Citrus Sinensis ID: 039792


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------82
MRVHQRLTHSLRKPHHKIKNCNSSNLLKSVTFSPRNPSLQSFNISTKRSVLAWFLQRPLPDNFNNKRITCYKQVHAQIAISGLQCDTFLANMLLRNYSKANDLDGARKLFDTMSERNLVSWSSLVSMYTKKGYGEEALMVFIGFLKVGNGRPDDYILSSVICACTQLGGGGDGGNVGEQMHSFVIKSGFDRDVYVGTSLMNLYAKNGSVDDAKFVFDGLMVKTAVSWTTIITGYVKSGRSDLSLNLFNQMRETDVVHDKYLLSSVLSACSMLQFVGGGKQIHAHVLRRGMGMDVSVINVLMDFYSKCGRVKMARRLFDEIEVKNIISWTTLIGGYMQNSFDREAMKLFTEMTRSGWKPDDFACSSVLTSCGSVEALEQGRQVHAYSFKANIESDNFVKNSLVDMYAKCDSLTEARKVFDVMADRNVVSYNAMIEGYSKEEKLSEALDLFHEMRVGFVPPGLLTFVSLLGLSSSVFSLESSKQIHGLIIKYGVFLDVFAGSALIDAYSKCFSNKDARLVFDEMNQRDIVVWNAMLLGYTQQLENEEAIKLYLELLLSQQRPNEFTFAALITAASNLGSLKHGQQFHNHLIKLGLDFDSFITSALIDMYAKCGSLEDAYETFGSTTWKDVACWNSMICTNAHHGEPMKALLLFREMIIEGLEPNYITFVGVLSACSHAGLIEDGLDHFQSMAGFGIEPGMEHYASVVSLLGRNVWNVELGRYAAEMAISIDPMDSGSYTLLSNTFACNSMWADAKQVRKKMDLDGLMKEAGRSWIEVNNEVHAFVARDKSHHAADLTYSILDNLILHIKGVGYVPNTSALC
cccccccHHcccccccccccccccccHHHcccccccHHHHHHHccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHcccccccEEcHHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccEEEEEccEEEEEEccccccccHHHHHHHHHHHHHHHHHccccccccccc
cccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEEHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccEEEEEccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHccccccccEEc
mrvhqrlthslrkphhkikncnssnllksvtfsprnpslqsfnisTKRSVLAWFlqrplpdnfnnkritCYKQVHAQIAISGLQCDTFLANMLLRNYSKANDLDGARKLFDTMSERNLVSWSSLVSMYTKKGYGEEALMVFIGFLkvgngrpddyiLSSVICActqlggggdggnvgEQMHSFVIKSGFDRDVYVGTSLMNLYakngsvddakfVFDGLMVKTAVSWTTIITGYVKSGRSDLSLNLFNQMRETDVVHDKYLLSSVLSACSMLQFVGGGKQIHAHVLRRGMGMDVSVINVLMDFYSKCGRVKMARRLFDEIEVKNIISWTTLIGGYMQNSFDREAMKLFTEMtrsgwkpddfacssvltscgsvealeqGRQVHAYSFkaniesdnfvkNSLVDMYAKCDSLTEARKVFDVMADRNVVSYNAMIEGYSKEEKLSEALDLFHEmrvgfvppgLLTFVSLLGLSSSVFSLESSKQIHGLIIKYGVFLDVFAGSALIDAYSKCFSNKDARLVFDEMNQRDIVVWNAMLLGYTQQLENEEAIKLYLELLLSQQRPNEFTFAALITAASnlgslkhgQQFHNHLIKLGLDFDSFITSALIDMYAKCGSLEDAYETfgsttwkdvacwnsmictnahhgePMKALLLFREMIIeglepnyiTFVGVLSACSHAGLIEDGLDHfqsmagfgiepgMEHYASVVSLLGRNVWNVELGRYAAEMAisidpmdsgsytlLSNTFACNSMWADAKQVRKKMDLDGLMKEAGRSWIEVNNEVHAFVardkshhaadLTYSILDNLILHikgvgyvpntsalc
mrvhqrlthslrkphhkikncnssnlLKSVTFSPRNPSLQSFNISTKRSVLAWFLQRPLPDNFNNKRITCYKQVHAQIAISGLQCDTFLANMLLRNYSKANDLDGARKLFDTMSERNLVSWSSLVSMYTKKGYGEEALMVFIGFLKVGNGRPDDYILSSVICACTQLGGGGDGGNVGEQMHSFVIKSGFDRDVYVGTSLMNLYAKNGSVDDAKFVFDGLMVKTAVSWTTIITGYVKSGRSDLSLNLFNQMRETDVVHDKYLLSSVLSACSMLQFVGGGKQIHAHVLRRGMGMDVSVINVLMDFYSKCGRVKMARRLFDEIEVKNIISWTTLIGGYMQNSFDREAMKLFTEMTRSGWKPDDFACSSVLTSCGSVEALEQGRQVHAYSFKaniesdnfvKNSLVDMYAKCDSLTEARKVFDVMADRNVVSYNAMIEGYSKEEKLSEALDLFHEMRVGFVPPGLLTFVSLLGLSSSVFSLESSKQIHGLIIKYGVFLDVFAGSALIDAYSKCFSNKDARLVFDEMNQRDIVVWNAMLLGYTQQLENEEAIKLYLELLLSQQRPNEFTFAALITAASNLGSLKHGQQFHNHLIKLGLDFDSFITSALIDMYAKCGSLEDAYETFGSTTWKDVACWNSMICTNAHHGEPMKALLLFREMIIEGLEPNYITFVGVLSACSHAGLIEDGLDHFQSMAGFGIEPGMEHYASVVSLLGRNVWNVELGRYAAEMAISIDPMDSGSYTLLSNTFACNSMWADAKQVRKKMDLDGLMKEAGRSWIEVNNEVHAFVARDKSHHAADLTYSILDNLILHIKGVGyvpntsalc
MRVHQRLTHSLRKPHHKIKNCNSSNLLKSVTFSPRNPSLQSFNISTKRSVLAWFLQRPLPDNFNNKRITCYKQVHAQIAISGLQCDTFLANMLLRNYSKANDLDGARKLFDTMSERNLVSWSSLVSMYTKKGYGEEALMVFIGFLKVGNGRPDDYILSSVICACTQLggggdggnvgEQMHSFVIKSGFDRDVYVGTSLMNLYAKNGSVDDAKFVFDGLMVKTAVSWTTIITGYVKSGRSDLSLNLFNQMRETDVVHDKYLLSSVLSACSMLQFVGGGKQIHAHVLRRGMGMDVSVINVLMDFYSKCGRVKMARRLFDEIEVKNIISWTTLIGGYMQNSFDREAMKLFTEMTRSGWKPDDFACSSVLTSCGSVEALEQGRQVHAYSFKANIESDNFVKNSLVDMYAKCDSLTEARKVFDVMADRNVVSYNAMIEGYSKEEKLSEALDLFHEMRVGFVPPglltfvsllglsssvfslessKQIHGLIIKYGVFLDVFAGSALIDAYSKCFSNKDARLVFDEMNQRDIVVWNAMLLGYTQQLENEEAIKLYLELLLSQQRPNEFTFAALITAASNLGSLKHGQQFHNHLIKLGLDFDSFITSALIDMYAKCGSLEDAYETFGSTTWKDVACWNSMICTNAHHGEPMKALLLFREMIIEGLEPNYITFVGVLSACSHAGLIEDGLDHFQSMAGFGIEPGMEHYASVVSLLGRNVWNVELGRYAAEMAISIDPMDSGSYTLLSNTFACNSMWADAKQVRKKMDLDGLMKEAGRSWIEVNNEVHAFVARDKSHHAADLTYSILDNLILHIKGVGYVPNTSALC
*****************************************FNISTKRSVLAWFLQRPLPDNFNNKRITCYKQVHAQIAISGLQCDTFLANMLLRNYSKANDLDGARKLFDTMSERNLVSWSSLVSMYTKKGYGEEALMVFIGFLKVGNGRPDDYILSSVICACT****************SFVIKSGFDRDVYVGTSLMNLYAKNGSVDDAKFVFDGLMVKTAVSWTTIITGYVKSGRSDLSLNLFNQMRETDVVHDKYLLSSVLSACSMLQFVGGGKQIHAHVLRRGMGMDVSVINVLMDFYSKCGRVKMARRLFDEIEVKNIISWTTLIGGYMQNSFDREAMKLFTEMTRSGWKPDDFACSSVLTSCGSVEALEQGRQVHAYSFKANIESDNFVKNSLVDMYAKCDSLTEARKVFDVMADRNVVSYNAMIEGYSKEEKLSEALDLFHEMRVGFVPPGLLTFVSLLGLSSSVFSLESSKQIHGLIIKYGVFLDVFAGSALIDAYSKCFSNKDARLVFDEMNQRDIVVWNAMLLGYTQQLENEEAIKLYLELLLSQQRPNEFTFAALITAASNLGSLKHGQQFHNHLIKLGLDFDSFITSALIDMYAKCGSLEDAYETFGSTTWKDVACWNSMICTNAHHGEPMKALLLFREMIIEGLEPNYITFVGVLSACSHAGLIEDGLDHFQSMAGFGIEPGMEHYASVVSLLGRNVWNVELGRYAAEMAISIDPMDSGSYTLLSNTFACNSMWADAKQVRKKMDLDGLMKEAGRSWIEVNNEVHAFVARDKSHHAADLTYSILDNLILHIKGVGYVP******
****QR*THSLRKPHHKIKNCNSSNLLKSVTF**************KRSVLAWFLQRPLPDNFNNKRITCYKQVHAQIAISGLQCDTFLANMLLRNYSKANDLDGARKLFDTMSERNLVSWSSLVSMYTKKGYGEEALMVFIGFLKVGNGRPDDYILSSVICACTQLGGGGDGGNVGEQMHSFVIKSGFDRDVYVGTSLMNLYAKNGSVDDAKFVFDGLMVKTAVSWTTIITGYVKSGRSDLSLNLFNQMRETDVVHDKYLLSSVLSACSMLQFVGGGKQIHAHVLRRGMGMDVSVINVLMDFYSKCGRVKMARRLFDEIEVKNIISWTTLIGGYMQNSFDREAMKLFTEMTRSGWKPDDFACSSVLTSCGSVEALEQGRQVHAYSFKANIESDNFVKNSLVDMYAKCDSLTEARKVFDVMADRNVVSYNAMIEGYSKEEKLSEALDLFHEMRVGFVPPGLLTFVSLLGLSSSVFSLESSKQIHGLIIKYGVFLDVFAGSALIDAYSKCFSNKDARLVFDEMNQRDIVVWNAMLLGYTQQLENEEAIKLYLELLLSQQRPNEFTFAALITAASNLGSLKHGQQFHNHLIKLGLDFDSFITSALIDMYAKCGSLEDAYETFGSTTWKDVACWNSMICTNAHHGEPMKALLLFREMIIEGLEPNYITFVGVLSACSHAGLIEDGLDHFQSMAGFGIEPGMEHYASVVSLLGRNVWNVELGRYAAEMAISIDPMDSGSYTLLSNTFACNSMWADAKQVRKKMDLDGLMKEAGRSWIEVNNEVHAFVARDKSHHAADLTYSILDNLILHIKGVGYVPNTSALC
*************PHHKIKNCNSSNLLKSVTFSPRNPSLQSFNISTKRSVLAWFLQRPLPDNFNNKRITCYKQVHAQIAISGLQCDTFLANMLLRNYSKANDLDGARKLFDTMSERNLVSWSSLVSMYTKKGYGEEALMVFIGFLKVGNGRPDDYILSSVICACTQLGGGGDGGNVGEQMHSFVIKSGFDRDVYVGTSLMNLYAKNGSVDDAKFVFDGLMVKTAVSWTTIITGYVKSGRSDLSLNLFNQMRETDVVHDKYLLSSVLSACSMLQFVGGGKQIHAHVLRRGMGMDVSVINVLMDFYSKCGRVKMARRLFDEIEVKNIISWTTLIGGYMQNSFDREAMKLFTEMTRSGWKPDDFACSSVLTSCGSVEALEQGRQVHAYSFKANIESDNFVKNSLVDMYAKCDSLTEARKVFDVMADRNVVSYNAMIEGYSKEEKLSEALDLFHEMRVGFVPPGLLTFVSLLGLSSSVFSLESSKQIHGLIIKYGVFLDVFAGSALIDAYSKCFSNKDARLVFDEMNQRDIVVWNAMLLGYTQQLENEEAIKLYLELLLSQQRPNEFTFAALITAASNLGSLKHGQQFHNHLIKLGLDFDSFITSALIDMYAKCGSLEDAYETFGSTTWKDVACWNSMICTNAHHGEPMKALLLFREMIIEGLEPNYITFVGVLSACSHAGLIEDGLDHFQSMAGFGIEPGMEHYASVVSLLGRNVWNVELGRYAAEMAISIDPMDSGSYTLLSNTFACNSMWADAKQVRKKMDLDGLMKEAGRSWIEVNNEVHAFVARDKSHHAADLTYSILDNLILHIKGVGYVPNTSALC
MRVHQRLTHSLRKPHHKIKNCNSSNLLKSVTFSPRNPSLQSFNISTKRSVLAWFLQRPLPDNFNNKRITCYKQVHAQIAISGLQCDTFLANMLLRNYSKANDLDGARKLFDTMSERNLVSWSSLVSMYTKKGYGEEALMVFIGFLKVGNGRPDDYILSSVICACTQLGGGGDGGNVGEQMHSFVIKSGFDRDVYVGTSLMNLYAKNGSVDDAKFVFDGLMVKTAVSWTTIITGYVKSGRSDLSLNLFNQMRETDVVHDKYLLSSVLSACSMLQFVGGGKQIHAHVLRRGMGMDVSVINVLMDFYSKCGRVKMARRLFDEIEVKNIISWTTLIGGYMQNSFDREAMKLFTEMTRSGWKPDDFACSSVLTSCGSVEALEQGRQVHAYSFKANIESDNFVKNSLVDMYAKCDSLTEARKVFDVMADRNVVSYNAMIEGYSKEEKLSEALDLFHEMRVGFVPPGLLTFVSLLGLSSSVFSLESSKQIHGLIIKYGVFLDVFAGSALIDAYSKCFSNKDARLVFDEMNQRDIVVWNAMLLGYTQQLENEEAIKLYLELLLSQQRPNEFTFAALITAASNLGSLKHGQQFHNHLIKLGLDFDSFITSALIDMYAKCGSLEDAYETFGSTTWKDVACWNSMICTNAHHGEPMKALLLFREMIIEGLEPNYITFVGVLSACSHAGLIEDGLDHFQSMAGFGIEPGMEHYASVVSLLGRNVWNVELGRYAAEMAISIDPMDSGSYTLLSNTFACNSMWADAKQVRKKMDLDGLMKEAGRSWIEVNNEVHAFVARDKSHHAADLTYSILDNLILHIKGVGYVPNTSALC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRVHQRLTHSLRKPHHKIKNCNSSNLLKSVTFSPRNPSLQSFNISTKRSVLAWFLQRPLPDNFNNKRITCYKQVHAQIAISGLQCDTFLANMLLRNYSKANDLDGARKLFDTMSERNLVSWSSLVSMYTKKGYGEEALMVFIGFLKVGNGRPDDYILSSVICACTQLGGGGDGGNVGEQMHSFVIKSGFDRDVYVGTSLMNLYAKNGSVDDAKFVFDGLMVKTAVSWTTIITGYVKSGRSDLSLNLFNQMRETDVVHDKYLLSSVLSACSMLQFVGGGKQIHAHVLRRGMGMDVSVINVLMDFYSKCGRVKMARRLFDEIEVKNIISWTTLIGGYMQNSFDREAMKLFTEMTRSGWKPDDFACSSVLTSCGSVEALEQGRQVHAYSFKANIESDNFVKNSLVDMYAKCDSLTEARKVFDVMADRNVVSYNAMIEGYSKEEKLSEALDLFHEMRVGFVPPGLLTFVSLLGLSSSVFSLESSKQIHGLIIKYGVFLDVFAGSALIDAYSKCFSNKDARLVFDEMNQRDIVVWNAMLLGYTQQLENEEAIKLYLELLLSQQRPNEFTFAALITAASNLGSLKHGQQFHNHLIKLGLDFDSFITSALIDMYAKCGSLEDAYETFGSTTWKDVACWNSMICTNAHHGEPMKALLLFREMIIEGLEPNYITFVGVLSACSHAGLIEDGLDHFQSMAGFGIEPGMEHYASVVSLLGRNVWNVELGRYAAEMAISIDPMDSGSYTLLSNTFACNSMWADAKQVRKKMDLDGLMKEAGRSWIEVNNEVHAFVARDKSHHAADLTYSILDNLILHIKGVGYVPNTSALC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query819 2.2.26 [Sep-21-2011]
Q9SVA5834 Pentatricopeptide repeat- yes no 0.896 0.880 0.555 0.0
Q9ZUW3868 Pentatricopeptide repeat- no no 0.854 0.806 0.350 1e-121
Q9FWA6903 Pentatricopeptide repeat- no no 0.877 0.796 0.322 1e-120
Q9SVP71064 Pentatricopeptide repeat- no no 0.905 0.697 0.313 1e-117
Q7Y211890 Pentatricopeptide repeat- no no 0.863 0.794 0.329 1e-114
Q5G1T1850 Pentatricopeptide repeat- no no 0.804 0.775 0.346 1e-112
Q3E6Q1809 Pentatricopeptide repeat- no no 0.780 0.789 0.338 1e-110
Q9STE1857 Pentatricopeptide repeat- no no 0.901 0.861 0.309 1e-110
Q9SN39871 Pentatricopeptide repeat- no no 0.798 0.750 0.333 1e-110
P93005727 Pentatricopeptide repeat- no no 0.748 0.843 0.350 1e-109
>sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protein At4g39530 OS=Arabidopsis thaliana GN=PCMP-E52 PE=1 SV=1 Back     alignment and function desciption
 Score =  859 bits (2220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/770 (55%), Positives = 564/770 (73%), Gaps = 36/770 (4%)

Query: 74  VHAQIAISGLQCDTFLANMLLRNYSKANDLDGARKLFDTMSERNLVSWSSLVSMYTKKGY 133
           VH QI + GL+ DT+L+N+L+  YS+A  +  ARK+F+ M ERNLVSWS++VS     G 
Sbjct: 66  VHGQIIVWGLELDTYLSNILINLYSRAGGMVYARKVFEKMPERNLVSWSTMVSACNHHGI 125

Query: 134 GEEALMVFIGFLKVGNGRPDDYILSSVICACTQLGGGGDGGNVGEQMHSFVIKSGFDRDV 193
            EE+L+VF+ F +     P++YILSS I AC+ L G G    +  Q+ SF++KSGFDRDV
Sbjct: 126 YEESLVVFLEFWRTRKDSPNEYILSSFIQACSGLDGRGRW--MVFQLQSFLVKSGFDRDV 183

Query: 194 YVGTSLMNLYAKNGSVDDAKFVFDGLMVKTAVSWTTIITGYVKSGRSDLSLNLFNQMRET 253
           YVGT L++ Y K+G++D A+ VFD L  K+ V+WTT+I+G VK GRS +SL LF Q+ E 
Sbjct: 184 YVGTLLIDFYLKDGNIDYARLVFDALPEKSTVTWTTMISGCVKMGRSYVSLQLFYQLMED 243

Query: 254 DVVHDKYLLSSVLSACSMLQFVGGGKQIHAHVLRRGMGMDVSVINVLMDFYSKCGRVKMA 313
           +VV D Y+LS+VLSACS+L F+ GGKQIHAH+LR G+ MD S++NVL+D Y KCGRV  A
Sbjct: 244 NVVPDGYILSTVLSACSILPFLEGGKQIHAHILRYGLEMDASLMNVLIDSYVKCGRVIAA 303

Query: 314 RRLFDEIEVKNIISWTTLIGGYMQNSFDREAMKLFTEMTRSGWKPDDFACSSVLTSCGSV 373
            +LF+ +  KNIISWTTL+ GY QN+  +EAM+LFT M++ G KPD +ACSS+LTSC S+
Sbjct: 304 HKLFNGMPNKNIISWTTLLSGYKQNALHKEAMELFTSMSKFGLKPDMYACSSILTSCASL 363

Query: 374 EALEQGRQVHAYSFKANIESDNFVKNSLVDMYAKCDSLTEARKVFDVMADRNVVSYNAMI 433
            AL  G QVHAY+ KAN+ +D++V NSL+DMYAKCD LT+ARKVFD+ A  +VV +NAMI
Sbjct: 364 HALGFGTQVHAYTIKANLGNDSYVTNSLIDMYAKCDCLTDARKVFDIFAAADVVLFNAMI 423

Query: 434 EGYSK---EEKLSEALDLFHEMRVGFVPPGLLTFVSLLGLSSSVFSLESSKQIHGLIIKY 490
           EGYS+   + +L EAL++F +MR   + P LLTFVSLL  S+S+ SL  SKQIHGL+ KY
Sbjct: 424 EGYSRLGTQWELHEALNIFRDMRFRLIRPSLLTFVSLLRASASLTSLGLSKQIHGLMFKY 483

Query: 491 GVFLDVFAGSALIDAYSKCFSNKDARLVFDEMNQRDIVVWNAMLLGYTQQLENEEAIKLY 550
           G+ LD+FAGSALID YS C+  KD+RLVFDEM  +D+V+WN+M  GY QQ ENEEA+ L+
Sbjct: 484 GLNLDIFAGSALIDVYSNCYCLKDSRLVFDEMKVKDLVIWNSMFAGYVQQSENEEALNLF 543

Query: 551 LELLLSQQRPNEFTFAALITAASNLGSLKHGQQFHNHLIKLGLDFDSFITSALIDMYAKC 610
           LEL LS++RP+EFTFA ++TAA NL S++ GQ+FH  L+K GL+ + +IT+AL+DMYAKC
Sbjct: 544 LELQLSRERPDEFTFANMVTAAGNLASVQLGQEFHCQLLKRGLECNPYITNALLDMYAKC 603

Query: 611 GSLEDAYETFGSTTWKDVACWNSMICTNAHHGEPMKALLLFREMIIEGLEPNYITFVGVL 670
           GS EDA++ F S   +DV CWNS+I + A+HGE  KAL +  +M+ EG+EPNYITFVGVL
Sbjct: 604 GSPEDAHKAFDSAASRDVVCWNSVISSYANHGEGKKALQMLEKMMSEGIEPNYITFVGVL 663

Query: 671 SACSHAGLIEDGLDHFQSMAGFGIEPGMEHYASVVSLLGRN------------------- 711
           SACSHAGL+EDGL  F+ M  FGIEP  EHY  +VSLLGR                    
Sbjct: 664 SACSHAGLVEDGLKQFELMLRFGIEPETEHYVCMVSLLGRAGRLNKARELIEKMPTKPAA 723

Query: 712 -VW-----------NVELGRYAAEMAISIDPMDSGSYTLLSNTFACNSMWADAKQVRKKM 759
            VW           NVEL  +AAEMAI  DP DSGS+T+LSN +A   MW +AK+VR++M
Sbjct: 724 IVWRSLLSGCAKAGNVELAEHAAEMAILSDPKDSGSFTMLSNIYASKGMWTEAKKVRERM 783

Query: 760 DLDGLMKEAGRSWIEVNNEVHAFVARDKSHHAADLTYSILDNLILHIKGV 809
            ++G++KE GRSWI +N EVH F+++DKSH  A+  Y +LD+L++ I+GV
Sbjct: 784 KVEGVVKEPGRSWIGINKEVHIFLSKDKSHCKANQIYEVLDDLLVQIRGV 833





Arabidopsis thaliana (taxid: 3702)
>sp|Q9ZUW3|PP172_ARATH Pentatricopeptide repeat-containing protein At2g27610 OS=Arabidopsis thaliana GN=PCMP-H60 PE=2 SV=1 Back     alignment and function description
>sp|Q9FWA6|PP207_ARATH Pentatricopeptide repeat-containing protein At3g02330 OS=Arabidopsis thaliana GN=PCMP-E90 PE=2 SV=2 Back     alignment and function description
>sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protein At4g13650 OS=Arabidopsis thaliana GN=PCMP-H42 PE=2 SV=2 Back     alignment and function description
>sp|Q7Y211|PP285_ARATH Pentatricopeptide repeat-containing protein At3g57430, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H81 PE=2 SV=2 Back     alignment and function description
>sp|Q5G1T1|PP272_ARATH Pentatricopeptide repeat-containing protein At3g49170, chloroplastic OS=Arabidopsis thaliana GN=EMB2261 PE=2 SV=1 Back     alignment and function description
>sp|Q3E6Q1|PPR32_ARATH Pentatricopeptide repeat-containing protein At1g11290 OS=Arabidopsis thaliana GN=PCMP-H40 PE=2 SV=1 Back     alignment and function description
>sp|Q9STE1|PP333_ARATH Pentatricopeptide repeat-containing protein At4g21300 OS=Arabidopsis thaliana GN=PCMP-E36 PE=3 SV=1 Back     alignment and function description
>sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protein At4g18750, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H45 PE=2 SV=1 Back     alignment and function description
>sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protein At2g33680 OS=Arabidopsis thaliana GN=PCMP-E19 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query819
225438557825 PREDICTED: pentatricopeptide repeat-cont 0.960 0.953 0.633 0.0
147772562732 hypothetical protein VITISV_038220 [Viti 0.835 0.934 0.662 0.0
356528519849 PREDICTED: pentatricopeptide repeat-cont 0.982 0.948 0.583 0.0
357520433 998 Pentatricopeptide repeat-containing prot 0.956 0.784 0.564 0.0
449461477837 PREDICTED: pentatricopeptide repeat-cont 0.954 0.934 0.571 0.0
297802056 1057 hypothetical protein ARALYDRAFT_352947 [ 0.894 0.693 0.561 0.0
15235115834 pentatricopeptide repeat-containing prot 0.896 0.880 0.555 0.0
115475988819 Os08g0340900 [Oryza sativa Japonica Grou 0.936 0.936 0.506 0.0
357131819822 PREDICTED: pentatricopeptide repeat-cont 0.903 0.900 0.504 0.0
255583011631 pentatricopeptide repeat-containing prot 0.770 1.0 0.596 0.0
>gi|225438557|ref|XP_002276001.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1075 bits (2780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/827 (63%), Positives = 639/827 (77%), Gaps = 40/827 (4%)

Query: 23  SSNLLKSVTFSPRNPSLQSFNISTKRSVLAWFLQRPLPDNFNNKRITCYKQVHAQIAISG 82
           ++ + K+      NP LQ  N+  KR   A  LQ  +  N     I  YK +H QI +SG
Sbjct: 2   ATGMQKTKDMEDENPCLQIPNLRPKRREFANLLQLSISRN----PIIHYKIIHGQIIVSG 57

Query: 83  LQCDTFLANMLLRNYSKANDLDGARKLFDTMSERNLVSWSSLVSMYTKKGYGEEALMVFI 142
           LQ DTFLAN+L+   SK++ +D AR +FD M  +NL++WSS+VSMY+++GY EEALMVF+
Sbjct: 58  LQSDTFLANILINVCSKSDRVDNARVVFDKMPHKNLITWSSMVSMYSQQGYSEEALMVFV 117

Query: 143 GFLKVGNGRPDDYILSSVICACTQLGGGGDGGNVGEQMHSFVIKSGFDRDVYVGTSLMNL 202
              +     P++++L+SVI ACTQLG    G     Q+H FV++SGFD+DVYVGTSL++ 
Sbjct: 118 DLQRKSGEHPNEFVLASVIRACTQLGVVEKGA----QLHGFVVRSGFDQDVYVGTSLIDF 173

Query: 203 YAKNGSVDDAKFVFDGLMVKTAVSWTTIITGYVKSGRSDLSLNLFNQMRETDVVHDKYLL 262
           Y+KNG++++A+ VFD L  KTAV+WTTII GY K GRS +SL LF QMRET+VV D+Y++
Sbjct: 174 YSKNGNIEEARLVFDQLSEKTAVTWTTIIAGYTKCGRSAVSLELFAQMRETNVVPDRYVV 233

Query: 263 SSVLSACSMLQFVGGGKQIHAHVLRRGMGMDVSVINVLMDFYSKCGRVKMARRLFDEIEV 322
           SSVLSACSML+F+ GGKQIHA+VLRRG  MDVSV+NVL+DFY+KC RVK  R+LFD++ V
Sbjct: 234 SSVLSACSMLEFLEGGKQIHAYVLRRGTEMDVSVVNVLIDFYTKCNRVKAGRKLFDQMVV 293

Query: 323 KNIISWTTLIGGYMQNSFDREAMKLFTEMTRSGWKPDDFACSSVLTSCGSVEALEQGRQV 382
           KNIISWTT+I GYMQNSFD EAMKLF EM R GWKPD FAC+SVLTSCGS EALEQGRQV
Sbjct: 294 KNIISWTTMISGYMQNSFDWEAMKLFGEMNRLGWKPDGFACTSVLTSCGSREALEQGRQV 353

Query: 383 HAYSFKANIESDNFVKNSLVDMYAKCDSLTEARKVFDVMADRNVVSYNAMIEGYSKEEKL 442
           HAY+ KAN+ESD FVKN L+DMYAK + L +A+KVFDVMA++NV+SYNAMIEGYS +EKL
Sbjct: 354 HAYTIKANLESDEFVKNGLIDMYAKSNLLIDAKKVFDVMAEQNVISYNAMIEGYSSQEKL 413

Query: 443 SEALDLFHEMRVGFVPPGLLTFVSLLGLSSSVFSLESSKQIHGLIIKYGVFLDVFAGSAL 502
           SEAL+LFHEMRV   PP LLTFVSLLG+S+S+F+LE SKQIHGLIIK+GV LD+FAGSAL
Sbjct: 414 SEALELFHEMRVRLFPPSLLTFVSLLGVSASLFALELSKQIHGLIIKFGVSLDLFAGSAL 473

Query: 503 IDAYSKCFSNKDARLVFDEMNQRDIVVWNAMLLGYTQQLENEEAIKLYLELLLSQQRPNE 562
           ID YSKC   KDAR VF+EMN++DIVVWNAM  GYTQ LENEEA+KLY  L  S+Q+PNE
Sbjct: 474 IDVYSKCSYVKDARHVFEEMNEKDIVVWNAMFFGYTQHLENEEALKLYSTLQFSRQKPNE 533

Query: 563 FTFAALITAASNLGSLKHGQQFHNHLIKLGLDFDSFITSALIDMYAKCGSLEDAYETFGS 622
           FTFAALITAASNL SL+HGQQFHN L+K+GLDF  F+T+AL+DMYAKCGS+E+A + F S
Sbjct: 534 FTFAALITAASNLASLRHGQQFHNQLVKMGLDFCPFVTNALVDMYAKCGSIEEARKMFNS 593

Query: 623 TTWKDVACWNSMICTNAHHGEPMKALLLFREMIIEGLEPNYITFVGVLSACSHAGLIEDG 682
           + W+DV CWNSMI T+A HGE  +AL +FREM+ EG++PNY+TFV VLSACSHAG +EDG
Sbjct: 594 SIWRDVVCWNSMISTHAQHGEAEEALGMFREMMKEGIQPNYVTFVAVLSACSHAGRVEDG 653

Query: 683 LDHFQSMAGFGIEPGMEHYASVVSLLGRN--------------------VW--------- 713
           L+HF SM GFGI+PG EHYA VVSLLGR+                    VW         
Sbjct: 654 LNHFNSMPGFGIKPGTEHYACVVSLLGRSGKLFEAKEFIEKMPIEPAAIVWRSLLSACRI 713

Query: 714 --NVELGRYAAEMAISIDPMDSGSYTLLSNTFACNSMWADAKQVRKKMDLDGLMKEAGRS 771
             NVELG+YAAEMAIS DP DSGSY LLSN FA   MWAD K+VR +MD   ++KE GRS
Sbjct: 714 AGNVELGKYAAEMAISTDPKDSGSYILLSNIFASKGMWADVKKVRDRMDSSEVVKEPGRS 773

Query: 772 WIEVNNEVHAFVARDKSHHAADLTYSILDNLILHIKGVGYVPNTSAL 818
           WIEVNN+V+ F+ARD +H  AD+  S+LD LI HIKG GYVP+ +AL
Sbjct: 774 WIEVNNKVNVFIARDTTHREADIG-SVLDILIQHIKGAGYVPDATAL 819




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147772562|emb|CAN67343.1| hypothetical protein VITISV_038220 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356528519|ref|XP_003532850.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like [Glycine max] Back     alignment and taxonomy information
>gi|357520433|ref|XP_003630505.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355524527|gb|AET04981.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449461477|ref|XP_004148468.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like [Cucumis sativus] gi|449515698|ref|XP_004164885.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297802056|ref|XP_002868912.1| hypothetical protein ARALYDRAFT_352947 [Arabidopsis lyrata subsp. lyrata] gi|297314748|gb|EFH45171.1| hypothetical protein ARALYDRAFT_352947 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15235115|ref|NP_195663.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75210987|sp|Q9SVA5.1|PP357_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g39530 gi|5042169|emb|CAB44688.1| putative protein [Arabidopsis thaliana] gi|7270937|emb|CAB80616.1| putative protein [Arabidopsis thaliana] gi|332661682|gb|AEE87082.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|115475988|ref|NP_001061590.1| Os08g0340900 [Oryza sativa Japonica Group] gi|38423978|dbj|BAD01706.1| PPR-repeat protein-like [Oryza sativa Japonica Group] gi|38637396|dbj|BAD03655.1| PPR-repeat protein-like [Oryza sativa Japonica Group] gi|113623559|dbj|BAF23504.1| Os08g0340900 [Oryza sativa Japonica Group] gi|215686971|dbj|BAG90841.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|357131819|ref|XP_003567531.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|255583011|ref|XP_002532274.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528034|gb|EEF30114.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query819
TAIR|locus:2122551834 AT4G39530 [Arabidopsis thalian 0.775 0.761 0.559 7.4e-222
TAIR|locus:2103483 890 OTP84 "ORGANELLE TRANSCRIPT PR 0.737 0.678 0.329 3.9e-110
TAIR|locus:2125899 990 AT4G33170 [Arabidopsis thalian 0.584 0.483 0.342 2e-96
TAIR|locus:2176927 893 AT5G52850 [Arabidopsis thalian 0.780 0.715 0.309 6.9e-96
TAIR|locus:2007116787 AT1G69350 "AT1G69350" [Arabido 0.802 0.834 0.315 2e-95
TAIR|locus:2039817836 AT2G39620 "AT2G39620" [Arabido 0.849 0.832 0.312 5.5e-92
TAIR|locus:2096414 882 AT3G03580 [Arabidopsis thalian 0.792 0.735 0.313 1e-91
TAIR|locus:2098901783 AT3G61170 [Arabidopsis thalian 0.754 0.789 0.308 3e-91
TAIR|locus:2038603 868 AT2G27610 "AT2G27610" [Arabido 0.728 0.687 0.347 4.5e-91
TAIR|locus:2064828860 AT2G40720 [Arabidopsis thalian 0.797 0.759 0.324 1.9e-90
TAIR|locus:2122551 AT4G39530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1843 (653.8 bits), Expect = 7.4e-222, Sum P(2) = 7.4e-222
 Identities = 358/640 (55%), Positives = 469/640 (73%)

Query:    74 VHAQIAISGLQCDTFLANMLLRNYSKANDLDGARKLFDTMSERNLVSWSSLVSMYTKKGY 133
             VH QI + GL+ DT+L+N+L+  YS+A  +  ARK+F+ M ERNLVSWS++VS     G 
Sbjct:    66 VHGQIIVWGLELDTYLSNILINLYSRAGGMVYARKVFEKMPERNLVSWSTMVSACNHHGI 125

Query:   134 GEEALMVFIGFLKVGNGRPDDYILSSVICACTQLXXXXXXXXXXEQMHSFVIKSGFDRDV 193
              EE+L+VF+ F +     P++YILSS I AC+ L           Q+ SF++KSGFDRDV
Sbjct:   126 YEESLVVFLEFWRTRKDSPNEYILSSFIQACSGLDGRGRWMVF--QLQSFLVKSGFDRDV 183

Query:   194 YVGTSLMNLYAKNGSVDDAKFVFDGLMVKTAVSWTTIITGYVKSGRSDLSLNLFNQMRET 253
             YVGT L++ Y K+G++D A+ VFD L  K+ V+WTT+I+G VK GRS +SL LF Q+ E 
Sbjct:   184 YVGTLLIDFYLKDGNIDYARLVFDALPEKSTVTWTTMISGCVKMGRSYVSLQLFYQLMED 243

Query:   254 DVVHDKYLLSSVLSACSMLQFVGGGKQIHAHVLRRGMGMDVSVINVLMDFYSKCGRVKMA 313
             +VV D Y+LS+VLSACS+L F+ GGKQIHAH+LR G+ MD S++NVL+D Y KCGRV  A
Sbjct:   244 NVVPDGYILSTVLSACSILPFLEGGKQIHAHILRYGLEMDASLMNVLIDSYVKCGRVIAA 303

Query:   314 RRLFDEIEVKNIISWTTLIGGYMQNSFDREAMKLFTEMTRSGWKPDDFACSSVLTSCGSV 373
              +LF+ +  KNIISWTTL+ GY QN+  +EAM+LFT M++ G KPD +ACSS+LTSC S+
Sbjct:   304 HKLFNGMPNKNIISWTTLLSGYKQNALHKEAMELFTSMSKFGLKPDMYACSSILTSCASL 363

Query:   374 EALEQGRQVHAYSFKANIESDNFVKNSLVDMYAKCDSLTEARKVFDVMADRNVVSYNAMI 433
              AL  G QVHAY+ KAN+ +D++V NSL+DMYAKCD LT+ARKVFD+ A  +VV +NAMI
Sbjct:   364 HALGFGTQVHAYTIKANLGNDSYVTNSLIDMYAKCDCLTDARKVFDIFAAADVVLFNAMI 423

Query:   434 EGYSK---EEKLSEALDLFHEMRVGFVPPXXXXXXXXXXXXXXXXXXXXXKQIHGLIIKY 490
             EGYS+   + +L EAL++F +MR   + P                     KQIHGL+ KY
Sbjct:   424 EGYSRLGTQWELHEALNIFRDMRFRLIRPSLLTFVSLLRASASLTSLGLSKQIHGLMFKY 483

Query:   491 GVFLDVFAGSALIDAYSKCFSNKDARLVFDEMNQRDIVVWNAMLLGYTQQLENEEAIKLY 550
             G+ LD+FAGSALID YS C+  KD+RLVFDEM  +D+V+WN+M  GY QQ ENEEA+ L+
Sbjct:   484 GLNLDIFAGSALIDVYSNCYCLKDSRLVFDEMKVKDLVIWNSMFAGYVQQSENEEALNLF 543

Query:   551 LELLLSQQRPNEFTFAALITAASNLGSLKHGQQFHNHLIKLGLDFDSFITSALIDMYAKC 610
             LEL LS++RP+EFTFA ++TAA NL S++ GQ+FH  L+K GL+ + +IT+AL+DMYAKC
Sbjct:   544 LELQLSRERPDEFTFANMVTAAGNLASVQLGQEFHCQLLKRGLECNPYITNALLDMYAKC 603

Query:   611 GSLEDAYETFGSTTWKDVACWNSMICTNAHHGEPMKALLLFREMIIEGLEPNYITFVGVL 670
             GS EDA++ F S   +DV CWNS+I + A+HGE  KAL +  +M+ EG+EPNYITFVGVL
Sbjct:   604 GSPEDAHKAFDSAASRDVVCWNSVISSYANHGEGKKALQMLEKMMSEGIEPNYITFVGVL 663

Query:   671 SACSHAGLIEDGLDHFQSMAGFGIEPGMEHYASVVSLLGR 710
             SACSHAGL+EDGL  F+ M  FGIEP  EHY  +VSLLGR
Sbjct:   664 SACSHAGLVEDGLKQFELMLRFGIEPETEHYVCMVSLLGR 703


GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2103483 OTP84 "ORGANELLE TRANSCRIPT PROCESSING 84" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125899 AT4G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2176927 AT5G52850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2007116 AT1G69350 "AT1G69350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039817 AT2G39620 "AT2G39620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096414 AT3G03580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098901 AT3G61170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038603 AT2G27610 "AT2G27610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2064828 AT2G40720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SVA5PP357_ARATHNo assigned EC number0.55580.89620.8800yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query819
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-132
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-103
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 5e-93
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-79
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-78
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-62
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-59
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 8e-51
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 7e-31
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-09
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 8e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-08
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-07
pfam0153531 pfam01535, PPR, PPR repeat 5e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-05
pfam0153531 pfam01535, PPR, PPR repeat 0.001
pfam0153531 pfam01535, PPR, PPR repeat 0.002
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.002
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.003
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.004
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  414 bits (1066), Expect = e-132
 Identities = 216/667 (32%), Positives = 346/667 (51%), Gaps = 34/667 (5%)

Query: 177 GEQMHSFVIKSGFDRDVYVGTSLMNLYAKNGSVDDAKFVFDGLMVKTAVSWTTIITGYVK 236
           G ++ S  + S     V +G ++++++ + G +  A +VF  +  +   SW  ++ GY K
Sbjct: 105 GSRVCSRALSSHPSLGVRLGNAMLSMFVRFGELVHAWYVFGKMPERDLFSWNVLVGGYAK 164

Query: 237 SGRSDLSLNLFNQMRETDVVHDKYLLSSVLSACSMLQFVGGGKQIHAHVLRRGMGMDVSV 296
           +G  D +L L+++M    V  D Y    VL  C  +  +  G+++HAHV+R G  +DV V
Sbjct: 165 AGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDV 224

Query: 297 INVLMDFYSKCGRVKMARRLFDEIEVKNIISWTTLIGGYMQNSFDREAMKLFTEMTRSGW 356
           +N L+  Y KCG V  AR +FD +  ++ ISW  +I GY +N    E ++LF  M     
Sbjct: 225 VNALITMYVKCGDVVSARLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMRELSV 284

Query: 357 KPDDFACSSVLTSCGSVEALEQGRQVHAYSFKANIESDNFVKNSLVDMYAKCDSLTEARK 416
            PD    +SV+++C  +     GR++H Y  K     D  V NSL+ MY    S  EA K
Sbjct: 285 DPDLMTITSVISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEK 344

Query: 417 VFDVMADRNVVSYNAMIEGYSKEEKLSEALDLFHEMRVGFVPPGLLTFVSLLGLSSSVFS 476
           VF  M  ++ VS+ AMI GY K     +AL+ +  M    V P  +T  S+L   + +  
Sbjct: 345 VFSRMETKDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGD 404

Query: 477 LESSKQIHGLIIKYGVFLDVFAGSALIDAYSKCFSNKDARLVFDEMNQRDIVVWNAMLLG 536
           L+   ++H L  + G+   V   +ALI+ YSKC     A  VF  + ++D++ W +++ G
Sbjct: 405 LDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAG 464

Query: 537 YTQQLENEEAIKLYLELLLSQQRPNEFTFAALITAASNLGSLKHGQQFHNHLIKLGLDFD 596
                   EA+  + ++LL+ + PN  T  A ++A + +G+L  G++ H H+++ G+ FD
Sbjct: 465 LRLNNRCFEALIFFRQMLLTLK-PNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFD 523

Query: 597 SFITSALIDMYAKCGSLEDAYETFGSTTWKDVACWNSMICTNAHHGEPMKALLLFREMII 656
            F+ +AL+D+Y +CG +  A+  F S   KDV  WN ++     HG+   A+ LF  M+ 
Sbjct: 524 GFLPNALLDLYVRCGRMNYAWNQFNSHE-KDVVSWNILLTGYVAHGKGSMAVELFNRMVE 582

Query: 657 EGLEPNYITFVGVLSACSHAGLIEDGLDHFQSMAG-FGIEPGMEHYASVVSLLGR----- 710
            G+ P+ +TF+ +L ACS +G++  GL++F SM   + I P ++HYA VV LLGR     
Sbjct: 583 SGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLT 642

Query: 711 ---------------NVW-----------NVELGRYAAEMAISIDPMDSGSYTLLSNTFA 744
                           VW           +VELG  AA+    +DP   G Y LL N +A
Sbjct: 643 EAYNFINKMPITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYA 702

Query: 745 CNSMWADAKQVRKKMDLDGLMKEAGRSWIEVNNEVHAFVARDKSHHAADLTYSILDNLIL 804
               W +  +VRK M  +GL  + G SW+EV  +VHAF+  D+SH       ++L+    
Sbjct: 703 DAGKWDEVARVRKTMRENGLTVDPGCSWVEVKGKVHAFLTDDESHPQIKEINTVLEGFYE 762

Query: 805 HIKGVGY 811
            +K  G 
Sbjct: 763 KMKASGL 769


Length = 857

>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 819
PLN03077857 Protein ECB2; Provisional 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.95
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.94
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.91
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.9
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.85
PRK11788389 tetratricopeptide repeat protein; Provisional 99.81
PRK11788389 tetratricopeptide repeat protein; Provisional 99.8
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.79
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.79
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.77
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.77
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.76
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.75
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.74
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.74
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.73
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.72
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.71
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.7
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.7
PRK14574 822 hmsH outer membrane protein; Provisional 99.67
PRK14574 822 hmsH outer membrane protein; Provisional 99.66
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.62
KOG2076895 consensus RNA polymerase III transcription factor 99.61
KOG2003840 consensus TPR repeat-containing protein [General f 99.54
KOG0547606 consensus Translocase of outer mitochondrial membr 99.51
KOG2076895 consensus RNA polymerase III transcription factor 99.5
KOG2003840 consensus TPR repeat-containing protein [General f 99.47
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.41
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.4
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.37
KOG1126638 consensus DNA-binding cell division cycle control 99.36
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.36
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.36
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.35
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.34
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.33
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.32
KOG1915677 consensus Cell cycle control protein (crooked neck 99.27
KOG1126638 consensus DNA-binding cell division cycle control 99.27
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.27
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.26
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.24
KOG1915677 consensus Cell cycle control protein (crooked neck 99.24
PF1304150 PPR_2: PPR repeat family 99.21
PF1304150 PPR_2: PPR repeat family 99.21
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.18
KOG0547606 consensus Translocase of outer mitochondrial membr 99.12
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.12
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.1
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.1
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.08
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.07
PRK11189296 lipoprotein NlpI; Provisional 99.06
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.06
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.06
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.06
KOG1129478 consensus TPR repeat-containing protein [General f 99.05
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.02
PRK12370553 invasion protein regulator; Provisional 98.98
KOG2376652 consensus Signal recognition particle, subunit Srp 98.97
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.96
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.95
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.95
PRK12370553 invasion protein regulator; Provisional 98.95
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.92
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.91
KOG2376652 consensus Signal recognition particle, subunit Srp 98.9
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.89
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.85
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.82
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.81
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.79
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.79
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.74
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.73
KOG1129478 consensus TPR repeat-containing protein [General f 98.7
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.69
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.69
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 98.64
PF1285434 PPR_1: PPR repeat 98.57
PF1285434 PPR_1: PPR repeat 98.54
PRK11189296 lipoprotein NlpI; Provisional 98.53
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.53
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.52
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.46
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.45
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.41
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.39
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.39
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.38
PRK04841903 transcriptional regulator MalT; Provisional 98.37
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.37
PRK10370198 formate-dependent nitrite reductase complex subuni 98.37
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.35
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.34
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.33
PLN02789320 farnesyltranstransferase 98.3
PRK04841903 transcriptional regulator MalT; Provisional 98.28
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.23
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.23
PLN02789320 farnesyltranstransferase 98.23
KOG1125579 consensus TPR repeat-containing protein [General f 98.23
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.16
KOG1128777 consensus Uncharacterized conserved protein, conta 98.1
PRK15359144 type III secretion system chaperone protein SscB; 98.07
PRK10370198 formate-dependent nitrite reductase complex subuni 98.07
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.07
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.06
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.06
KOG1128777 consensus Uncharacterized conserved protein, conta 98.04
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.04
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.03
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.98
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.95
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.92
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.91
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.91
PRK15359144 type III secretion system chaperone protein SscB; 97.88
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.88
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.86
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.85
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.83
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.83
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.82
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.78
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.78
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.77
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.75
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.74
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.69
PF1343134 TPR_17: Tetratricopeptide repeat 97.69
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.66
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.64
KOG1125579 consensus TPR repeat-containing protein [General f 97.63
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.6
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.53
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.51
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.5
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.48
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.39
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.36
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.36
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.3
KOG0553304 consensus TPR repeat-containing protein [General f 97.29
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.18
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.18
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.16
PF14432116 DYW_deaminase: DYW family of nucleic acid deaminas 97.15
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.14
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.12
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.09
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.07
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.04
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.0
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 96.97
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.97
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.95
COG3898531 Uncharacterized membrane-bound protein [Function u 96.95
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.93
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 96.91
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.89
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.89
KOG0553304 consensus TPR repeat-containing protein [General f 96.87
KOG20411189 consensus WD40 repeat protein [General function pr 96.87
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 96.85
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.84
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.83
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.83
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.82
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.81
COG3898 531 Uncharacterized membrane-bound protein [Function u 96.81
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.79
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.76
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.75
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 96.75
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.73
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.69
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.63
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.61
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.51
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.51
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.48
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.42
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.38
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.34
PF12688120 TPR_5: Tetratrico peptide repeat 96.3
COG4700251 Uncharacterized protein conserved in bacteria cont 96.29
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.24
PF12688120 TPR_5: Tetratrico peptide repeat 96.22
PRK10803263 tol-pal system protein YbgF; Provisional 96.2
PF1337173 TPR_9: Tetratricopeptide repeat 96.17
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.16
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.12
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.9
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 95.78
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 95.74
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 95.72
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 95.61
KOG20411189 consensus WD40 repeat protein [General function pr 95.56
KOG3941 406 consensus Intermediate in Toll signal transduction 95.42
COG4700251 Uncharacterized protein conserved in bacteria cont 95.39
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.37
PF1337173 TPR_9: Tetratricopeptide repeat 95.22
PRK10803263 tol-pal system protein YbgF; Provisional 95.1
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 94.98
PRK11906458 transcriptional regulator; Provisional 94.91
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 94.9
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 94.81
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.76
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 94.6
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 94.59
PF03704146 BTAD: Bacterial transcriptional activator domain; 94.39
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.36
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 94.32
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.25
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 94.24
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.21
PRK15331165 chaperone protein SicA; Provisional 94.02
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 94.0
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 93.98
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 93.88
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 93.79
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 93.76
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 93.63
PRK11906458 transcriptional regulator; Provisional 93.55
PF13512142 TPR_18: Tetratricopeptide repeat 93.16
COG0457291 NrfG FOG: TPR repeat [General function prediction 93.13
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.0
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 92.95
KOG4555175 consensus TPR repeat-containing protein [Function 92.95
KOG1941 518 consensus Acetylcholine receptor-associated protei 92.9
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 92.75
COG1729262 Uncharacterized protein conserved in bacteria [Fun 92.6
KOG2610 491 consensus Uncharacterized conserved protein [Funct 92.6
PRK15331165 chaperone protein SicA; Provisional 92.4
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 92.31
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 92.12
smart00299140 CLH Clathrin heavy chain repeat homology. 92.09
PF1342844 TPR_14: Tetratricopeptide repeat 92.04
KOG3941406 consensus Intermediate in Toll signal transduction 91.9
COG4105254 ComL DNA uptake lipoprotein [General function pred 91.9
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 91.89
COG3118304 Thioredoxin domain-containing protein [Posttransla 91.57
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 91.22
smart00299140 CLH Clathrin heavy chain repeat homology. 91.09
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 90.92
KOG1258577 consensus mRNA processing protein [RNA processing 90.3
KOG2610491 consensus Uncharacterized conserved protein [Funct 90.28
COG0457291 NrfG FOG: TPR repeat [General function prediction 90.2
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 90.07
PF1342844 TPR_14: Tetratricopeptide repeat 90.03
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 89.31
COG3629280 DnrI DNA-binding transcriptional activator of the 89.06
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 88.94
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 88.93
KOG4555175 consensus TPR repeat-containing protein [Function 88.84
PF13170297 DUF4003: Protein of unknown function (DUF4003) 88.79
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 88.51
KOG4648 536 consensus Uncharacterized conserved protein, conta 87.87
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 87.82
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 87.78
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 87.64
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 87.57
COG3629280 DnrI DNA-binding transcriptional activator of the 87.42
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 87.35
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 87.32
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 87.04
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 86.99
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 86.83
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 86.55
COG4105254 ComL DNA uptake lipoprotein [General function pred 86.48
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 86.43
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 86.32
KOG4234271 consensus TPR repeat-containing protein [General f 86.04
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 85.89
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 85.84
COG4649221 Uncharacterized protein conserved in bacteria [Fun 85.6
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 85.47
PF13170297 DUF4003: Protein of unknown function (DUF4003) 84.99
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 84.67
PF1343134 TPR_17: Tetratricopeptide repeat 84.58
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 83.74
KOG4570 418 consensus Uncharacterized conserved protein [Funct 83.6
KOG1550552 consensus Extracellular protein SEL-1 and related 83.55
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 83.16
COG4649221 Uncharacterized protein conserved in bacteria [Fun 82.57
COG1729262 Uncharacterized protein conserved in bacteria [Fun 82.4
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 82.23
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 81.67
KOG1941 518 consensus Acetylcholine receptor-associated protei 81.44
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 80.98
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 80.94
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 80.43
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=5.9e-113  Score=1006.09  Aligned_cols=696  Identities=32%  Similarity=0.579  Sum_probs=681.6

Q ss_pred             CCCcchHHHHHHHHHcCCChhhHHHHHHHHHHcCCCCCCcccHHHHHHHHhcCCCCCCCchhHHHHHHHHHHhCCCCCcc
Q 039792          115 ERNLVSWSSLVSMYTKKGYGEEALMVFIGFLKVGNGRPDDYILSSVICACTQLGGGGDGGNVGEQMHSFVIKSGFDRDVY  194 (819)
Q Consensus       115 ~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~g~~~~~~  194 (819)
                      .++..++|.+|.+|++.|++++|+.+|++| ...|+.|+..+|..++++|...+.+.    .+.++|..+.+.|..+++.
T Consensus        48 ~~~~~~~n~~i~~l~~~g~~~~A~~l~~~m-~~~g~~~~~~~~~~ll~~~~~~~~~~----~a~~~~~~~~~~~~~~~~~  122 (857)
T PLN03077         48 SSSTHDSNSQLRALCSHGQLEQALKLLESM-QELRVPVDEDAYVALFRLCEWKRAVE----EGSRVCSRALSSHPSLGVR  122 (857)
T ss_pred             ccchhhHHHHHHHHHhCCCHHHHHHHHHHH-HhcCCCCChhHHHHHHHHHhhCCCHH----HHHHHHHHHHHcCCCCCch
Confidence            467778999999999999999999999999 78889999999999999999888755    7889999999999999999


Q ss_pred             hhhHHHHHHHhcCChhHHHHHHhcCCCCCeeeHHHHHHHHHhcCCchhHHHHHHHHHHCCCCCChhhHHHHHHHhhccCC
Q 039792          195 VGTSLMNLYAKNGSVDDAKFVFDGLMVKTAVSWTTIITGYVKSGRSDLSLNLFNQMRETDVVHDKYLLSSVLSACSMLQF  274 (819)
Q Consensus       195 ~~~~ll~~~~~~g~~~~A~~~f~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~  274 (819)
                      ++|+|+.+|+++|+++.|.++|++|++||+++||+||.+|++.|++++|+++|++|...|+.||.+||+++|++|+..++
T Consensus       123 ~~n~li~~~~~~g~~~~A~~~f~~m~~~d~~~~n~li~~~~~~g~~~~A~~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~~  202 (857)
T PLN03077        123 LGNAMLSMFVRFGELVHAWYVFGKMPERDLFSWNVLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPD  202 (857)
T ss_pred             HHHHHHHHHHhCCChHHHHHHHhcCCCCCeeEHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHhCCccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhHHHHHHHHHHhCCCCchhHHHHHHHHhHhCCChHHHHHHHhcccCCCcccHHHHHHHHHcCCChhHHHHHHHHHHHC
Q 039792          275 VGGGKQIHAHVLRRGMGMDVSVINVLMDFYSKCGRVKMARRLFDEIEVKNIISWTTLIGGYMQNSFDREAMKLFTEMTRS  354 (819)
Q Consensus       275 ~~~a~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~  354 (819)
                      +..+.++|..+.+.|+.||..++|+|+.+|+++|++++|.++|++|+.+|+++||+||.+|++.|++++|+++|++|.+.
T Consensus       203 ~~~~~~~~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~lf~~m~~~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~  282 (857)
T PLN03077        203 LARGREVHAHVVRFGFELDVDVVNALITMYVKCGDVVSARLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMREL  282 (857)
T ss_pred             hhhHHHHHHHHHHcCCCcccchHhHHHHHHhcCCCHHHHHHHHhcCCCCCcchhHHHHHHHHhCCCHHHHHHHHHHHHHc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCcchHHHHHHHhcCCcchhhHHHHHHHHHHcCCCCChhHHhHHhhhhhcCCCHHHHHHHHHhcCCCCcchHHHHHH
Q 039792          355 GWKPDDFACSSVLTSCGSVEALEQGRQVHAYSFKANIESDNFVKNSLVDMYAKCDSLTEARKVFDVMADRNVVSYNAMIE  434 (819)
Q Consensus       355 g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~~~~~li~  434 (819)
                      |+.||..||+.++.+|++.|+.+.|.+++..+.+.|+.||..+||+|+.+|+++|++++|.++|++|.++|+++||++|.
T Consensus       283 g~~Pd~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~~s~n~li~  362 (857)
T PLN03077        283 SVDPDLMTITSVISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMIS  362 (857)
T ss_pred             CCCCChhHHHHHHHHHHhcCChHHHHHHHHHHHHhCCccchHHHHHHHHHHHhcCCHHHHHHHHhhCCCCCeeeHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhcCChhHHHHHHHHHHhCCCCCChhHHHHHHHHhhccCchHhHHHHHHHHHHhCCccchhhHHHHHHHHHhcCChHH
Q 039792          435 GYSKEEKLSEALDLFHEMRVGFVPPGLLTFVSLLGLSSSVFSLESSKQIHGLIIKYGVFLDVFAGSALIDAYSKCFSNKD  514 (819)
Q Consensus       435 ~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~i~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~  514 (819)
                      +|++.|++++|+++|++|.+.|+.||..||+.++.+|++.|+++.+.++++.+.+.|+.|+..++|+||++|+++|++++
T Consensus       363 ~~~~~g~~~~A~~lf~~M~~~g~~Pd~~t~~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~  442 (857)
T PLN03077        363 GYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDK  442 (857)
T ss_pred             HHHhCCCHHHHHHHHHHHHHhCCCCCceeHHHHHHHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcCCCCeeehhhhHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHhccCChHHHHHHHHHHHHhCCC
Q 039792          515 ARLVFDEMNQRDIVVWNAMLLGYTQQLENEEAIKLYLELLLSQQRPNEFTFAALITAASNLGSLKHGQQFHNHLIKLGLD  594 (819)
Q Consensus       515 A~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~  594 (819)
                      |.++|++|.++|+++||+||.+|++.|+.++|+++|++|.. +++||..||+.+|.+|++.|+++.+.+++..+.+.|+.
T Consensus       443 A~~vf~~m~~~d~vs~~~mi~~~~~~g~~~eA~~lf~~m~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~  521 (857)
T PLN03077        443 ALEVFHNIPEKDVISWTSIIAGLRLNNRCFEALIFFRQMLL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIG  521 (857)
T ss_pred             HHHHHHhCCCCCeeeHHHHHHHHHHCCCHHHHHHHHHHHHh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCCC
Confidence            99999999999999999999999999999999999999986 59999999999999999999999999999999999999


Q ss_pred             CchhHHHHHHHHHHhcCCHHHHHHHHhcCCCCChHhHHHHHHHHHhCCChHHHHHHHHHHHHcCCCCCchhHHHHHHHHH
Q 039792          595 FDSFITSALIDMYAKCGSLEDAYETFGSTTWKDVACWNSMICTNAHHGEPMKALLLFREMIIEGLEPNYITFVGVLSACS  674 (819)
Q Consensus       595 ~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~a~~  674 (819)
                      +|..++|+|+++|+|+|++++|.++|+.+ .+|+++||+||.+|+++|+.++|+++|++|.+.|+.||.+||+.++.+|+
T Consensus       522 ~~~~~~naLi~~y~k~G~~~~A~~~f~~~-~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~  600 (857)
T PLN03077        522 FDGFLPNALLDLYVRCGRMNYAWNQFNSH-EKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACS  600 (857)
T ss_pred             ccceechHHHHHHHHcCCHHHHHHHHHhc-CCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHh
Confidence            99999999999999999999999999999 99999999999999999999999999999999999999999999999999


Q ss_pred             ccCCHHHHHHHHHHHHh-cCCccCchHHHHHHHHhhcc--------------------cc-----------hhhhHHHHH
Q 039792          675 HAGLIEDGLDHFQSMAG-FGIEPGMEHYASVVSLLGRN--------------------VW-----------NVELGRYAA  722 (819)
Q Consensus       675 ~~g~~~~a~~~~~~m~~-~g~~p~~~~y~~li~~l~r~--------------------~w-----------~~~~a~~~~  722 (819)
                      +.|++++|.++|++|.+ +|+.|+..||+||+++|+|+                    .|           |++.|+.++
T Consensus       601 ~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~lv~~l~r~G~~~eA~~~~~~m~~~pd~~~~~aLl~ac~~~~~~e~~e~~a  680 (857)
T PLN03077        601 RSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAVWGALLNACRIHRHVELGELAA  680 (857)
T ss_pred             hcChHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHhCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCChHHHHHHH
Confidence            99999999999999995 99999999999999999998                    34           889999999


Q ss_pred             HHHHccCCCCchhHHHHHHHHHhCCCchHHHHHHHHHHhCCCcCCCceeEEEECCEEEEEEeCCCCCCChHHHHHHHHHH
Q 039792          723 EMAISIDPMDSGSYTLLSNTFACNSMWADAKQVRKKMDLDGLMKEAGRSWIEVNNEVHAFVARDKSHHAADLTYSILDNL  802 (819)
Q Consensus       723 ~~~~~~~p~~~~~~~~l~~~y~~~g~~~~a~~~~~~m~~~g~~~~~g~s~i~~~~~~~~f~~~~~~~~~~~~i~~~l~~l  802 (819)
                      +++++++|++++.|+.|+|+|+..|+|++|.++++.|+++|++|+||+||||++|++|.|++||++||+.++||++|++|
T Consensus       681 ~~l~~l~p~~~~~y~ll~n~ya~~g~~~~a~~vr~~M~~~g~~k~~g~s~ie~~~~~~~f~~~d~~h~~~~~i~~~l~~l  760 (857)
T PLN03077        681 QHIFELDPNSVGYYILLCNLYADAGKWDEVARVRKTMRENGLTVDPGCSWVEVKGKVHAFLTDDESHPQIKEINTVLEGF  760 (857)
T ss_pred             HHHHhhCCCCcchHHHHHHHHHHCCChHHHHHHHHHHHHcCCCCCCCccEEEECCEEEEEecCCCCCcchHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhcCCcCCCCC
Q 039792          803 ILHIKGVGYVPNTSA  817 (819)
Q Consensus       803 ~~~~~~~~~~~~~~~  817 (819)
                      ..+|++.||+||++.
T Consensus       761 ~~~~~~~g~~~~~~~  775 (857)
T PLN03077        761 YEKMKASGLAGSESS  775 (857)
T ss_pred             HHHHHhCCcCCCcch
Confidence            999999999999874



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF14432 DYW_deaminase: DYW family of nucleic acid deaminases Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query819
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-10
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-09
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-07
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-06
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 64.1 bits (154), Expect = 2e-10
 Identities = 25/210 (11%), Positives = 58/210 (27%), Gaps = 8/210 (3%)

Query: 559 RPNEFTFAALITAASNLGSLKHGQQFHNHLIKLGLDFDSFITSALIDMYAKCGSLEDAYE 618
            P E   A L+  A    SL   Q       +  L        A          L  A+ 
Sbjct: 89  SPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLAHH 148

Query: 619 TF-------GSTTWKDVACWNSMICTNAHHGEPMKALLLFREMIIEGLEPNYITFVGVLS 671
                           +  +N+++   A  G   + + +   +   GL P+ +++   L 
Sbjct: 149 LLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQ 208

Query: 672 ACSHAGLIEDGLDH-FQSMAGFGIEPGMEHYASVVSLLGRNVWNVELGRYAAEMAISIDP 730
                      ++   + M+  G++      A ++S   R      + +     ++    
Sbjct: 209 CMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQL 268

Query: 731 MDSGSYTLLSNTFACNSMWADAKQVRKKMD 760
               + + L              ++   + 
Sbjct: 269 PPPVNTSKLLRDVYAKDGRVSYPKLHLPLK 298


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query819
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.95
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.94
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.93
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.92
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.89
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.86
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.86
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.86
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.84
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.84
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.81
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.77
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.77
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.74
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.74
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.73
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.71
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.71
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.69
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.68
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.68
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.66
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.65
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.65
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.64
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.64
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.64
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.63
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.62
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.62
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.61
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.59
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.56
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.53
3u4t_A272 TPR repeat-containing protein; structural genomics 99.5
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.49
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.44
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.42
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.4
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.38
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.37
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.37
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.37
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.37
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.36
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.36
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.34
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.33
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.33
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.32
3u4t_A272 TPR repeat-containing protein; structural genomics 99.31
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.31
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.31
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.29
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.26
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.26
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.26
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.24
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.23
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.22
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.2
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.19
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.18
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.17
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.15
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.15
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.14
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.13
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.13
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.11
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.09
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.08
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.06
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.04
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.02
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.02
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.98
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.94
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.92
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.91
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.9
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.87
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.84
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.82
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.8
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.78
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.78
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.78
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.73
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.71
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.71
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.7
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.69
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.66
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.64
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.63
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.58
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.57
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.56
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.54
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.54
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.54
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.53
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.51
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.5
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.49
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.48
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.48
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.47
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.44
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.43
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.42
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.41
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.41
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.4
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.39
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.39
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.34
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.33
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.29
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.26
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.25
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.24
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.23
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.22
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.21
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.2
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.19
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.19
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.18
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.18
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.17
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.16
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.16
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.14
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.14
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.14
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.13
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.13
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.12
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.09
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.09
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.06
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.04
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.03
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.02
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.01
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.0
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.99
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.97
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.96
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.96
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.94
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.92
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.91
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.9
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.89
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.88
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.88
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.87
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.86
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.85
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.85
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.83
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.8
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.8
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.8
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.76
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.75
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.75
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.74
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.71
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.69
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.65
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.63
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.61
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.6
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.59
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.58
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.55
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.49
3k9i_A117 BH0479 protein; putative protein binding protein, 97.47
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.47
3k9i_A117 BH0479 protein; putative protein binding protein, 97.41
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.4
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.4
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.38
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.38
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.36
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.32
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.29
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.28
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.27
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.13
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.12
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.12
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.06
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.02
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.01
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.01
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.96
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.94
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.89
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.85
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.81
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 96.76
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.71
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.69
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.67
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.64
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.23
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.19
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.09
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.84
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.74
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.64
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.37
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.35
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.15
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.0
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 94.82
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 93.9
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 93.49
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 93.16
1pc2_A152 Mitochondria fission protein; unknown function; NM 92.62
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 92.07
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 91.65
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 91.21
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 91.04
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 90.71
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 90.69
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 89.84
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 89.1
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 88.77
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 87.88
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 86.72
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 85.66
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 85.35
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 82.33
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 81.56
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 81.32
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=6.2e-40  Score=375.85  Aligned_cols=497  Identities=10%  Similarity=-0.035  Sum_probs=327.0

Q ss_pred             HHhcCChhHHHHHHhcCCCCCeeeHHHHHHHHHhcCCchhHHHHHHHHHHCCCCCChhhHHHHHHHhhccCChhhHHHHH
Q 039792          203 YAKNGSVDDAKFVFDGLMVKTAVSWTTIITGYVKSGRSDLSLNLFNQMRETDVVHDKYLLSSVLSACSMLQFVGGGKQIH  282 (819)
Q Consensus       203 ~~~~g~~~~A~~~f~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~  282 (819)
                      +.+.|.+..+...|+.++.+++..|+.++..|.+.|++++|+.+|++|..  ..|+..++..+..+|...|++++|..++
T Consensus        63 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~--~~p~~~~~~~l~~~~~~~g~~~~A~~~~  140 (597)
T 2xpi_A           63 TSTDGSFLKERNAQNTDSLSREDYLRLWRHDALMQQQYKCAAFVGEKVLD--ITGNPNDAFWLAQVYCCTGDYARAKCLL  140 (597)
T ss_dssp             -------------------CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--HHCCHHHHHHHHHHHHHTTCHHHHHHHH
T ss_pred             ccccCccCCCCCccccchHHHHHHHHHHHHHHHHccCchHHHHHHHHHHh--hCCCchHHHHHHHHHHHcCcHHHHHHHH
Confidence            56678888899999999989999999999999999999999999999985  5678899999999999999999999999


Q ss_pred             HHHHHhCCCCchhHHHHHHHHhHhCCChHHHHHHHhcccCC-------------------CcccHHHHHHHHHcCCChhH
Q 039792          283 AHVLRRGMGMDVSVINVLMDFYSKCGRVKMARRLFDEIEVK-------------------NIISWTTLIGGYMQNSFDRE  343 (819)
Q Consensus       283 ~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~-------------------~~~~~~~li~~~~~~g~~~~  343 (819)
                      +.+...  ++++.+++.++.+|.++|++++|.++|+++...                   +..+|+.++.+|.+.|++++
T Consensus       141 ~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~  218 (597)
T 2xpi_A          141 TKEDLY--NRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDR  218 (597)
T ss_dssp             HHTCGG--GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHH
T ss_pred             HHHhcc--ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHH
Confidence            987543  678899999999999999999999999965433                   36789999999999999999


Q ss_pred             HHHHHHHHHHCCCCCCcch-HHHHHHHhcCCcchhhH--HHH-HHHHHHcCCCCChhHHhHHhhhhhcCCCHHHHHHHHH
Q 039792          344 AMKLFTEMTRSGWKPDDFA-CSSVLTSCGSVEALEQG--RQV-HAYSFKANIESDNFVKNSLVDMYAKCDSLTEARKVFD  419 (819)
Q Consensus       344 A~~~~~~m~~~g~~p~~~t-~~~ll~~~~~~~~~~~a--~~~-~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~  419 (819)
                      |+++|++|.+.  .|+..+ +..+...+...+..+..  ..+ +..+...+..+...+|+.++..|.+.|++++|.++|+
T Consensus       219 A~~~~~~~~~~--~p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~  296 (597)
T 2xpi_A          219 AKECYKEALMV--DAKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLS  296 (597)
T ss_dssp             HHHHHHHHHHH--CTTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHh--CchhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHH
Confidence            99999999884  465443 44444433333322221  111 4445555555566778888999999999999999999


Q ss_pred             hcCC--CCcchHHHHHHHHHhcCChhHHHHHHHHHHhCCCCCChhHHHHHHHHhhccCchHhHHHHHHHHHHhCCccchh
Q 039792          420 VMAD--RNVVSYNAMIEGYSKEEKLSEALDLFHEMRVGFVPPGLLTFVSLLGLSSSVFSLESSKQIHGLIIKYGVFLDVF  497 (819)
Q Consensus       420 ~m~~--~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~i~~~~~~~g~~~~~~  497 (819)
                      ++.+  ++..+|+.++.+|.+.|++++|+++|+++.+.+ +.+..++..++.++...|+.++|..+++.+.+.. ..+..
T Consensus       297 ~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~  374 (597)
T 2xpi_A          297 SINGLEKSSDLLLCKADTLFVRSRFIDVLAITTKILEID-PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEKAV  374 (597)
T ss_dssp             TSTTGGGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTSHH
T ss_pred             HhhcCCchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cccHH
Confidence            9987  788999999999999999999999999998654 2355556666666666666666666666665433 22444


Q ss_pred             hHHHHHHHHHhcCChHHHHHHHHhcCC---CCeeehhhhHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHhc
Q 039792          498 AGSALIDAYSKCFSNKDARLVFDEMNQ---RDIVVWNAMLLGYTQQLENEEAIKLYLELLLSQQRPNEFTFAALITAASN  574 (819)
Q Consensus       498 ~~~~li~~~~~~g~~~~A~~~~~~~~~---~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~  574 (819)
                      +++.++.+|.+.|++++|.++|+++.+   .+..+|+.++.+|.+.|++++|+++|+++.                    
T Consensus       375 ~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~--------------------  434 (597)
T 2xpi_A          375 TWLAVGIYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFAHSFAIEGEHDQAISAYTTAA--------------------  434 (597)
T ss_dssp             HHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHH--------------------
T ss_pred             HHHHHHHHHHHhccHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHH--------------------
Confidence            555555555555555555555554432   233344444444544555555554444444                    


Q ss_pred             cCChHHHHHHHHHHHHhCCCCchhHHHHHHHHHHhcCCHHHHHHHHhcCC---CCChHhHHHHHHHHHhCCChHHHHHHH
Q 039792          575 LGSLKHGQQFHNHLIKLGLDFDSFITSALIDMYAKCGSLEDAYETFGSTT---WKDVACWNSMICTNAHHGEPMKALLLF  651 (819)
Q Consensus       575 ~g~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~---~~~~~~~~~li~~~~~~g~~~~A~~~~  651 (819)
                                     +.++. +..+++.++.+|.+.|++++|.++|+++.   +.+..+|+.++..|.+.|++++|+++|
T Consensus       435 ---------------~~~~~-~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~  498 (597)
T 2xpi_A          435 ---------------RLFQG-THLPYLFLGMQHMQLGNILLANEYLQSSYALFQYDPLLLNELGVVAFNKSDMQTAINHF  498 (597)
T ss_dssp             ---------------HTTTT-CSHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHTTCHHHHHHHH
T ss_pred             ---------------HhCcc-chHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHhCCHHHHHHHH
Confidence                           33321 44445555555555555555555555443   234555555555555556666666666


Q ss_pred             HHHHHc----CCCCC--chhHHHHHHHHHccCCHHHHHHHHHHHHhcCCccCchHHHHHHHHhhcccchhhhHHHHHHHH
Q 039792          652 REMIIE----GLEPN--YITFVGVLSACSHAGLIEDGLDHFQSMAGFGIEPGMEHYASVVSLLGRNVWNVELGRYAAEMA  725 (819)
Q Consensus       652 ~~m~~~----g~~p~--~~t~~~ll~a~~~~g~~~~a~~~~~~m~~~g~~p~~~~y~~li~~l~r~~w~~~~a~~~~~~~  725 (819)
                      +++.+.    +..|+  ..+|..++.+|.+.|++++|.++|+++.+.+ ..+...|..+...|.+.+ +.+.|...++++
T Consensus       499 ~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-p~~~~~~~~l~~~~~~~g-~~~~A~~~~~~~  576 (597)
T 2xpi_A          499 QNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLS-TNDANVHTAIALVYLHKK-IPGLAITHLHES  576 (597)
T ss_dssp             HHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHS-SCCHHHHHHHHHHHHHTT-CHHHHHHHHHHH
T ss_pred             HHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhC-CCChHHHHHHHHHHHHhC-CHHHHHHHHHHH
Confidence            665553    44555  3456666666666666666666666665522 123445555555555443 556666666777


Q ss_pred             HccCCCCchhHHHHHHHHHh
Q 039792          726 ISIDPMDSGSYTLLSNTFAC  745 (819)
Q Consensus       726 ~~~~p~~~~~~~~l~~~y~~  745 (819)
                      ++++|+++..|..|+++|..
T Consensus       577 l~~~p~~~~~~~~l~~~~~~  596 (597)
T 2xpi_A          577 LAISPNEIMASDLLKRALEE  596 (597)
T ss_dssp             HHHCTTCHHHHHHHHHTTC-
T ss_pred             HhcCCCChHHHHHHHHHHhc
Confidence            77788888888888877743



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query819
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.83
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.8
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.34
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.26
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.92
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.92
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.83
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.8
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.66
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.66
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.6
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.58
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.57
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.44
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.4
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.22
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.22
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.12
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.1
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.06
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.05
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.99
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.92
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.91
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.89
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.88
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.8
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.75
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.74
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.73
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.73
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.68
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.49
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.46
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.45
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.43
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.42
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.4
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.4
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.38
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.21
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.13
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.1
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.09
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.07
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.05
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.04
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.04
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 96.92
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.69
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.37
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.06
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.04
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 94.78
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 93.52
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 92.3
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 91.68
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 90.74
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 89.95
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 88.9
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.83  E-value=6.5e-18  Score=178.36  Aligned_cols=240  Identities=13%  Similarity=0.105  Sum_probs=174.5

Q ss_pred             HHHHHHhcCChHHHHHHHHhcCC--C-CeeehhhhHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHhccCCh
Q 039792          502 LIDAYSKCFSNKDARLVFDEMNQ--R-DIVVWNAMLLGYTQQLENEEAIKLYLELLLSQQRPNEFTFAALITAASNLGSL  578 (819)
Q Consensus       502 li~~~~~~g~~~~A~~~~~~~~~--~-~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~g~~  578 (819)
                      ........+....+...+.....  | +...+..+...+...|++++|...+++..... +-+...+..+...+...|++
T Consensus       141 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~  219 (388)
T d1w3ba_         141 LGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYINLGNVLKEARIF  219 (388)
T ss_dssp             HHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCT
T ss_pred             ccccccccchhhhhHHHHHHhhccCcchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHHHhhhhhccccH
Confidence            33344444555555544444332  2 33455566667777778888888877776542 23456677777788888888


Q ss_pred             HHHHHHHHHHHHhCCCCchhHHHHHHHHHHhcCCHHHHHHHHhcCC---CCChHhHHHHHHHHHhCCChHHHHHHHHHHH
Q 039792          579 KHGQQFHNHLIKLGLDFDSFITSALIDMYAKCGSLEDAYETFGSTT---WKDVACWNSMICTNAHHGEPMKALLLFREMI  655 (819)
Q Consensus       579 ~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~---~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~  655 (819)
                      ++|...+....+.+.. +...+..+...|.+.|++++|.+.|++..   +.+..+|..+...+...|++++|++.++...
T Consensus       220 ~~A~~~~~~~~~~~~~-~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~  298 (388)
T d1w3ba_         220 DRAVAAYLRALSLSPN-HAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTAL  298 (388)
T ss_dssp             THHHHHHHHHHHHCTT-CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHhHHHhhh-HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhh
Confidence            8888888888776654 56677778888888888888888887654   4456788888888888888889988888887


Q ss_pred             HcCCCCC-chhHHHHHHHHHccCCHHHHHHHHHHHHhcCCccC-chHHHHHHHHhhcccchhhhHHHHHHHHHccCCCCc
Q 039792          656 IEGLEPN-YITFVGVLSACSHAGLIEDGLDHFQSMAGFGIEPG-MEHYASVVSLLGRNVWNVELGRYAAEMAISIDPMDS  733 (819)
Q Consensus       656 ~~g~~p~-~~t~~~ll~a~~~~g~~~~a~~~~~~m~~~g~~p~-~~~y~~li~~l~r~~w~~~~a~~~~~~~~~~~p~~~  733 (819)
                      .  ..|+ ...+..+...+...|++++|.+.|++..+  +.|+ ...+..+...+-+.+ +.+.|...++++++++|+++
T Consensus       299 ~--~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~--~~p~~~~~~~~la~~~~~~g-~~~~A~~~~~~al~l~P~~~  373 (388)
T d1w3ba_         299 R--LCPTHADSLNNLANIKREQGNIEEAVRLYRKALE--VFPEFAAAHSNLASVLQQQG-KLQEALMHYKEAIRISPTFA  373 (388)
T ss_dssp             H--HCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTT--SCTTCHHHHHHHHHHHHTTT-CCHHHHHHHHHHHTTCTTCH
T ss_pred             c--cCCccchhhhHHHHHHHHCCCHHHHHHHHHHHHH--hCCCCHHHHHHHHHHHHHcC-CHHHHHHHHHHHHHhCCCCH
Confidence            7  4554 45677788888888999999988888876  3344 334555555554443 78889999999999999999


Q ss_pred             hhHHHHHHHHHhCCC
Q 039792          734 GSYTLLSNTFACNSM  748 (819)
Q Consensus       734 ~~~~~l~~~y~~~g~  748 (819)
                      .+|..|+++|.+.||
T Consensus       374 ~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         374 DAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHHHcCC
Confidence            999999999998886



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure