNLTGLTLFNNQITDI---D-PLKNLTNLNRLELSSNTISDISALS--GLTSLQQLSFGNQV-----TDLKPL  171 (384)
T ss_dssp             --GGTTCTTCCEEECCSSCCCCC---G-GGTTCTTCSEEEEEEEEECCCGGGT--TCTTCSEEEEEESC-----CCCGGG
T ss_pred             --ccccccccccccccccccccc---c-ccccccccccccccccccccccccc--cccccccccccccc-----chhhhh
Confidence              356666677776666655442   1 1223334444444444332221110  00011111111111     111122


Q ss_pred             cCCCCCcEEEcCCCcCcCcCCCCcccCCCcccEEEeecceeeeecccccccccCCceeeecCccccCCcccCcCCCCCcc
Q 039778          195 ANLTSLRVLHVPDNQLTGNLSSSPLMHLTSIEVLLLSNNHFQIPISLEPFFNYSKLKIFHANNSLSGPFRLPTRSRKNII  274 (459)
Q Consensus       195 ~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~L~  274 (459)
                      ...+.........+...   .......+++++.+.++++.+....                          ....+++|+
T Consensus       172 ~~~~~~~~~~~~~~~~~---~~~~~~~l~~~~~l~l~~n~i~~~~--------------------------~~~~~~~L~  222 (384)
T d2omza2         172 ANLTTLERLDISSNKVS---DISVLAKLTNLESLIATNNQISDIT--------------------------PLGILTNLD  222 (384)
T ss_dssp             TTCTTCCEEECCSSCCC---CCGGGGGCTTCSEEECCSSCCCCCG--------------------------GGGGCTTCC
T ss_pred             ccccccccccccccccc---cccccccccccceeeccCCccCCCC--------------------------cccccCCCC
Confidence            23333334444333322   1334456666777777666543111                          122345677


Q ss_pred             EEEeccCccccccchhhhhcCCCccEEEeecCcCCCCCCCcccCCCCCcEEEccCCccccccchhHHhcccccceeeccc
Q 039778          275 ALDISYNKLQGHIPVEIGKVLPNLGFLSITFNAFNGSIPSSFGDMNSLIYLDLSNNQLTGEIPEHLAMGCFNLEYLLLSN  354 (459)
Q Consensus       275 ~L~l~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~  354 (459)
                      +|+++++.+. .++ . ...+++|+.+++++|.+.+.  ..+..+++|+.|+++++.+. .++.  +..++.++.+.+..
T Consensus       223 ~L~l~~n~l~-~~~-~-l~~l~~L~~L~l~~n~l~~~--~~~~~~~~L~~L~l~~~~l~-~~~~--~~~~~~l~~l~~~~  294 (384)
T d2omza2         223 ELSLNGNQLK-DIG-T-LASLTNLTDLDLANNQISNL--APLSGLTKLTELKLGANQIS-NISP--LAGLTALTNLELNE  294 (384)
T ss_dssp             EEECCSSCCC-CCG-G-GGGCTTCSEEECCSSCCCCC--GGGTTCTTCSEEECCSSCCC-CCGG--GTTCTTCSEEECCS
T ss_pred             EEECCCCCCC-Ccc-h-hhcccccchhccccCccCCC--CcccccccCCEeeccCcccC-CCCc--cccccccccccccc
Confidence            7777777766 333 2 23378888888888887643  34777889999999988887 4443  34588899999999


Q ss_pred             cccccccccccccccCCceEEccCCcccCCCcccccccCCCcEEEcccccccCCCcccccCcccccEEEcCCCcccCCCc
Q 039778          355 NSLQGQLFSKKNNLTKLKRLNLDGNHFIGDIPESLSNCSSLQGLYISDNDITGSIPTWIGNISFLDAIIMPDNHLEGPIP  434 (459)
Q Consensus       355 ~~i~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~  434 (459)
                      |.+.+  +..+..+++++.|++++|.+.+..  .+..+++|++|++++|+++ .++ .+..+++|+.|++++|++++ ++
T Consensus       295 n~l~~--~~~~~~~~~l~~L~ls~n~l~~l~--~l~~l~~L~~L~L~~n~l~-~l~-~l~~l~~L~~L~l~~N~l~~-l~  367 (384)
T d2omza2         295 NQLED--ISPISNLKNLTYLTLYFNNISDIS--PVSSLTKLQRLFFANNKVS-DVS-SLANLTNINWLSAGHNQISD-LT  367 (384)
T ss_dssp             SCCSC--CGGGGGCTTCSEEECCSSCCSCCG--GGGGCTTCCEEECCSSCCC-CCG-GGGGCTTCCEEECCSSCCCB-CG
T ss_pred             ccccc--ccccchhcccCeEECCCCCCCCCc--ccccCCCCCEEECCCCCCC-CCh-hHcCCCCCCEEECCCCcCCC-Ch
Confidence            88875  345677889999999999888653  3778899999999999887 444 58889999999999999984 34


Q ss_pred             hhhcCCCcccEEeccCC
Q 039778          435 SEFCQLDYLEILDLSKN  451 (459)
Q Consensus       435 ~~~~~~~~L~~L~l~~~  451 (459)
                      . +.++++|+.|+|++|
T Consensus       368 ~-l~~l~~L~~L~L~~N  383 (384)
T d2omza2         368 P-LANLTRITQLGLNDQ  383 (384)
T ss_dssp             G-GTTCTTCSEEECCCE
T ss_pred             h-hccCCCCCEeeCCCC
Confidence            2 788999999999987



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure