Citrus Sinensis ID: 039842
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 284 | ||||||
| 255540193 | 253 | Protein yrdA, putative [Ricinus communis | 0.880 | 0.988 | 0.742 | 1e-115 | |
| 449520511 | 244 | PREDICTED: gamma carbonic anhydrase-like | 0.859 | 1.0 | 0.735 | 1e-114 | |
| 449440536 | 244 | PREDICTED: gamma carbonic anhydrase-like | 0.859 | 1.0 | 0.718 | 1e-111 | |
| 224119706 | 251 | predicted protein [Populus trichocarpa] | 0.830 | 0.940 | 0.755 | 1e-109 | |
| 356513425 | 253 | PREDICTED: uncharacterized protein At5g6 | 0.862 | 0.968 | 0.702 | 1e-107 | |
| 356527967 | 253 | PREDICTED: uncharacterized protein At3g4 | 0.862 | 0.968 | 0.702 | 1e-107 | |
| 388490758 | 253 | unknown [Lotus japonicus] | 0.890 | 1.0 | 0.711 | 1e-106 | |
| 255646687 | 253 | unknown [Glycine max] | 0.890 | 1.0 | 0.707 | 1e-106 | |
| 388509710 | 253 | unknown [Medicago truncatula] | 0.890 | 1.0 | 0.697 | 1e-105 | |
| 297793931 | 252 | hypothetical protein ARALYDRAFT_496538 [ | 0.876 | 0.988 | 0.695 | 1e-105 |
| >gi|255540193|ref|XP_002511161.1| Protein yrdA, putative [Ricinus communis] gi|223550276|gb|EEF51763.1| Protein yrdA, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 419 bits (1077), Expect = e-115, Method: Compositional matrix adjust.
Identities = 211/284 (74%), Positives = 232/284 (81%), Gaps = 34/284 (11%)
Query: 2 AALARITRRALTTQLS-HGHVIRRAFSTSAAATATATATTTKADAKSITPSADRVKWDYR 60
AAL+RI+++ALT+ +S H ++R FS + + +++ T KSITPSADRVKWDYR
Sbjct: 3 AALSRISKKALTSTISPQCHFLKRGFSAAESLSSSPT--------KSITPSADRVKWDYR 54
Query: 61 GQRQIIPLGQWVPKVAVDAYVAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNV 120
GQRQIIPLGQW+PKVAVDAYVAPNVVLAGQVTV DGASVW GSVLRGDLNKITVGFCSNV
Sbjct: 55 GQRQIIPLGQWLPKVAVDAYVAPNVVLAGQVTVWDGASVWSGSVLRGDLNKITVGFCSNV 114
Query: 121 QERCVLHAAWNSPYRFVGFVSLLIDLQMSCPRSNSLYIAWLPAETSIERFVTIGAYCSLR 180
QERCV+HAAWNSP LPAETSIER+VTIGAY LR
Sbjct: 115 QERCVVHAAWNSP-------------------------TGLPAETSIERYVTIGAYSLLR 149
Query: 181 SCTIEPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPTGELWAGNPARFVRTLTHE 240
SCTIEPECIIGQHSILMEGS+VETH+ILEAGSV+PPGRRIPTGELWAGNPARFVR LTHE
Sbjct: 150 SCTIEPECIIGQHSILMEGSLVETHSILEAGSVVPPGRRIPTGELWAGNPARFVRALTHE 209
Query: 241 ETLEIPKLAVAINDLSKSHFSEFLPYSTVYLEVEKFKKSLGITI 284
ETLEIPKLAVAINDLSK+HFSEFLPYSTVYLEVEK KK LGI+I
Sbjct: 210 ETLEIPKLAVAINDLSKNHFSEFLPYSTVYLEVEKMKKKLGISI 253
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449520511|ref|XP_004167277.1| PREDICTED: gamma carbonic anhydrase-like 2, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449440536|ref|XP_004138040.1| PREDICTED: gamma carbonic anhydrase-like 2, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224119706|ref|XP_002318141.1| predicted protein [Populus trichocarpa] gi|118488068|gb|ABK95854.1| unknown [Populus trichocarpa] gi|222858814|gb|EEE96361.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356513425|ref|XP_003525414.1| PREDICTED: uncharacterized protein At5g63510, mitochondrial-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356527967|ref|XP_003532577.1| PREDICTED: uncharacterized protein At3g48680, mitochondrial-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388490758|gb|AFK33445.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|255646687|gb|ACU23817.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388509710|gb|AFK42921.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297793931|ref|XP_002864850.1| hypothetical protein ARALYDRAFT_496538 [Arabidopsis lyrata subsp. lyrata] gi|297310685|gb|EFH41109.1| hypothetical protein ARALYDRAFT_496538 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 284 | ||||||
| TAIR|locus:2114445 | 256 | GAMMA CAL2 "gamma carbonic anh | 0.619 | 0.687 | 0.647 | 4.3e-54 | |
| TIGR_CMR|APH_1197 | 170 | APH_1197 "hexapeptide transfer | 0.338 | 0.564 | 0.416 | 1.1e-27 | |
| TIGR_CMR|NSE_0045 | 185 | NSE_0045 "hexapeptide transfer | 0.345 | 0.529 | 0.387 | 2.5e-26 | |
| TIGR_CMR|ECH_1066 | 170 | ECH_1066 "hexapeptide transfer | 0.338 | 0.564 | 0.364 | 1.2e-24 | |
| UNIPROTKB|Q48AV3 | 179 | CPS_0032 "Bacterial transferas | 0.320 | 0.508 | 0.285 | 1.8e-22 | |
| TIGR_CMR|CPS_0032 | 179 | CPS_0032 "bacterial transferas | 0.320 | 0.508 | 0.285 | 1.8e-22 | |
| UNIPROTKB|Q81KI7 | 170 | BAS4655 "Bacterial transferase | 0.288 | 0.482 | 0.365 | 1.1e-21 | |
| TIGR_CMR|BA_5010 | 170 | BA_5010 "bacterial transferase | 0.288 | 0.482 | 0.365 | 1.1e-21 | |
| UNIPROTKB|Q482R8 | 173 | CPS_2224 "Bacterial transferas | 0.221 | 0.364 | 0.412 | 4.2e-21 | |
| TIGR_CMR|CPS_2224 | 173 | CPS_2224 "bacterial transferas | 0.221 | 0.364 | 0.412 | 4.2e-21 |
| TAIR|locus:2114445 GAMMA CAL2 "gamma carbonic anhydrase-like 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 559 (201.8 bits), Expect = 4.3e-54, P = 4.3e-54
Identities = 125/193 (64%), Positives = 143/193 (74%)
Query: 97 ASVWPGSVLRGDLNKITVGFCSNVQERCVLHAAWNSPYRFVGFVSLLIDLQMSCPRSNSL 156
A V P VL G ++TV S+V VL N VGF S ++Q C +
Sbjct: 76 AYVAPNVVLAG---QVTVWDGSSVWNGAVLRGDLNKIT--VGFCS---NVQERCV----V 123
Query: 157 YIAW-----LPAETSIERFVTIGAYCSLRSCTIEPECIIGQHSILMEGSMVETHAILEAG 211
+ AW LPA+T I+R+VT+GAY LRSCTIEPECIIGQHSILMEGS+VET +ILEAG
Sbjct: 124 HAAWSSPTGLPAQTLIDRYVTVGAYSLLRSCTIEPECIIGQHSILMEGSLVETRSILEAG 183
Query: 212 SVLPPGRRIPTGELWAGNPARFVRTLTHEETLEIPKLAVAINDLSKSHFSEFLPYSTVYL 271
SVLPPGRRIP+GELW GNPARF+RTLT+EETLEIPKLAVAIN LS +FSEFLPYST+YL
Sbjct: 184 SVLPPGRRIPSGELWGGNPARFIRTLTNEETLEIPKLAVAINHLSGDYFSEFLPYSTIYL 243
Query: 272 EVEKFKKSLGITI 284
EVEKFKKSLGI I
Sbjct: 244 EVEKFKKSLGIAI 256
|
|
| TIGR_CMR|APH_1197 APH_1197 "hexapeptide transferase family protein" [Anaplasma phagocytophilum HZ (taxid:212042)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|NSE_0045 NSE_0045 "hexapeptide transferase family protein" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|ECH_1066 ECH_1066 "hexapeptide transferase family protein" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q48AV3 CPS_0032 "Bacterial transferase hexapeptide domain protein" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_0032 CPS_0032 "bacterial transferase hexapeptide domain protein" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q81KI7 BAS4655 "Bacterial transferase family protein" [Bacillus anthracis (taxid:1392)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_5010 BA_5010 "bacterial transferase family protein" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q482R8 CPS_2224 "Bacterial transferase family protein" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_2224 CPS_2224 "bacterial transferase family protein" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| grail3.0015028601 | SubName- Full=Putative uncharacterized protein; (251 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 284 | |||
| PLN02472 | 246 | PLN02472, PLN02472, uncharacterized protein | 1e-149 | |
| cd04645 | 153 | cd04645, LbH_gamma_CA_like, Gamma carbonic anhydra | 6e-59 | |
| PLN02296 | 269 | PLN02296, PLN02296, carbonate dehydratase | 3e-42 | |
| COG0663 | 176 | COG0663, PaaY, Carbonic anhydrases/acetyltransfera | 1e-41 | |
| cd04650 | 154 | cd04650, LbH_FBP, Ferripyochelin Binding Protein ( | 3e-27 | |
| cd04745 | 155 | cd04745, LbH_paaY_like, paaY-like: This group is c | 2e-21 | |
| TIGR02287 | 192 | TIGR02287, PaaY, phenylacetic acid degradation pro | 1e-15 | |
| PRK13627 | 196 | PRK13627, PRK13627, carnitine operon protein CaiE; | 2e-13 | |
| cd03359 | 161 | cd03359, LbH_Dynactin_5, Dynactin 5 (or subunit p2 | 1e-11 | |
| cd00710 | 167 | cd00710, LbH_gamma_CA, Gamma carbonic anhydrases ( | 2e-11 | |
| cd03358 | 119 | cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed p | 1e-06 | |
| cd04647 | 109 | cd04647, LbH_MAT_like, Maltose O-acyltransferase ( | 1e-05 | |
| TIGR03570 | 193 | TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sia | 6e-05 | |
| COG0110 | 190 | COG0110, WbbJ, Acetyltransferase (isoleucine patch | 8e-05 | |
| TIGR02353 | 695 | TIGR02353, NRPS_term_dom, non-ribosomal peptide sy | 9e-05 | |
| cd03353 | 193 | cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph | 1e-04 | |
| COG0448 | 393 | COG0448, GlgC, ADP-glucose pyrophosphorylase [Carb | 0.002 | |
| cd00208 | 78 | cd00208, LbetaH, Left-handed parallel beta-Helix ( | 0.003 |
| >gnl|CDD|215263 PLN02472, PLN02472, uncharacterized protein | Back alignment and domain information |
|---|
Score = 416 bits (1070), Expect = e-149
Identities = 211/284 (74%), Positives = 224/284 (78%), Gaps = 38/284 (13%)
Query: 1 MAALARITRRALTTQLSHGHVIRRAFSTSAAATATATATTTKADAKSITPSADRVKWDYR 60
+LARI RRALT+ + +RR F+ AAA AT ITPS DRVKWDYR
Sbjct: 1 ATSLARIARRALTSTAAAQ--LRRGFAAEAAAAAT-----------PITPSPDRVKWDYR 47
Query: 61 GQRQIIPLGQWVPKVAVDAYVAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNV 120
GQRQIIPLGQWVPKVAVDAYVAPNVVLAGQVTV DGASVW G+VLRGDLNKITVGFCSNV
Sbjct: 48 GQRQIIPLGQWVPKVAVDAYVAPNVVLAGQVTVWDGASVWNGAVLRGDLNKITVGFCSNV 107
Query: 121 QERCVLHAAWNSPYRFVGFVSLLIDLQMSCPRSNSLYIAWLPAETSIERFVTIGAYCSLR 180
QERCVLHAAWNSP G LPAET I+R+VTIGAY LR
Sbjct: 108 QERCVLHAAWNSP---TG----------------------LPAETLIDRYVTIGAYSLLR 142
Query: 181 SCTIEPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPTGELWAGNPARFVRTLTHE 240
SCTIEPECIIGQHSILMEGS+VETH+ILEAGSVLPPGRRIPTGELWAGNPARFVRTLT+E
Sbjct: 143 SCTIEPECIIGQHSILMEGSLVETHSILEAGSVLPPGRRIPTGELWAGNPARFVRTLTNE 202
Query: 241 ETLEIPKLAVAINDLSKSHFSEFLPYSTVYLEVEKFKKSLGITI 284
ETLEIPKLAVAINDLS+SHFSEFLPYST YLEVEK KKSLGI +
Sbjct: 203 ETLEIPKLAVAINDLSQSHFSEFLPYSTAYLEVEKLKKSLGIAL 246
|
Length = 246 |
| >gnl|CDD|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >gnl|CDD|215167 PLN02296, PLN02296, carbonate dehydratase | Back alignment and domain information |
|---|
| >gnl|CDD|223735 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|100055 cd04650, LbH_FBP, Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition | Back alignment and domain information |
|---|
| >gnl|CDD|100058 cd04745, LbH_paaY_like, paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E | Back alignment and domain information |
|---|
| >gnl|CDD|131340 TIGR02287, PaaY, phenylacetic acid degradation protein PaaY | Back alignment and domain information |
|---|
| >gnl|CDD|184189 PRK13627, PRK13627, carnitine operon protein CaiE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|100049 cd03359, LbH_Dynactin_5, Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >gnl|CDD|100039 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site | Back alignment and domain information |
|---|
| >gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|100053 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|234265 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >gnl|CDD|223188 COG0110, WbbJ, Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233832 TIGR02353, NRPS_term_dom, non-ribosomal peptide synthetase terminal domain of unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|223525 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 284 | |||
| PLN02472 | 246 | uncharacterized protein | 100.0 | |
| COG0663 | 176 | PaaY Carbonic anhydrases/acetyltransferases, isole | 100.0 | |
| PLN02296 | 269 | carbonate dehydratase | 99.97 | |
| PRK13627 | 196 | carnitine operon protein CaiE; Provisional | 99.97 | |
| TIGR02287 | 192 | PaaY phenylacetic acid degradation protein PaaY. M | 99.96 | |
| cd04745 | 155 | LbH_paaY_like paaY-like: This group is composed by | 99.94 | |
| cd04650 | 154 | LbH_FBP Ferripyochelin Binding Protein (FBP): FBP | 99.93 | |
| cd04645 | 153 | LbH_gamma_CA_like Gamma carbonic anhydrase-like: T | 99.92 | |
| COG1044 | 338 | LpxD UDP-3-O-[3-hydroxymyristoyl] | 99.92 | |
| cd04646 | 164 | LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact | 99.92 | |
| TIGR01853 | 324 | lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam | 99.91 | |
| cd03359 | 161 | LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact | 99.89 | |
| PRK00892 | 343 | lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac | 99.89 | |
| cd03351 | 254 | LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr | 99.88 | |
| PRK05289 | 262 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.88 | |
| PRK12461 | 255 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.88 | |
| TIGR01852 | 254 | lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac | 99.88 | |
| TIGR03532 | 231 | DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla | 99.86 | |
| PRK09527 | 203 | lacA galactoside O-acetyltransferase; Reviewed | 99.85 | |
| cd00710 | 167 | LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo | 99.84 | |
| COG1043 | 260 | LpxA Acyl-[acyl carrier protein] | 99.83 | |
| PRK10502 | 182 | putative acyl transferase; Provisional | 99.82 | |
| cd03352 | 205 | LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas | 99.82 | |
| TIGR03308 | 204 | phn_thr-fam phosphonate metabolim protein, transfe | 99.82 | |
| PRK00892 | 343 | lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac | 99.81 | |
| PRK10092 | 183 | maltose O-acetyltransferase; Provisional | 99.8 | |
| PRK09677 | 192 | putative lipopolysaccharide biosynthesis O-acetyl | 99.8 | |
| COG1044 | 338 | LpxD UDP-3-O-[3-hydroxymyristoyl] | 99.79 | |
| cd03358 | 119 | LbH_WxcM_N_like WcxM-like, Left-handed parallel be | 99.78 | |
| TIGR01852 | 254 | lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac | 99.77 | |
| cd03357 | 169 | LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and | 99.77 | |
| KOG3121 | 184 | consensus Dynactin, subunit p25 [Cytoskeleton] | 99.76 | |
| PRK12461 | 255 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.75 | |
| COG1043 | 260 | LpxA Acyl-[acyl carrier protein] | 99.75 | |
| cd03353 | 193 | LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl | 99.75 | |
| TIGR01173 | 451 | glmU UDP-N-acetylglucosamine diphosphorylase/gluco | 99.75 | |
| TIGR03570 | 201 | NeuD_NnaD sugar O-acyltransferase, sialic acid O-a | 99.74 | |
| cd03350 | 139 | LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d | 99.74 | |
| cd05825 | 107 | LbH_wcaF_like wcaF-like: This group is composed of | 99.74 | |
| TIGR00965 | 269 | dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate | 99.73 | |
| cd03360 | 197 | LbH_AT_putative Putative Acyltransferase (AT), Lef | 99.73 | |
| cd03350 | 139 | LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d | 99.73 | |
| PRK09451 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.72 | |
| KOG4042 | 190 | consensus Dynactin subunit p27/WS-3, involved in t | 99.71 | |
| COG0110 | 190 | WbbJ Acetyltransferase (isoleucine patch superfami | 99.71 | |
| PRK11830 | 272 | dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- | 99.71 | |
| PRK11132 | 273 | cysE serine acetyltransferase; Provisional | 99.71 | |
| COG0663 | 176 | PaaY Carbonic anhydrases/acetyltransferases, isole | 99.71 | |
| cd03351 | 254 | LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr | 99.71 | |
| PRK05289 | 262 | UDP-N-acetylglucosamine acyltransferase; Provision | 99.7 | |
| PRK14357 | 448 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.7 | |
| PRK14355 | 459 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.7 | |
| cd05636 | 163 | LbH_G1P_TT_C_like Putative glucose-1-phosphate thy | 99.69 | |
| cd03349 | 145 | LbH_XAT Xenobiotic acyltransferase (XAT): The XAT | 99.69 | |
| PRK14353 | 446 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.69 | |
| PRK14360 | 450 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.68 | |
| PLN02694 | 294 | serine O-acetyltransferase | 99.68 | |
| PRK14353 | 446 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.68 | |
| PRK14352 | 482 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.67 | |
| COG1207 | 460 | GlmU N-acetylglucosamine-1-phosphate uridyltransfe | 99.67 | |
| PLN02739 | 355 | serine acetyltransferase | 99.67 | |
| PRK14359 | 430 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.67 | |
| cd03352 | 205 | LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas | 99.67 | |
| cd04647 | 109 | LbH_MAT_like Maltose O-acyltransferase (MAT)-like: | 99.67 | |
| TIGR01853 | 324 | lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam | 99.66 | |
| PRK13627 | 196 | carnitine operon protein CaiE; Provisional | 99.64 | |
| PRK14358 | 481 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.64 | |
| TIGR01172 | 162 | cysE serine O-acetyltransferase. Cysteine biosynth | 99.63 | |
| PLN02296 | 269 | carbonate dehydratase | 99.63 | |
| TIGR02287 | 192 | PaaY phenylacetic acid degradation protein PaaY. M | 99.62 | |
| COG1045 | 194 | CysE Serine acetyltransferase [Amino acid transpor | 99.62 | |
| PLN02472 | 246 | uncharacterized protein | 99.61 | |
| PLN02357 | 360 | serine acetyltransferase | 99.61 | |
| PRK14356 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.6 | |
| PRK14354 | 458 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.6 | |
| cd00710 | 167 | LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo | 99.59 | |
| KOG4750 | 269 | consensus Serine O-acetyltransferase [Amino acid t | 99.58 | |
| cd05636 | 163 | LbH_G1P_TT_C_like Putative glucose-1-phosphate thy | 99.58 | |
| cd04745 | 155 | LbH_paaY_like paaY-like: This group is composed by | 99.57 | |
| PRK10191 | 146 | putative acyl transferase; Provisional | 99.56 | |
| cd04645 | 153 | LbH_gamma_CA_like Gamma carbonic anhydrase-like: T | 99.56 | |
| cd04646 | 164 | LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact | 99.55 | |
| cd03354 | 101 | LbH_SAT Serine acetyltransferase (SAT): SAT cataly | 99.54 | |
| PRK14360 | 450 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.51 | |
| TIGR00965 | 269 | dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate | 99.51 | |
| cd04649 | 147 | LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah | 99.5 | |
| COG2171 | 271 | DapD Tetrahydrodipicolinate N-succinyltransferase | 99.5 | |
| TIGR01173 | 451 | glmU UDP-N-acetylglucosamine diphosphorylase/gluco | 99.49 | |
| KOG1461 | 673 | consensus Translation initiation factor 2B, epsilo | 99.49 | |
| TIGR03532 | 231 | DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla | 99.48 | |
| cd03353 | 193 | LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl | 99.48 | |
| cd04650 | 154 | LbH_FBP Ferripyochelin Binding Protein (FBP): FBP | 99.48 | |
| PRK14352 | 482 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.48 | |
| PRK14355 | 459 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.47 | |
| PRK11830 | 272 | dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- | 99.46 | |
| PRK14358 | 481 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.46 | |
| cd03359 | 161 | LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact | 99.45 | |
| TIGR03536 | 341 | DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl | 99.41 | |
| TIGR03308 | 204 | phn_thr-fam phosphonate metabolim protein, transfe | 99.41 | |
| PRK09451 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.4 | |
| TIGR03535 | 319 | DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo | 99.4 | |
| PRK14357 | 448 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.39 | |
| TIGR02353 | 695 | NRPS_term_dom non-ribosomal peptide synthetase ter | 99.38 | |
| PRK14354 | 458 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.38 | |
| PRK14359 | 430 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.38 | |
| PRK14356 | 456 | glmU bifunctional N-acetylglucosamine-1-phosphate | 99.38 | |
| cd03360 | 197 | LbH_AT_putative Putative Acyltransferase (AT), Lef | 99.37 | |
| PRK09677 | 192 | putative lipopolysaccharide biosynthesis O-acetyl | 99.35 | |
| TIGR03570 | 201 | NeuD_NnaD sugar O-acyltransferase, sialic acid O-a | 99.35 | |
| COG1207 | 460 | GlmU N-acetylglucosamine-1-phosphate uridyltransfe | 99.31 | |
| cd04649 | 147 | LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah | 99.3 | |
| cd05635 | 101 | LbH_unknown Uncharacterized proteins, Left-handed | 99.3 | |
| TIGR02353 | 695 | NRPS_term_dom non-ribosomal peptide synthetase ter | 99.29 | |
| cd04652 | 81 | LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal | 99.27 | |
| cd05787 | 79 | LbH_eIF2B_epsilon eIF-2B epsilon subunit, central | 99.26 | |
| KOG1461 | 673 | consensus Translation initiation factor 2B, epsilo | 99.25 | |
| cd05635 | 101 | LbH_unknown Uncharacterized proteins, Left-handed | 99.24 | |
| cd03356 | 79 | LbH_G1P_AT_C_like Left-handed parallel beta-Helix | 99.23 | |
| cd03358 | 119 | LbH_WxcM_N_like WcxM-like, Left-handed parallel be | 99.22 | |
| PRK05293 | 380 | glgC glucose-1-phosphate adenylyltransferase; Prov | 99.22 | |
| PRK11132 | 273 | cysE serine acetyltransferase; Provisional | 99.21 | |
| PRK10502 | 182 | putative acyl transferase; Provisional | 99.2 | |
| TIGR01172 | 162 | cysE serine O-acetyltransferase. Cysteine biosynth | 99.18 | |
| TIGR03536 | 341 | DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl | 99.18 | |
| PRK10191 | 146 | putative acyl transferase; Provisional | 99.18 | |
| cd05824 | 80 | LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr | 99.18 | |
| cd00208 | 78 | LbetaH Left-handed parallel beta-Helix (LbetaH or | 99.16 | |
| COG1045 | 194 | CysE Serine acetyltransferase [Amino acid transpor | 99.16 | |
| PLN02739 | 355 | serine acetyltransferase | 99.15 | |
| cd04652 | 81 | LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal | 99.15 | |
| cd05787 | 79 | LbH_eIF2B_epsilon eIF-2B epsilon subunit, central | 99.14 | |
| COG1208 | 358 | GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas | 99.13 | |
| TIGR03535 | 319 | DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo | 99.13 | |
| PRK09527 | 203 | lacA galactoside O-acetyltransferase; Reviewed | 99.1 | |
| PLN02694 | 294 | serine O-acetyltransferase | 99.09 | |
| cd03356 | 79 | LbH_G1P_AT_C_like Left-handed parallel beta-Helix | 99.07 | |
| cd05824 | 80 | LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr | 99.06 | |
| cd00208 | 78 | LbetaH Left-handed parallel beta-Helix (LbetaH or | 99.06 | |
| cd04651 | 104 | LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera | 99.05 | |
| cd03357 | 169 | LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and | 99.05 | |
| PLN02357 | 360 | serine acetyltransferase | 99.04 | |
| TIGR01208 | 353 | rmlA_long glucose-1-phosphate thymidylylransferase | 99.03 | |
| PLN02241 | 436 | glucose-1-phosphate adenylyltransferase | 99.03 | |
| COG2171 | 271 | DapD Tetrahydrodipicolinate N-succinyltransferase | 99.01 | |
| cd03354 | 101 | LbH_SAT Serine acetyltransferase (SAT): SAT cataly | 99.0 | |
| cd04647 | 109 | LbH_MAT_like Maltose O-acyltransferase (MAT)-like: | 98.99 | |
| cd04651 | 104 | LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera | 98.97 | |
| cd05825 | 107 | LbH_wcaF_like wcaF-like: This group is composed of | 98.96 | |
| PRK10092 | 183 | maltose O-acetyltransferase; Provisional | 98.94 | |
| PRK02862 | 429 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.91 | |
| KOG1462 | 433 | consensus Translation initiation factor 2B, gamma | 98.86 | |
| PRK05293 | 380 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.86 | |
| COG1208 | 358 | GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas | 98.84 | |
| cd03349 | 145 | LbH_XAT Xenobiotic acyltransferase (XAT): The XAT | 98.84 | |
| TIGR01208 | 353 | rmlA_long glucose-1-phosphate thymidylylransferase | 98.84 | |
| PLN02241 | 436 | glucose-1-phosphate adenylyltransferase | 98.83 | |
| KOG3121 | 184 | consensus Dynactin, subunit p25 [Cytoskeleton] | 98.82 | |
| TIGR02091 | 361 | glgC glucose-1-phosphate adenylyltransferase. This | 98.73 | |
| KOG1460 | 407 | consensus GDP-mannose pyrophosphorylase [Carbohydr | 98.68 | |
| TIGR02091 | 361 | glgC glucose-1-phosphate adenylyltransferase. This | 98.63 | |
| KOG1462 | 433 | consensus Translation initiation factor 2B, gamma | 98.63 | |
| PRK00844 | 407 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.62 | |
| COG0110 | 190 | WbbJ Acetyltransferase (isoleucine patch superfami | 98.57 | |
| KOG4750 | 269 | consensus Serine O-acetyltransferase [Amino acid t | 98.57 | |
| KOG4042 | 190 | consensus Dynactin subunit p27/WS-3, involved in t | 98.57 | |
| COG0448 | 393 | GlgC ADP-glucose pyrophosphorylase [Carbohydrate t | 98.57 | |
| TIGR02092 | 369 | glgD glucose-1-phosphate adenylyltransferase, GlgD | 98.52 | |
| PRK00725 | 425 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.52 | |
| PRK00725 | 425 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.51 | |
| TIGR02092 | 369 | glgD glucose-1-phosphate adenylyltransferase, GlgD | 98.5 | |
| PRK00844 | 407 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.47 | |
| PRK02862 | 429 | glgC glucose-1-phosphate adenylyltransferase; Prov | 98.44 | |
| KOG1322 | 371 | consensus GDP-mannose pyrophosphorylase/mannose-1- | 98.4 | |
| KOG1460 | 407 | consensus GDP-mannose pyrophosphorylase [Carbohydr | 98.39 | |
| PF14602 | 34 | Hexapep_2: Hexapeptide repeat of succinyl-transfer | 98.36 | |
| PF14602 | 34 | Hexapep_2: Hexapeptide repeat of succinyl-transfer | 98.26 | |
| COG0448 | 393 | GlgC ADP-glucose pyrophosphorylase [Carbohydrate t | 98.2 | |
| PF00132 | 36 | Hexapep: Bacterial transferase hexapeptide (six re | 98.08 | |
| KOG1322 | 371 | consensus GDP-mannose pyrophosphorylase/mannose-1- | 98.07 | |
| PF00132 | 36 | Hexapep: Bacterial transferase hexapeptide (six re | 97.73 | |
| COG4801 | 277 | Predicted acyltransferase [General function predic | 97.41 | |
| COG4801 | 277 | Predicted acyltransferase [General function predic | 96.95 | |
| PF07959 | 414 | Fucokinase: L-fucokinase; InterPro: IPR012887 In t | 87.66 | |
| PF07959 | 414 | Fucokinase: L-fucokinase; InterPro: IPR012887 In t | 86.76 | |
| PF04613 | 72 | LpxD: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 84.99 | |
| PF13720 | 83 | Acetyltransf_11: Udp N-acetylglucosamine O-acyltra | 84.39 |
| >PLN02472 uncharacterized protein | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.8e-37 Score=270.47 Aligned_cols=246 Identities=85% Similarity=1.319 Sum_probs=217.5
Q ss_pred ChhhhhhhHhhhhhhcccchhhhhhhhhhhhhhccccccccccCCCCCCCCcccccccccccceeeecCCCCceeCCCcE
Q 039842 1 MAALARITRRALTTQLSHGHVIRRAFSTSAAATATATATTTKADAKSITPSADRVKWDYRGQRQIIPLGQWVPKVAVDAY 80 (284)
Q Consensus 1 ~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~ 80 (284)
|++|+|+.+..++..... .+++.++..++.+.+ ...+...+.+|+|..++++..+....|.++.+++
T Consensus 1 ~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~-----------~~~~~~~~~~~~~~~~~~~~~~~~~~p~i~~~~~ 67 (246)
T PLN02472 1 ATSLARIARRALTSTAAA--QLRRGFAAEAAAAAT-----------PITPSPDRVKWDYRGQRQIIPLGQWVPKVAVDAY 67 (246)
T ss_pred ChhHHHHHHHhhhhhhhh--hhcCCcchhhhcccC-----------CCCCcccccccCcCCcceEEecCCcCCccCCCCE
Confidence 788999988888766555 344444443333321 1345678899999999999999999999999999
Q ss_pred EcCCcEEecceEECCCCEECCCCEEecCCCcEEECCCCEECCCCEEecCCCCCcccccceeeeecccccCCCCCcccccc
Q 039842 81 VAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNVQERCVLHAAWNSPYRFVGFVSLLIDLQMSCPRSNSLYIAW 160 (284)
Q Consensus 81 I~~~a~i~~~v~IG~~~~I~~~~~I~g~~~~v~IG~~~~I~~~~~I~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~ 160 (284)
|.|++.+.+++.||+++.|+++++|+|+.+.++||++|.|+++|+|+.....+..
T Consensus 68 I~p~a~i~G~V~Ig~~a~I~~gavirgd~~~I~IG~~t~Ig~~~vI~~~~~~~~~------------------------- 122 (246)
T PLN02472 68 VAPNVVLAGQVTVWDGASVWNGAVLRGDLNKITVGFCSNVQERCVLHAAWNSPTG------------------------- 122 (246)
T ss_pred ECCCCEEecCEEECCCCEEcCCCEEecCCcceEECCCCEECCCCEEeecCccccC-------------------------
Confidence 9999999999999999999999999999889999999999999999865421111
Q ss_pred CCcceEECCCCEECCCceeeccEECCCCEECCCcEEcCCCEECCCCEEcCCCeeCCCCeeCCCCEEeccCceeeccCCHH
Q 039842 161 LPAETSIERFVTIGAYCSLRSCTIEPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPTGELWAGNPARFVRTLTHE 240 (284)
Q Consensus 161 ~~~~v~Ig~~v~Ig~~~~I~~v~Igd~v~IG~~s~I~~gv~Ig~~~~I~a~s~V~~~~~I~~~~vv~G~pa~~~~~~~~~ 240 (284)
.+.+++||++|.||++|+|++++||++|+||.+|+|.++++||++++|+++++|.++..+|++.++.|+||++++.+.++
T Consensus 123 i~~~tvIG~~v~IG~~s~L~~~~Igd~v~IG~~svI~~gavIg~~~~Ig~gsvV~~g~~Ip~g~~~~G~PA~~~~~~~~~ 202 (246)
T PLN02472 123 LPAETLIDRYVTIGAYSLLRSCTIEPECIIGQHSILMEGSLVETHSILEAGSVLPPGRRIPTGELWAGNPARFVRTLTNE 202 (246)
T ss_pred CCCCcEECCCCEECCCcEECCeEEcCCCEECCCCEECCCCEECCCCEECCCCEECCCCEeCCCCEEEecCCEEeccCCHH
Confidence 23468999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHhhhhhhHHHHHHHHHHHHhccccchHHHHHHHHHHHHhCCCC
Q 039842 241 ETLEIPKLAVAINDLSKSHFSEFLPYSTVYLEVEKFKKSLGITI 284 (284)
Q Consensus 241 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 284 (284)
+...++...+.|.++.+.|.+.|.++...|.+.+++++++++.+
T Consensus 203 ~~~~l~~~a~~y~~l~k~~~~~~~~~~~~~~~~~~~~~~~~~~~ 246 (246)
T PLN02472 203 ETLEIPKLAVAINDLSQSHFSEFLPYSTAYLEVEKLKKSLGIAL 246 (246)
T ss_pred HHHHHHHHHHHHHHHHHHHHHhccccchhHHHHHHHHHHhccCC
Confidence 99999999999999999999999999999999999999999864
|
|
| >COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02296 carbonate dehydratase | Back alignment and domain information |
|---|
| >PRK13627 carnitine operon protein CaiE; Provisional | Back alignment and domain information |
|---|
| >TIGR02287 PaaY phenylacetic acid degradation protein PaaY | Back alignment and domain information |
|---|
| >cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E | Back alignment and domain information |
|---|
| >cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition | Back alignment and domain information |
|---|
| >cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase | Back alignment and domain information |
|---|
| >PRK09527 lacA galactoside O-acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site | Back alignment and domain information |
|---|
| >COG1043 LpxA Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >PRK10502 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family | Back alignment and domain information |
|---|
| >PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10092 maltose O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional | Back alignment and domain information |
|---|
| >COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] | Back alignment and domain information |
|---|
| >cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase | Back alignment and domain information |
|---|
| >cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates | Back alignment and domain information |
|---|
| >KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1043 LpxA Acyl-[acyl carrier protein] | Back alignment and domain information |
|---|
| >cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA | Back alignment and domain information |
|---|
| >cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E | Back alignment and domain information |
|---|
| >TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA | Back alignment and domain information |
|---|
| >PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11132 cysE serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc | Back alignment and domain information |
|---|
| >PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains | Back alignment and domain information |
|---|
| >cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others | Back alignment and domain information |
|---|
| >PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02694 serine O-acetyltransferase | Back alignment and domain information |
|---|
| >PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PLN02739 serine acetyltransferase | Back alignment and domain information |
|---|
| >PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc | Back alignment and domain information |
|---|
| >cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase | Back alignment and domain information |
|---|
| >PRK13627 carnitine operon protein CaiE; Provisional | Back alignment and domain information |
|---|
| >PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01172 cysE serine O-acetyltransferase | Back alignment and domain information |
|---|
| >PLN02296 carbonate dehydratase | Back alignment and domain information |
|---|
| >TIGR02287 PaaY phenylacetic acid degradation protein PaaY | Back alignment and domain information |
|---|
| >COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02472 uncharacterized protein | Back alignment and domain information |
|---|
| >PLN02357 serine acetyltransferase | Back alignment and domain information |
|---|
| >PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site | Back alignment and domain information |
|---|
| >KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains | Back alignment and domain information |
|---|
| >cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E | Back alignment and domain information |
|---|
| >PRK10191 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E | Back alignment and domain information |
|---|
| >cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine | Back alignment and domain information |
|---|
| >PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH | Back alignment and domain information |
|---|
| >COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase | Back alignment and domain information |
|---|
| >KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase | Back alignment and domain information |
|---|
| >cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase | Back alignment and domain information |
|---|
| >cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition | Back alignment and domain information |
|---|
| >PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport | Back alignment and domain information |
|---|
| >TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family | Back alignment and domain information |
|---|
| >PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function | Back alignment and domain information |
|---|
| >PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain | Back alignment and domain information |
|---|
| >PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional | Back alignment and domain information |
|---|
| >TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family | Back alignment and domain information |
|---|
| >COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH | Back alignment and domain information |
|---|
| >cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function | Back alignment and domain information |
|---|
| >cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain | Back alignment and domain information |
|---|
| >PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11132 cysE serine acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10502 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01172 cysE serine O-acetyltransferase | Back alignment and domain information |
|---|
| >TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >PRK10191 putative acyl transferase; Provisional | Back alignment and domain information |
|---|
| >cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02739 serine acetyltransferase | Back alignment and domain information |
|---|
| >cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) | Back alignment and domain information |
|---|
| >COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | Back alignment and domain information |
|---|
| >PRK09527 lacA galactoside O-acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PLN02694 serine O-acetyltransferase | Back alignment and domain information |
|---|
| >cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma | Back alignment and domain information |
|---|
| >cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase | Back alignment and domain information |
|---|
| >cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) | Back alignment and domain information |
|---|
| >cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates | Back alignment and domain information |
|---|
| >PLN02357 serine acetyltransferase | Back alignment and domain information |
|---|
| >TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form | Back alignment and domain information |
|---|
| >PLN02241 glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine | Back alignment and domain information |
|---|
| >cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins | Back alignment and domain information |
|---|
| >cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase | Back alignment and domain information |
|---|
| >cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E | Back alignment and domain information |
|---|
| >PRK10092 maltose O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others | Back alignment and domain information |
|---|
| >TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form | Back alignment and domain information |
|---|
| >PLN02241 glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR02091 glgC glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02091 glgC glucose-1-phosphate adenylyltransferase | Back alignment and domain information |
|---|
| >KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit | Back alignment and domain information |
|---|
| >PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit | Back alignment and domain information |
|---|
| >PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A | Back alignment and domain information |
|---|
| >PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A | Back alignment and domain information |
|---|
| >COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix | Back alignment and domain information |
|---|
| >KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix | Back alignment and domain information |
|---|
| >COG4801 Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG4801 Predicted acyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] | Back alignment and domain information |
|---|
| >PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] | Back alignment and domain information |
|---|
| >PF04613 LpxD: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD ; InterPro: IPR020573 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (2 | Back alignment and domain information |
|---|
| >PF13720 Acetyltransf_11: Udp N-acetylglucosamine O-acyltransferase; Domain 2; PDB: 3I3A_A 3I3X_A 3HSQ_B 2JF2_A 1LXA_A 2AQ9_A 2QIV_X 2QIA_A 2JF3_A 4EQY_F | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 284 | ||||
| 3ixc_A | 191 | Crystal Structure Of Hexapeptide Transferase Family | 4e-27 | ||
| 1v3w_A | 173 | Structure Of Ferripyochelin Binding Protein From Py | 5e-20 | ||
| 3r1w_A | 189 | Crystal Structure Of A Carbonic Anhydrase From A Cr | 3e-19 | ||
| 1xhd_A | 173 | X-Ray Crystal Structure Of Putative Acetyltransfera | 4e-19 | ||
| 3tio_A | 183 | Crystal Structures Of Yrda From Escherichia Coli, A | 7e-19 | ||
| 3vnp_A | 183 | Crystal Structure Of Hypothetical Protein (Gk2848) | 1e-18 | ||
| 3r3r_A | 187 | Structure Of The Yrda Ferripyochelin Binding Protei | 1e-17 |
| >pdb|3IXC|A Chain A, Crystal Structure Of Hexapeptide Transferase Family Protein From Anaplasma Phagocytophilum Length = 191 | Back alignment and structure |
|
| >pdb|1V3W|A Chain A, Structure Of Ferripyochelin Binding Protein From Pyrococcus Horikoshii Ot3 Length = 173 | Back alignment and structure |
| >pdb|3R1W|A Chain A, Crystal Structure Of A Carbonic Anhydrase From A Crude Oil Degrading Psychrophilic Library Length = 189 | Back alignment and structure |
| >pdb|1XHD|A Chain A, X-Ray Crystal Structure Of Putative Acetyltransferase, Product Of Bc4754 Gene [bacillus Cereus] Length = 173 | Back alignment and structure |
| >pdb|3TIO|A Chain A, Crystal Structures Of Yrda From Escherichia Coli, A Homologous Protein Of Gamma-Class Carbonic Anhydrase, Show Possible Allosteric Conformations Length = 183 | Back alignment and structure |
| >pdb|3VNP|A Chain A, Crystal Structure Of Hypothetical Protein (Gk2848) From Geobacillus Kaustophilus Length = 183 | Back alignment and structure |
| >pdb|3R3R|A Chain A, Structure Of The Yrda Ferripyochelin Binding Protein From Salmonella Enterica Length = 187 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 284 | |||
| 3r1w_A | 189 | Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid | 2e-54 | |
| 3r3r_A | 187 | Ferripyochelin binding protein; structural genomic | 3e-53 | |
| 3ixc_A | 191 | Hexapeptide transferase family protein; niaid, ssg | 2e-50 | |
| 1xhd_A | 173 | Putative acetyltransferase/acyltransferase; struct | 1e-49 | |
| 1v3w_A | 173 | Ferripyochelin binding protein; beta-helix, carbon | 6e-48 | |
| 1qre_A | 247 | Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth | 8e-39 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 2e-33 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 2e-11 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 3e-10 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 9e-08 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 1e-07 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 2e-07 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 4e-07 | |
| 4e8l_A | 219 | Virginiamycin A acetyltransferase; structural geno | 1e-06 | |
| 1xat_A | 212 | Xenobiotic acetyltransferase; chloramphenicol, LEF | 2e-06 | |
| 1mr7_A | 209 | Streptogramin A acetyltransferase; LEFT-handed par | 4e-06 | |
| 3eev_A | 212 | Chloramphenicol acetyltransferase; beta-helix, str | 4e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 5e-05 | |
| 3jqy_B | 252 | NEUO, polysialic acid O-acetyltransferase; LEFT-ha | 3e-04 | |
| 1krr_A | 203 | Galactoside O-acetyltransferase; LEFT-handed paral | 5e-04 | |
| 3ftt_A | 199 | Putative acetyltransferase sacol2570; galactoside | 6e-04 |
| >3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} Length = 189 | Back alignment and structure |
|---|
Score = 174 bits (442), Expect = 2e-54
Identities = 58/198 (29%), Positives = 91/198 (45%), Gaps = 24/198 (12%)
Query: 65 IIPLGQWVPKVAVDAYVAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNVQERC 124
+ PK+ +V + V+ G V + D SVWP +V+RGD++ I +G ++VQ+
Sbjct: 12 VRTYQGISPKLGERVFVDRSSVIIGDVELGDDCSVWPLAVIRGDMHHIRIGARTSVQDGS 71
Query: 125 VLHAAWNSPYRFVGFVSLLIDLQMSCPRSNSLYIAWLPAETSIERFVTIGAYCSLRSCTI 184
VLH S Y G+ I VTIG L CTI
Sbjct: 72 VLHITHASDYNPGGY------------------------PLIIGDDVTIGHQAMLHGCTI 107
Query: 185 EPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPTGELWAGNPARFVRTLTHEETLE 244
+IG S++M+G++VE I+ AG+ + PG+ + +G ++ G PA+ VR +T +E
Sbjct: 108 GNRVLIGMKSMIMDGAIVEDEVIVAAGATVSPGKVLESGFVYMGTPAKKVRPITEKERSF 167
Query: 245 IPKLAVAINDLSKSHFSE 262
A L H +E
Sbjct: 168 FTYGAGNYVRLKDKHLAE 185
|
| >3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} Length = 187 | Back alignment and structure |
|---|
| >3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Length = 191 | Back alignment and structure |
|---|
| >1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Length = 173 | Back alignment and structure |
|---|
| >1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Length = 173 | Back alignment and structure |
|---|
| >1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A Length = 247 | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Length = 213 | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Length = 205 | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220 | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Length = 240 | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Length = 496 | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192 | Back alignment and structure |
|---|
| >4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} Length = 219 | Back alignment and structure |
|---|
| >1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* Length = 212 | Back alignment and structure |
|---|
| >1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Length = 209 | Back alignment and structure |
|---|
| >3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} Length = 212 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 | Back alignment and structure |
|---|
| >3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} Length = 252 | Back alignment and structure |
|---|
| >1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Length = 203 | Back alignment and structure |
|---|
| >3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* Length = 199 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 284 | |||
| 3r1w_A | 189 | Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid | 99.96 | |
| 3r3r_A | 187 | Ferripyochelin binding protein; structural genomic | 99.96 | |
| 1v3w_A | 173 | Ferripyochelin binding protein; beta-helix, carbon | 99.96 | |
| 1xhd_A | 173 | Putative acetyltransferase/acyltransferase; struct | 99.96 | |
| 3ixc_A | 191 | Hexapeptide transferase family protein; niaid, ssg | 99.96 | |
| 3tv0_A | 194 | Dynactin subunit 6; LEFT-handed beta-helix, ARP11, | 99.96 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 99.93 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 99.92 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 99.92 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 99.92 | |
| 4e79_A | 357 | UDP-3-O-acylglucosamine N-acyltransferase; lipopol | 99.92 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 99.92 | |
| 1qre_A | 247 | Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth | 99.91 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 99.91 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.9 | |
| 4e6u_A | 265 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.9 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.9 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 99.9 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.9 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 99.9 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 99.9 | |
| 3nz2_A | 195 | Hexapeptide-repeat containing-acetyltransferase; s | 99.88 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 99.88 | |
| 3hjj_A | 190 | Maltose O-acetyltransferase; LEFT-handed beta-heli | 99.87 | |
| 1krr_A | 203 | Galactoside O-acetyltransferase; LEFT-handed paral | 99.86 | |
| 3jqy_B | 252 | NEUO, polysialic acid O-acetyltransferase; LEFT-ha | 99.86 | |
| 3ftt_A | 199 | Putative acetyltransferase sacol2570; galactoside | 99.86 | |
| 2wlg_A | 215 | Polysialic acid O-acetyltransferase; enzyme, LEFT- | 99.85 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 99.85 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 99.85 | |
| 3srt_A | 188 | Maltose O-acetyltransferase; structural genomics, | 99.85 | |
| 4e79_A | 357 | UDP-3-O-acylglucosamine N-acyltransferase; lipopol | 99.84 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 99.84 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 99.84 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 99.83 | |
| 1ocx_A | 182 | Maltose O-acetyltransferase; LEFT-handed parallel | 99.83 | |
| 3gos_A | 276 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.82 | |
| 4hur_A | 220 | Virginiamycin A acetyltransferase; structural geno | 99.82 | |
| 1j2z_A | 270 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.82 | |
| 3eg4_A | 304 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.82 | |
| 4eqy_A | 283 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.82 | |
| 2p2o_A | 185 | Maltose transacetylase; GK1921, GKA001001921.1, ge | 99.82 | |
| 3tk8_A | 316 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.81 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 99.81 | |
| 3pmo_A | 372 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; | 99.81 | |
| 2iu8_A | 374 | LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a | 99.8 | |
| 3hsq_A | 259 | Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam | 99.8 | |
| 2qia_A | 262 | UDP-N-acetylglucosamine acyltransferase; LEFT-hand | 99.8 | |
| 1xat_A | 212 | Xenobiotic acetyltransferase; chloramphenicol, LEF | 99.8 | |
| 4e6u_A | 265 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.79 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 99.79 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 99.79 | |
| 3eev_A | 212 | Chloramphenicol acetyltransferase; beta-helix, str | 99.79 | |
| 3fs8_A | 273 | QDTC; acetyltransferase, natural product, deoxysug | 99.78 | |
| 3r0s_A | 266 | Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam | 99.77 | |
| 3eh0_A | 341 | UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr | 99.76 | |
| 3q1x_A | 313 | Serine acetyltransferase; cysteine biosynthesis, L | 99.76 | |
| 4e8l_A | 219 | Virginiamycin A acetyltransferase; structural geno | 99.74 | |
| 3mc4_A | 287 | WW/RSP5/WWP domain:bacterial transferase hexapept | 99.73 | |
| 3t57_A | 305 | UDP-N-acetylglucosamine O-acyltransferase domain- | 99.72 | |
| 3ixc_A | 191 | Hexapeptide transferase family protein; niaid, ssg | 99.72 | |
| 1mr7_A | 209 | Streptogramin A acetyltransferase; LEFT-handed par | 99.72 | |
| 2ggo_A | 401 | 401AA long hypothetical glucose-1-phosphate thymid | 99.71 | |
| 3vbi_A | 205 | ANTD, galactoside O-acetyltransferase; anthrose, a | 99.71 | |
| 3r3r_A | 187 | Ferripyochelin binding protein; structural genomic | 99.7 | |
| 3f1x_A | 310 | Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 | 99.7 | |
| 1ssq_A | 267 | SAT, serine acetyltransferase; LEFT-handed paralle | 99.7 | |
| 1xhd_A | 173 | Putative acetyltransferase/acyltransferase; struct | 99.7 | |
| 1t3d_A | 289 | SAT, serine acetyltransferase; LEFT-handed-beta-he | 99.7 | |
| 3kwd_A | 213 | Carbon dioxide concentrating mechanism protein; LE | 99.7 | |
| 3tv0_A | 194 | Dynactin subunit 6; LEFT-handed beta-helix, ARP11, | 99.69 | |
| 3r1w_A | 189 | Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid | 99.69 | |
| 3fsy_A | 332 | Tetrahydrodipicolinate N-succinyltransferase; beta | 99.69 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 99.68 | |
| 3r5d_A | 347 | Tetrahydrodipicolinate N-succinyletransferase; 1.8 | 99.68 | |
| 1qre_A | 247 | Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth | 99.65 | |
| 2v0h_A | 456 | Bifunctional protein GLMU; cell WALL, magnesium, c | 99.63 | |
| 1v3w_A | 173 | Ferripyochelin binding protein; beta-helix, carbon | 99.63 | |
| 3eg4_A | 304 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.62 | |
| 3jqy_B | 252 | NEUO, polysialic acid O-acetyltransferase; LEFT-ha | 99.59 | |
| 2pig_A | 334 | Putative transferase; SCR6, NESG, YDCK, structural | 99.58 | |
| 1hm9_A | 468 | GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr | 99.57 | |
| 3gos_A | 276 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.57 | |
| 4fce_A | 459 | Bifunctional protein GLMU; GLMU. csgid, niaid, str | 99.56 | |
| 3mqg_A | 192 | Lipopolysaccharides biosynthesis acetyltransferas; | 99.55 | |
| 3tk8_A | 316 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su | 99.53 | |
| 2wlg_A | 215 | Polysialic acid O-acetyltransferase; enzyme, LEFT- | 99.52 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 99.52 | |
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 99.49 | |
| 3fsy_A | 332 | Tetrahydrodipicolinate N-succinyltransferase; beta | 99.49 | |
| 3st8_A | 501 | Bifunctional protein GLMU; acetyltransferase, pyro | 99.48 | |
| 3q1x_A | 313 | Serine acetyltransferase; cysteine biosynthesis, L | 99.48 | |
| 3r8y_A | 240 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac | 99.48 | |
| 2rij_A | 387 | Putative 2,3,4,5-tetrahydropyridine-2-carboxylate | 99.48 | |
| 3bfp_A | 194 | Acetyltransferase; LEFT-handed beta helix, COA bin | 99.47 | |
| 3r5d_A | 347 | Tetrahydrodipicolinate N-succinyletransferase; 1.8 | 99.45 | |
| 3c8v_A | 496 | Putative acetyltransferase; YP_390128.1, structura | 99.43 | |
| 3nz2_A | 195 | Hexapeptide-repeat containing-acetyltransferase; s | 99.38 | |
| 3f1x_A | 310 | Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 | 99.36 | |
| 2pig_A | 334 | Putative transferase; SCR6, NESG, YDCK, structural | 99.36 | |
| 3hjj_A | 190 | Maltose O-acetyltransferase; LEFT-handed beta-heli | 99.33 | |
| 1yp2_A | 451 | Glucose-1-phosphate adenylyltransferase small subu | 99.31 | |
| 3mc4_A | 287 | WW/RSP5/WWP domain:bacterial transferase hexapept | 99.28 | |
| 3ftt_A | 199 | Putative acetyltransferase sacol2570; galactoside | 99.27 | |
| 2rij_A | 387 | Putative 2,3,4,5-tetrahydropyridine-2-carboxylate | 99.26 | |
| 1ssq_A | 267 | SAT, serine acetyltransferase; LEFT-handed paralle | 99.25 | |
| 1krr_A | 203 | Galactoside O-acetyltransferase; LEFT-handed paral | 99.25 | |
| 4hur_A | 220 | Virginiamycin A acetyltransferase; structural geno | 99.24 | |
| 3eev_A | 212 | Chloramphenicol acetyltransferase; beta-helix, str | 99.22 | |
| 1t3d_A | 289 | SAT, serine acetyltransferase; LEFT-handed-beta-he | 99.22 | |
| 3srt_A | 188 | Maltose O-acetyltransferase; structural genomics, | 99.21 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 99.13 | |
| 1ocx_A | 182 | Maltose O-acetyltransferase; LEFT-handed parallel | 99.13 | |
| 4e8l_A | 219 | Virginiamycin A acetyltransferase; structural geno | 99.11 | |
| 3brk_X | 420 | Glucose-1-phosphate adenylyltransferase; ADP-gluco | 99.09 | |
| 2p2o_A | 185 | Maltose transacetylase; GK1921, GKA001001921.1, ge | 99.08 | |
| 1xat_A | 212 | Xenobiotic acetyltransferase; chloramphenicol, LEF | 98.85 | |
| 1mr7_A | 209 | Streptogramin A acetyltransferase; LEFT-handed par | 98.77 |
| >3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} | Back alignment and structure |
|---|
Probab=99.96 E-value=1.5e-28 Score=207.25 Aligned_cols=173 Identities=33% Similarity=0.516 Sum_probs=154.2
Q ss_pred eecCCCCceeCCCcEEcCCcEEecceEECCCCEECCCCEEecCCCcEEECCCCEECCCCEEecCCCCCcccccceeeeec
Q 039842 66 IPLGQWVPKVAVDAYVAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNVQERCVLHAAWNSPYRFVGFVSLLID 145 (284)
Q Consensus 66 ~~~~~~~~~i~~~~~I~~~a~i~~~v~IG~~~~I~~~~~I~g~~~~v~IG~~~~I~~~~~I~~~~~~~~~~~g~~~~~~~ 145 (284)
..+....+.++++++|++++.|.+++.||++|.|++++.|.++...+.||++|.|+++++|....+....
T Consensus 13 ~~~~~~~~~ig~~~~I~~~~~i~~~v~IG~~~~I~~~~~i~~~~~~i~IG~~~~I~~~~~I~~~~~~~~~---------- 82 (189)
T 3r1w_A 13 RTYQGISPKLGERVFVDRSSVIIGDVELGDDCSVWPLAVIRGDMHHIRIGARTSVQDGSVLHITHASDYN---------- 82 (189)
T ss_dssp ECBTTBCCEECTTCEECTTCEEEEEEEECTTCEECTTCEEEEEEEEEEECTTCEECTTCEEECBCCSSSS----------
T ss_pred eeccCcCCEECCCcEECCCCEEeeeeEECCCCEECCCCEEecCCCceEECCCCEECCCCEEecCCcccCC----------
Confidence 3455667889999999999999999999999999999999866556899999999999999765331111
Q ss_pred ccccCCCCCccccccCCcceEECCCCEECCCceeeccEECCCCEECCCcEEcCCCEECCCCEEcCCCeeCCCCeeCCCCE
Q 039842 146 LQMSCPRSNSLYIAWLPAETSIERFVTIGAYCSLRSCTIEPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPTGEL 225 (284)
Q Consensus 146 ~~~~~~~~~~~~~~~~~~~v~Ig~~v~Ig~~~~I~~v~Igd~v~IG~~s~I~~gv~Ig~~~~I~a~s~V~~~~~I~~~~v 225 (284)
....+++||++|+|+++|.|++++||++|+||++++|.++++||++|+|+++++|.++++||++++
T Consensus 83 --------------~~~~~~~Ig~~~~Ig~~~~i~~~~Ig~~~~Ig~~~~i~~~v~Ig~~~~Ig~~s~V~~g~~i~~~~v 148 (189)
T 3r1w_A 83 --------------PGGYPLIIGDDVTIGHQAMLHGCTIGNRVLIGMKSMIMDGAIVEDEVIVAAGATVSPGKVLESGFV 148 (189)
T ss_dssp --------------TTCBCEEECSSEEECTTCEEESCEECSSEEECTTCEECTTCEECSSCEECTTCEECTTCEECTTEE
T ss_pred --------------CCCCCeEECCCCEECCCCEEeCcEECCCcEECCCCEEcCCCEECCCCEEccCCEECCCCEeCCCCE
Confidence 022369999999999999999999999999999999999999999999999999999999999999
Q ss_pred EeccCceeeccCCHHHHhhhhhhHHHHHHHHHHHHhc
Q 039842 226 WAGNPARFVRTLTHEETLEIPKLAVAINDLSKSHFSE 262 (284)
Q Consensus 226 v~G~pa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 262 (284)
++|+||++++.+++++..++....+.|.++.+.|.++
T Consensus 149 v~G~pa~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 185 (189)
T 3r1w_A 149 YMGTPAKKVRPITEKERSFFTYGAGNYVRLKDKHLAE 185 (189)
T ss_dssp EETTTTEEEEECCHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred EECCccccccCCCHHHHHHHHHHHHHHHHHHHHHhhc
Confidence 9999999999999999999999999999999988654
|
| >3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A | Back alignment and structure |
|---|
| >1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A | Back alignment and structure |
|---|
| >1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A | Back alignment and structure |
|---|
| >3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* | Back alignment and structure |
|---|
| >4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A | Back alignment and structure |
|---|
| >1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 | Back alignment and structure |
|---|
| >4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* | Back alignment and structure |
|---|
| >3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* | Back alignment and structure |
|---|
| >1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* | Back alignment and structure |
|---|
| >3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A | Back alignment and structure |
|---|
| >2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* | Back alignment and structure |
|---|
| >3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* | Back alignment and structure |
|---|
| >4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* | Back alignment and structure |
|---|
| >1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A | Back alignment and structure |
|---|
| >4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A | Back alignment and structure |
|---|
| >1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 | Back alignment and structure |
|---|
| >3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} | Back alignment and structure |
|---|
| >4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A | Back alignment and structure |
|---|
| >3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* | Back alignment and structure |
|---|
| >3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* | Back alignment and structure |
|---|
| >3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* | Back alignment and structure |
|---|
| >2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A | Back alignment and structure |
|---|
| >1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* | Back alignment and structure |
|---|
| >4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* | Back alignment and structure |
|---|
| >3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 | Back alignment and structure |
|---|
| >3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A | Back alignment and structure |
|---|
| >4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* | Back alignment and structure |
|---|
| >2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* | Back alignment and structure |
|---|
| >3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* | Back alignment and structure |
|---|
| >3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A | Back alignment and structure |
|---|
| >3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* | Back alignment and structure |
|---|
| >1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A | Back alignment and structure |
|---|
| >1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 | Back alignment and structure |
|---|
| >3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A | Back alignment and structure |
|---|
| >3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} | Back alignment and structure |
|---|
| >3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* | Back alignment and structure |
|---|
| >3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A | Back alignment and structure |
|---|
| >1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A | Back alignment and structure |
|---|
| >2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* | Back alignment and structure |
|---|
| >1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A | Back alignment and structure |
|---|
| >3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} | Back alignment and structure |
|---|
| >3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A | Back alignment and structure |
|---|
| >1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* | Back alignment and structure |
|---|
| >3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A | Back alignment and structure |
|---|
| >4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* | Back alignment and structure |
|---|
| >3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* | Back alignment and structure |
|---|
| >3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* | Back alignment and structure |
|---|
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* | Back alignment and structure |
|---|
| >3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* | Back alignment and structure |
|---|
| >3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* | Back alignment and structure |
|---|
| >3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A | Back alignment and structure |
|---|
| >3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* | Back alignment and structure |
|---|
| >2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A | Back alignment and structure |
|---|
| >3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A | Back alignment and structure |
|---|
| >3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* | Back alignment and structure |
|---|
| >3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A | Back alignment and structure |
|---|
| >3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* | Back alignment and structure |
|---|
| >1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* | Back alignment and structure |
|---|
| >3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A | Back alignment and structure |
|---|
| >2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* | Back alignment and structure |
|---|
| >1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* | Back alignment and structure |
|---|
| >4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A | Back alignment and structure |
|---|
| >3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 | Back alignment and structure |
|---|
| >3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* | Back alignment and structure |
|---|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 | Back alignment and structure |
|---|
| >4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A | Back alignment and structure |
|---|
| >1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* | Back alignment and structure |
|---|
| >1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 284 | ||||
| d1v3wa_ | 173 | b.81.1.5 (A:) Ferripyochelin binding protein {Arch | 6e-18 | |
| d1qrea_ | 210 | b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon M | 3e-17 | |
| d1xhda_ | 172 | b.81.1.5 (A:) Putative acetyltransferase/acyltrans | 6e-17 | |
| d1xata_ | 208 | b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudo | 6e-09 | |
| d1g97a1 | 196 | b.81.1.4 (A:252-447) N-acetylglucosamine 1-phospha | 5e-08 | |
| d1ocxa_ | 182 | b.81.1.3 (A:) Maltose O-acetyltransferase {Escheri | 1e-06 | |
| d1mr7a_ | 203 | b.81.1.3 (A:) Xenobiotic acetyltransferase {Entero | 1e-06 | |
| d1krra_ | 200 | b.81.1.3 (A:) Galactoside acetyltransferase {Esche | 2e-06 | |
| d1ssqa_ | 241 | b.81.1.6 (A:) Serine acetyltransferase {Haemophilu | 7e-06 | |
| d3bswa1 | 193 | b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylo | 8e-05 | |
| d2jf2a1 | 262 | b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra | 0.003 | |
| d1fxja1 | 78 | b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha | 0.003 |
| >d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 173 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Single-stranded left-handed beta-helix superfamily: Trimeric LpxA-like enzymes family: gamma-carbonic anhydrase-like domain: Ferripyochelin binding protein species: Archaeon Pyrococcus horikoshii [TaxId: 53953]
Score = 77.3 bits (189), Expect = 6e-18
Identities = 57/195 (29%), Positives = 87/195 (44%), Gaps = 31/195 (15%)
Query: 65 IIPLGQWVPKVAVDAYVAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNVQERC 124
I + P++ A+V N V+ G V + + SVWP +VLRGD+ +I VG SNVQ+
Sbjct: 3 IYEINGKKPRIHPSAFVDENAVVIGDVVLEEKTSVWPSAVLRGDIEQIYVGKYSNVQDNV 62
Query: 125 VLHAAWNSPYRFVGFVSLLIDLQMSCPRSNSLYIAWLPAETSIERFVTIGAYCSLRSCTI 184
+H + P +VTIG + +
Sbjct: 63 SIHTSHGYPTEI-------------------------------GEYVTIGHNAMVHGAKV 91
Query: 185 EPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPTGELWAGNPARFVRTLTHEETLE 244
IIG S++++G+ + H I+ AG+V+PP + IP L G P + VR LT EE
Sbjct: 92 GNYVIIGISSVILDGAKIGDHVIIGAGAVVPPNKEIPDYSLVLGVPGKVVRQLTEEEIEW 151
Query: 245 IPKLAVAINDLSKSH 259
K A +L++ H
Sbjct: 152 TKKNAEIYVELAEKH 166
|
| >d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Length = 210 | Back information, alignment and structure |
|---|
| >d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} Length = 172 | Back information, alignment and structure |
|---|
| >d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} Length = 208 | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 196 | Back information, alignment and structure |
|---|
| >d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} Length = 182 | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Length = 203 | Back information, alignment and structure |
|---|
| >d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} Length = 200 | Back information, alignment and structure |
|---|
| >d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} Length = 241 | Back information, alignment and structure |
|---|
| >d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Length = 193 | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 284 | |||
| d1xhda_ | 172 | Putative acetyltransferase/acyltransferase BC4754 | 99.97 | |
| d1v3wa_ | 173 | Ferripyochelin binding protein {Archaeon Pyrococcu | 99.96 | |
| d2jf2a1 | 262 | UDP N-acetylglucosamine acyltransferase {Escherich | 99.93 | |
| d1qrea_ | 210 | gamma-carbonic anhydrase {Archaeon Methanosarcina | 99.92 | |
| d1krra_ | 200 | Galactoside acetyltransferase {Escherichia coli [T | 99.91 | |
| d1j2za_ | 259 | UDP N-acetylglucosamine acyltransferase {Helicobac | 99.91 | |
| d1ocxa_ | 182 | Maltose O-acetyltransferase {Escherichia coli [Tax | 99.87 | |
| d1g97a1 | 196 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.85 | |
| d3bswa1 | 193 | Acetyltransferase PglD {Campylobacter jejuni [TaxI | 99.84 | |
| d1mr7a_ | 203 | Xenobiotic acetyltransferase {Enterococcus faecium | 99.84 | |
| d1xata_ | 208 | Xenobiotic acetyltransferase {Pseudomonas aerugino | 99.83 | |
| d2oi6a1 | 201 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.75 | |
| d1j2za_ | 259 | UDP N-acetylglucosamine acyltransferase {Helicobac | 99.75 | |
| d1ssqa_ | 241 | Serine acetyltransferase {Haemophilus influenzae [ | 99.71 | |
| d1xhda_ | 172 | Putative acetyltransferase/acyltransferase BC4754 | 99.68 | |
| d1qrea_ | 210 | gamma-carbonic anhydrase {Archaeon Methanosarcina | 99.66 | |
| d2jf2a1 | 262 | UDP N-acetylglucosamine acyltransferase {Escherich | 99.61 | |
| d3tdta_ | 274 | Tetrahydrodipicolinate-N-succinlytransferase, THDP | 99.59 | |
| d1g97a1 | 196 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.53 | |
| d1v3wa_ | 173 | Ferripyochelin binding protein {Archaeon Pyrococcu | 99.5 | |
| d2oi6a1 | 201 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.49 | |
| d1krra_ | 200 | Galactoside acetyltransferase {Escherichia coli [T | 99.45 | |
| d1fxja1 | 78 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.44 | |
| d3bswa1 | 193 | Acetyltransferase PglD {Campylobacter jejuni [TaxI | 99.44 | |
| d1fxja1 | 78 | N-acetylglucosamine 1-phosphate uridyltransferase | 99.41 | |
| d1yp2a1 | 135 | Glucose-1-phosphate adenylyltransferase small subu | 99.38 | |
| d1ocxa_ | 182 | Maltose O-acetyltransferase {Escherichia coli [Tax | 99.26 | |
| d3tdta_ | 274 | Tetrahydrodipicolinate-N-succinlytransferase, THDP | 99.26 | |
| d1yp2a1 | 135 | Glucose-1-phosphate adenylyltransferase small subu | 99.23 | |
| d1mr7a_ | 203 | Xenobiotic acetyltransferase {Enterococcus faecium | 99.2 | |
| d1ssqa_ | 241 | Serine acetyltransferase {Haemophilus influenzae [ | 99.17 | |
| d1xata_ | 208 | Xenobiotic acetyltransferase {Pseudomonas aerugino | 99.1 | |
| d2f9ca1 | 320 | Hypothetical protein YdcK {Salmonella enterica [Ta | 99.03 | |
| d2f9ca1 | 320 | Hypothetical protein YdcK {Salmonella enterica [Ta | 98.8 |
| >d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Single-stranded left-handed beta-helix superfamily: Trimeric LpxA-like enzymes family: gamma-carbonic anhydrase-like domain: Putative acetyltransferase/acyltransferase BC4754 species: Bacillus cereus [TaxId: 1396]
Probab=99.97 E-value=2.7e-29 Score=207.20 Aligned_cols=166 Identities=31% Similarity=0.555 Sum_probs=150.9
Q ss_pred ceeeecCCCCceeCCCcEEcCCcEEecceEECCCCEECCCCEEecCCCcEEECCCCEECCCCEEecCCCCCcccccceee
Q 039842 63 RQIIPLGQWVPKVAVDAYVAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNVQERCVLHAAWNSPYRFVGFVSL 142 (284)
Q Consensus 63 ~~~~~~~~~~~~i~~~~~I~~~a~i~~~v~IG~~~~I~~~~~I~g~~~~v~IG~~~~I~~~~~I~~~~~~~~~~~g~~~~ 142 (284)
.+++++....+.|+++++|+|+++|.+++.||++|.|+++|+|.++...+.||+++.+++++.++.+..
T Consensus 3 a~i~~~~~~~~~Ig~~~~I~~~a~I~~~v~IG~~~~Ig~~~~I~~~~~~i~IG~~~~i~~~~~~~~~~~----------- 71 (172)
T d1xhda_ 3 AMIYPYKEKKPKIASSAFIADYVTITGDVYVGEESSIWFNTVIRGDVSPTIIGDRVNVQDQCTLHQSPQ----------- 71 (172)
T ss_dssp CEEECBTTBCCEECTTCEECTTCEEEEEEEECTTCEECTTCEEEEEEEEEEECTTCEECTTCEEECCTT-----------
T ss_pred cEEEecCCcCCEECCCcEECCCCEEeCCEEECCCcEecCCcccccccccccccceeeeeeeceeccCCc-----------
Confidence 345566777789999999999999999999999999999999986666789999999999999986533
Q ss_pred eecccccCCCCCccccccCCcceEECCCCEECCCceeeccEECCCCEECCCcEEcCCCEECCCCEEcCCCeeCCCCeeCC
Q 039842 143 LIDLQMSCPRSNSLYIAWLPAETSIERFVTIGAYCSLRSCTIEPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPT 222 (284)
Q Consensus 143 ~~~~~~~~~~~~~~~~~~~~~~v~Ig~~v~Ig~~~~I~~v~Igd~v~IG~~s~I~~gv~Ig~~~~I~a~s~V~~~~~I~~ 222 (284)
.+++||+++.++.++.+++++|+++|+||.+++|.++++||++|+|+++|+|.++++||+
T Consensus 72 --------------------~~~~ig~~~~~~~~~~~~~~~i~~~~~ig~~~~i~~gv~IG~~~~IgagsvV~~~~~i~~ 131 (172)
T d1xhda_ 72 --------------------YPLILEDDVTVGHQVILHSCHIKKDALIGMGSIILDGAEIGEGAFIGAGSLVSQGKKIPP 131 (172)
T ss_dssp --------------------CCEEECTTCEECTTCEEESCEECTTCEECTTCEECTTCEECTTCEECTTCEECTTCEECT
T ss_pred --------------------CCeeeeeeeeeeeeecccccccccceEEecccEeeCCcEEcCcccccceEEEeeCeEECC
Confidence 358999999999999999999999999999999999999999999999999999999999
Q ss_pred CCEEeccCceeeccCCHHHHhhhhhhHHHHHHHHHHH
Q 039842 223 GELWAGNPARFVRTLTHEETLEIPKLAVAINDLSKSH 259 (284)
Q Consensus 223 ~~vv~G~pa~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 259 (284)
+++++|+||+++++++.++..++.+..+.|.++.+.|
T Consensus 132 ~~v~~G~Pak~i~~~~~~~~~~~~~~~~~y~~~~k~y 168 (172)
T d1xhda_ 132 NTLAFGRPAKVIRELTAEDRKDMERIRTQYVEKGQYY 168 (172)
T ss_dssp TEEEEETTEEEEEECCHHHHHHHHHHHHHHHHHHHHH
T ss_pred CeEEEecCcEEECCCCHHHHHHHHHHHHHHHHHHHHH
Confidence 9999999999999999999888888888777776654
|
| >d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} | Back information, alignment and structure |
|---|
| >d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} | Back information, alignment and structure |
|---|
| >d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} | Back information, alignment and structure |
|---|
| >d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} | Back information, alignment and structure |
|---|
| >d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|