Citrus Sinensis ID: 039842


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280----
MAALARITRRALTTQLSHGHVIRRAFSTSAAATATATATTTKADAKSITPSADRVKWDYRGQRQIIPLGQWVPKVAVDAYVAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNVQERCVLHAAWNSPYRFVGFVSLLIDLQMSCPRSNSLYIAWLPAETSIERFVTIGAYCSLRSCTIEPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPTGELWAGNPARFVRTLTHEETLEIPKLAVAINDLSKSHFSEFLPYSTVYLEVEKFKKSLGITI
cHHHHHHHHHHHHHHcccccccEEEEHHHHHHHHccccccccccccccccccccccccccccEEEEEcccccccccccEEEEcccEEEEEEEEccccEEccccEEEcccccEEEccccccccccEEEEccccccccccccHHHHHcccccccccccccccccccEEEccccEEccccEEEEEEEccccEEEcccEEccccEEccccEEccccccccccccccccEEEEcccEEcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccc
cHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccccccccccccccccccHHHHcccccEEccccccccccccEEEccccEEEEEEEEccccEEcccEEEEccccEEEEcccccccccEEEEEccccccccccccEEHHHHHHEcccccccccccccccEEEcccEEEccEEEEEEEEEcccEEEEccEEEEccEEEcccEEEEEccccccccEccccEEEEcccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccc
MAALARITRRALTTQLSHGHVIRRAFSTSAAATATATAtttkadaksitpsadrvkwdyrgqrqiiplgqwvpkVAVDAYVAPNVVLAGQvtvcdgasvwpgsvlrgdlnkitVGFCSNVQERCVlhaawnspyrFVGFVSLLIDLqmscprsnslyiawlpaetsIERFVTIGAYcslrsctiepeciigqhsilmegsMVETHAILEagsvlppgrriptgelwagnparFVRTltheetleiPKLAVAINDlskshfseflpysTVYLEVEKFKKSLGITI
MAALARITRRalttqlshghvirrafstsaaatatatatttkadaksitpsadrvkwdyrGQRQIIPLGQWVPKVAVDAYVAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNVQERCVLHAAWNSPYRFVGFVSLLIDLQMSCPRSNSLYIAWLPAETSIERFVTIGAYCSLRSCTIEPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPTGELWAGNPARFVRTLTHEETLEIPKLAVAINDLSKSHFSEFLPYSTVYLEVEKFKKSLGITI
MaalaritrralttqlSHGHVIRRAFstsaaatatatatttkadaksitPSADRVKWDYRGQRQIIPLGQWVPKVAVDAYVAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNVQERCVLHAAWNSPYRFVGFVSLLIDLQMSCPRSNSLYIAWLPAETSIERFVTIGAYCSLRSCTIEPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPTGELWAGNPARFVRTLTHEETLEIPKLAVAINDLSKSHFSEFLPYSTVYLEVEKFKKSLGITI
**********ALTTQLSHGHVIRRAFS*************************DRVKWDYRGQRQIIPLGQWVPKVAVDAYVAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNVQERCVLHAAWNSPYRFVGFVSLLIDLQMSCPRSNSLYIAWLPAETSIERFVTIGAYCSLRSCTIEPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPTGELWAGNPARFVRTLTHEETLEIPKLAVAINDLSKSHFSEFLPYSTVYLEVEKFK*******
*********R*LTTQLSHGHVIRRAFSTSAAATATAT****************RVKWDYRGQRQIIPLGQWVPKVAVDAYVAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNVQERCVLHAAWNSPYRFVGFVSLLIDLQMSCPRSNSLYIAWLPAETSIERFVTIGAYCSLRSCTIEPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPTGELWAGNPARFVRTLTHEETLEIPKLAVAINDLSKSHFSEFLPYSTVYLEVEKFKKSLGIT*
MAALARITRRALTTQLSHGHVIRRAFST*********************PSADRVKWDYRGQRQIIPLGQWVPKVAVDAYVAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNVQERCVLHAAWNSPYRFVGFVSLLIDLQMSCPRSNSLYIAWLPAETSIERFVTIGAYCSLRSCTIEPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPTGELWAGNPARFVRTLTHEETLEIPKLAVAINDLSKSHFSEFLPYSTVYLEVEKFKKSLGITI
*****R*T**ALTTQLSHGHVIRRAFSTSAAATAT***************SADRVKWDYRGQRQIIPLGQWVPKVAVDAYVAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNVQERCVLHAAWNSPYRFVGFVSLLIDLQMSCPRSNSLYIAWLPAETSIERFVTIGAYCSLRSCTIEPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPTGELWAGNPARFVRTLTHEETLEIPKLAVAINDLSKSHFSEFLPYSTVYLEVEKFKKSLGITI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAALARITRRALTTQLSHGHVIRRAFSTSAAATATATATTTKADAKSITPSADRVKWDYRGQRQIIPLGQWVPKVAVDAYVAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNVQERCVLHAAWNSPYRFVGFVSLLIDLQMSCPRSNSLYIAWLPAETSIERFVTIGAYCSLRSCTIEPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPTGELWAGNPARFVRTLTHEETLEIPKLAVAINDLSKSHFSEFLPYSTVYLEVEKFKKSLGITI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query284 2.2.26 [Sep-21-2011]
Q9SMN1256 Gamma carbonic anhydrase- no no 0.890 0.988 0.698 1e-106
Q9FMV1252 Gamma carbonic anhydrase- no no 0.876 0.988 0.687 1e-105
Q94AU7258 Gamma carbonic anhydrase no no 0.669 0.736 0.347 1e-29
Q9C6B3278 Gamma carbonic anhydrase no no 0.714 0.730 0.323 1e-27
Q9FWR5275 Gamma carbonic anhydrase no no 0.669 0.690 0.337 2e-27
Q54JC2246 Uncharacterized protein D no no 0.598 0.691 0.316 9e-23
P0A9X0184 Protein YrdA OS=Shigella yes no 0.531 0.820 0.285 6e-18
P0A9W9184 Protein YrdA OS=Escherich N/A no 0.531 0.820 0.285 6e-18
O34696171 Uncharacterized transfera yes no 0.588 0.976 0.28 9e-17
Q57752159 Uncharacterized protein M yes no 0.517 0.924 0.286 8e-16
>sp|Q9SMN1|GCAL2_ARATH Gamma carbonic anhydrase-like 2, mitochondrial OS=Arabidopsis thaliana GN=GAMMACAL2 PE=1 SV=1 Back     alignment and function desciption
 Score =  385 bits (988), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 197/282 (69%), Positives = 225/282 (79%), Gaps = 29/282 (10%)

Query: 3   ALARITRRALTTQLSHGHVIRRAFSTSAAATATATATTTKADAKSITPSADRVKWDYRGQ 62
           +LARI++R++T+ +S  ++IRR F+  A A AT      K+    +TPS DRVKWDYRGQ
Sbjct: 4   SLARISKRSITSAVSS-NLIRRYFAAEAVAVATTETPKPKSQ---VTPSPDRVKWDYRGQ 59

Query: 63  RQIIPLGQWVPKVAVDAYVAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNVQE 122
           RQIIPLGQW+PKVAVDAYVAPNVVLAGQVTV DG+SVW G+VLRGDLNKITVGFCSNVQE
Sbjct: 60  RQIIPLGQWLPKVAVDAYVAPNVVLAGQVTVWDGSSVWNGAVLRGDLNKITVGFCSNVQE 119

Query: 123 RCVLHAAWNSPYRFVGFVSLLIDLQMSCPRSNSLYIAWLPAETSIERFVTIGAYCSLRSC 182
           RCV+HAAW+SP                           LPA+T I+R+VT+GAY  LRSC
Sbjct: 120 RCVVHAAWSSP-------------------------TGLPAQTLIDRYVTVGAYSLLRSC 154

Query: 183 TIEPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPTGELWAGNPARFVRTLTHEET 242
           TIEPECIIGQHSILMEGS+VET +ILEAGSVLPPGRRIP+GELW GNPARF+RTLT+EET
Sbjct: 155 TIEPECIIGQHSILMEGSLVETRSILEAGSVLPPGRRIPSGELWGGNPARFIRTLTNEET 214

Query: 243 LEIPKLAVAINDLSKSHFSEFLPYSTVYLEVEKFKKSLGITI 284
           LEIPKLAVAIN LS  +FSEFLPYST+YLEVEKFKKSLGI I
Sbjct: 215 LEIPKLAVAINHLSGDYFSEFLPYSTIYLEVEKFKKSLGIAI 256




Involved in complex I assembly in mitochondria and respiration.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FMV1|GCAL1_ARATH Gamma carbonic anhydrase-like 1, mitochondrial OS=Arabidopsis thaliana GN=GAMMACAL1 PE=1 SV=1 Back     alignment and function description
>sp|Q94AU7|GCA3_ARATH Gamma carbonic anhydrase 3, mitochondrial OS=Arabidopsis thaliana GN=GAMMACA3 PE=1 SV=1 Back     alignment and function description
>sp|Q9C6B3|GCA2_ARATH Gamma carbonic anhydrase 2, mitochondrial OS=Arabidopsis thaliana GN=GAMMACA2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FWR5|GCA1_ARATH Gamma carbonic anhydrase 1, mitochondrial OS=Arabidopsis thaliana GN=GAMMACA1 PE=1 SV=1 Back     alignment and function description
>sp|Q54JC2|Y2881_DICDI Uncharacterized protein DDB_G0288155 OS=Dictyostelium discoideum GN=DDB_G0288155 PE=1 SV=1 Back     alignment and function description
>sp|P0A9X0|YRDA_SHIFL Protein YrdA OS=Shigella flexneri GN=yrdA PE=3 SV=1 Back     alignment and function description
>sp|P0A9W9|YRDA_ECOLI Protein YrdA OS=Escherichia coli (strain K12) GN=yrdA PE=1 SV=1 Back     alignment and function description
>sp|O34696|YTOA_BACSU Uncharacterized transferase YtoA OS=Bacillus subtilis (strain 168) GN=ytoA PE=3 SV=1 Back     alignment and function description
>sp|Q57752|Y304_METJA Uncharacterized protein MJ0304 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0304 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query284
255540193253 Protein yrdA, putative [Ricinus communis 0.880 0.988 0.742 1e-115
449520511244 PREDICTED: gamma carbonic anhydrase-like 0.859 1.0 0.735 1e-114
449440536244 PREDICTED: gamma carbonic anhydrase-like 0.859 1.0 0.718 1e-111
224119706251 predicted protein [Populus trichocarpa] 0.830 0.940 0.755 1e-109
356513425253 PREDICTED: uncharacterized protein At5g6 0.862 0.968 0.702 1e-107
356527967253 PREDICTED: uncharacterized protein At3g4 0.862 0.968 0.702 1e-107
388490758253 unknown [Lotus japonicus] 0.890 1.0 0.711 1e-106
255646687253 unknown [Glycine max] 0.890 1.0 0.707 1e-106
388509710253 unknown [Medicago truncatula] 0.890 1.0 0.697 1e-105
297793931252 hypothetical protein ARALYDRAFT_496538 [ 0.876 0.988 0.695 1e-105
>gi|255540193|ref|XP_002511161.1| Protein yrdA, putative [Ricinus communis] gi|223550276|gb|EEF51763.1| Protein yrdA, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 211/284 (74%), Positives = 232/284 (81%), Gaps = 34/284 (11%)

Query: 2   AALARITRRALTTQLS-HGHVIRRAFSTSAAATATATATTTKADAKSITPSADRVKWDYR 60
           AAL+RI+++ALT+ +S   H ++R FS + + +++ T        KSITPSADRVKWDYR
Sbjct: 3   AALSRISKKALTSTISPQCHFLKRGFSAAESLSSSPT--------KSITPSADRVKWDYR 54

Query: 61  GQRQIIPLGQWVPKVAVDAYVAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNV 120
           GQRQIIPLGQW+PKVAVDAYVAPNVVLAGQVTV DGASVW GSVLRGDLNKITVGFCSNV
Sbjct: 55  GQRQIIPLGQWLPKVAVDAYVAPNVVLAGQVTVWDGASVWSGSVLRGDLNKITVGFCSNV 114

Query: 121 QERCVLHAAWNSPYRFVGFVSLLIDLQMSCPRSNSLYIAWLPAETSIERFVTIGAYCSLR 180
           QERCV+HAAWNSP                           LPAETSIER+VTIGAY  LR
Sbjct: 115 QERCVVHAAWNSP-------------------------TGLPAETSIERYVTIGAYSLLR 149

Query: 181 SCTIEPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPTGELWAGNPARFVRTLTHE 240
           SCTIEPECIIGQHSILMEGS+VETH+ILEAGSV+PPGRRIPTGELWAGNPARFVR LTHE
Sbjct: 150 SCTIEPECIIGQHSILMEGSLVETHSILEAGSVVPPGRRIPTGELWAGNPARFVRALTHE 209

Query: 241 ETLEIPKLAVAINDLSKSHFSEFLPYSTVYLEVEKFKKSLGITI 284
           ETLEIPKLAVAINDLSK+HFSEFLPYSTVYLEVEK KK LGI+I
Sbjct: 210 ETLEIPKLAVAINDLSKNHFSEFLPYSTVYLEVEKMKKKLGISI 253




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449520511|ref|XP_004167277.1| PREDICTED: gamma carbonic anhydrase-like 2, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449440536|ref|XP_004138040.1| PREDICTED: gamma carbonic anhydrase-like 2, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224119706|ref|XP_002318141.1| predicted protein [Populus trichocarpa] gi|118488068|gb|ABK95854.1| unknown [Populus trichocarpa] gi|222858814|gb|EEE96361.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356513425|ref|XP_003525414.1| PREDICTED: uncharacterized protein At5g63510, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|356527967|ref|XP_003532577.1| PREDICTED: uncharacterized protein At3g48680, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|388490758|gb|AFK33445.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255646687|gb|ACU23817.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388509710|gb|AFK42921.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|297793931|ref|XP_002864850.1| hypothetical protein ARALYDRAFT_496538 [Arabidopsis lyrata subsp. lyrata] gi|297310685|gb|EFH41109.1| hypothetical protein ARALYDRAFT_496538 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query284
TAIR|locus:2114445256 GAMMA CAL2 "gamma carbonic anh 0.619 0.687 0.647 4.3e-54
TIGR_CMR|APH_1197170 APH_1197 "hexapeptide transfer 0.338 0.564 0.416 1.1e-27
TIGR_CMR|NSE_0045185 NSE_0045 "hexapeptide transfer 0.345 0.529 0.387 2.5e-26
TIGR_CMR|ECH_1066170 ECH_1066 "hexapeptide transfer 0.338 0.564 0.364 1.2e-24
UNIPROTKB|Q48AV3179 CPS_0032 "Bacterial transferas 0.320 0.508 0.285 1.8e-22
TIGR_CMR|CPS_0032179 CPS_0032 "bacterial transferas 0.320 0.508 0.285 1.8e-22
UNIPROTKB|Q81KI7170 BAS4655 "Bacterial transferase 0.288 0.482 0.365 1.1e-21
TIGR_CMR|BA_5010170 BA_5010 "bacterial transferase 0.288 0.482 0.365 1.1e-21
UNIPROTKB|Q482R8173 CPS_2224 "Bacterial transferas 0.221 0.364 0.412 4.2e-21
TIGR_CMR|CPS_2224173 CPS_2224 "bacterial transferas 0.221 0.364 0.412 4.2e-21
TAIR|locus:2114445 GAMMA CAL2 "gamma carbonic anhydrase-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 559 (201.8 bits), Expect = 4.3e-54, P = 4.3e-54
 Identities = 125/193 (64%), Positives = 143/193 (74%)

Query:    97 ASVWPGSVLRGDLNKITVGFCSNVQERCVLHAAWNSPYRFVGFVSLLIDLQMSCPRSNSL 156
             A V P  VL G   ++TV   S+V    VL    N     VGF S   ++Q  C     +
Sbjct:    76 AYVAPNVVLAG---QVTVWDGSSVWNGAVLRGDLNKIT--VGFCS---NVQERCV----V 123

Query:   157 YIAW-----LPAETSIERFVTIGAYCSLRSCTIEPECIIGQHSILMEGSMVETHAILEAG 211
             + AW     LPA+T I+R+VT+GAY  LRSCTIEPECIIGQHSILMEGS+VET +ILEAG
Sbjct:   124 HAAWSSPTGLPAQTLIDRYVTVGAYSLLRSCTIEPECIIGQHSILMEGSLVETRSILEAG 183

Query:   212 SVLPPGRRIPTGELWAGNPARFVRTLTHEETLEIPKLAVAINDLSKSHFSEFLPYSTVYL 271
             SVLPPGRRIP+GELW GNPARF+RTLT+EETLEIPKLAVAIN LS  +FSEFLPYST+YL
Sbjct:   184 SVLPPGRRIPSGELWGGNPARFIRTLTNEETLEIPKLAVAINHLSGDYFSEFLPYSTIYL 243

Query:   272 EVEKFKKSLGITI 284
             EVEKFKKSLGI I
Sbjct:   244 EVEKFKKSLGIAI 256


GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0009853 "photorespiration" evidence=RCA;TAS
GO:0031966 "mitochondrial membrane" evidence=IDA
GO:0045271 "respiratory chain complex I" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005747 "mitochondrial respiratory chain complex I" evidence=IDA
GO:0009651 "response to salt stress" evidence=IGI
GO:0009737 "response to abscisic acid stimulus" evidence=IGI
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=IGI
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0019252 "starch biosynthetic process" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
TIGR_CMR|APH_1197 APH_1197 "hexapeptide transferase family protein" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms
TIGR_CMR|NSE_0045 NSE_0045 "hexapeptide transferase family protein" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_1066 ECH_1066 "hexapeptide transferase family protein" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
UNIPROTKB|Q48AV3 CPS_0032 "Bacterial transferase hexapeptide domain protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_0032 CPS_0032 "bacterial transferase hexapeptide domain protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q81KI7 BAS4655 "Bacterial transferase family protein" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5010 BA_5010 "bacterial transferase family protein" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|Q482R8 CPS_2224 "Bacterial transferase family protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_2224 CPS_2224 "bacterial transferase family protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
grail3.0015028601
SubName- Full=Putative uncharacterized protein; (251 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query284
PLN02472246 PLN02472, PLN02472, uncharacterized protein 1e-149
cd04645153 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydra 6e-59
PLN02296269 PLN02296, PLN02296, carbonate dehydratase 3e-42
COG0663176 COG0663, PaaY, Carbonic anhydrases/acetyltransfera 1e-41
cd04650154 cd04650, LbH_FBP, Ferripyochelin Binding Protein ( 3e-27
cd04745155 cd04745, LbH_paaY_like, paaY-like: This group is c 2e-21
TIGR02287192 TIGR02287, PaaY, phenylacetic acid degradation pro 1e-15
PRK13627196 PRK13627, PRK13627, carnitine operon protein CaiE; 2e-13
cd03359161 cd03359, LbH_Dynactin_5, Dynactin 5 (or subunit p2 1e-11
cd00710167 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases ( 2e-11
cd03358119 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed p 1e-06
cd04647109 cd04647, LbH_MAT_like, Maltose O-acyltransferase ( 1e-05
TIGR03570193 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sia 6e-05
COG0110190 COG0110, WbbJ, Acetyltransferase (isoleucine patch 8e-05
TIGR02353 695 TIGR02353, NRPS_term_dom, non-ribosomal peptide sy 9e-05
cd03353193 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosph 1e-04
COG0448393 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carb 0.002
cd0020878 cd00208, LbetaH, Left-handed parallel beta-Helix ( 0.003
>gnl|CDD|215263 PLN02472, PLN02472, uncharacterized protein Back     alignment and domain information
 Score =  416 bits (1070), Expect = e-149
 Identities = 211/284 (74%), Positives = 224/284 (78%), Gaps = 38/284 (13%)

Query: 1   MAALARITRRALTTQLSHGHVIRRAFSTSAAATATATATTTKADAKSITPSADRVKWDYR 60
             +LARI RRALT+  +    +RR F+  AAA AT            ITPS DRVKWDYR
Sbjct: 1   ATSLARIARRALTSTAAAQ--LRRGFAAEAAAAAT-----------PITPSPDRVKWDYR 47

Query: 61  GQRQIIPLGQWVPKVAVDAYVAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNV 120
           GQRQIIPLGQWVPKVAVDAYVAPNVVLAGQVTV DGASVW G+VLRGDLNKITVGFCSNV
Sbjct: 48  GQRQIIPLGQWVPKVAVDAYVAPNVVLAGQVTVWDGASVWNGAVLRGDLNKITVGFCSNV 107

Query: 121 QERCVLHAAWNSPYRFVGFVSLLIDLQMSCPRSNSLYIAWLPAETSIERFVTIGAYCSLR 180
           QERCVLHAAWNSP    G                      LPAET I+R+VTIGAY  LR
Sbjct: 108 QERCVLHAAWNSP---TG----------------------LPAETLIDRYVTIGAYSLLR 142

Query: 181 SCTIEPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPTGELWAGNPARFVRTLTHE 240
           SCTIEPECIIGQHSILMEGS+VETH+ILEAGSVLPPGRRIPTGELWAGNPARFVRTLT+E
Sbjct: 143 SCTIEPECIIGQHSILMEGSLVETHSILEAGSVLPPGRRIPTGELWAGNPARFVRTLTNE 202

Query: 241 ETLEIPKLAVAINDLSKSHFSEFLPYSTVYLEVEKFKKSLGITI 284
           ETLEIPKLAVAINDLS+SHFSEFLPYST YLEVEK KKSLGI +
Sbjct: 203 ETLEIPKLAVAINDLSQSHFSEFLPYSTAYLEVEKLKKSLGIAL 246


Length = 246

>gnl|CDD|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>gnl|CDD|215167 PLN02296, PLN02296, carbonate dehydratase Back     alignment and domain information
>gnl|CDD|223735 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|100055 cd04650, LbH_FBP, Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>gnl|CDD|100058 cd04745, LbH_paaY_like, paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>gnl|CDD|131340 TIGR02287, PaaY, phenylacetic acid degradation protein PaaY Back     alignment and domain information
>gnl|CDD|184189 PRK13627, PRK13627, carnitine operon protein CaiE; Provisional Back     alignment and domain information
>gnl|CDD|100049 cd03359, LbH_Dynactin_5, Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>gnl|CDD|100039 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>gnl|CDD|100053 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>gnl|CDD|234265 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>gnl|CDD|223188 COG0110, WbbJ, Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|233832 TIGR02353, NRPS_term_dom, non-ribosomal peptide synthetase terminal domain of unknown function Back     alignment and domain information
>gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>gnl|CDD|223525 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 284
PLN02472246 uncharacterized protein 100.0
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isole 100.0
PLN02296269 carbonate dehydratase 99.97
PRK13627196 carnitine operon protein CaiE; Provisional 99.97
TIGR02287192 PaaY phenylacetic acid degradation protein PaaY. M 99.96
cd04745155 LbH_paaY_like paaY-like: This group is composed by 99.94
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP 99.93
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: T 99.92
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.92
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact 99.92
TIGR01853324 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam 99.91
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact 99.89
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac 99.89
cd03351254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr 99.88
PRK05289262 UDP-N-acetylglucosamine acyltransferase; Provision 99.88
PRK12461255 UDP-N-acetylglucosamine acyltransferase; Provision 99.88
TIGR01852254 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac 99.88
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla 99.86
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 99.85
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo 99.84
COG1043260 LpxA Acyl-[acyl carrier protein] 99.83
PRK10502182 putative acyl transferase; Provisional 99.82
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas 99.82
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transfe 99.82
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac 99.81
PRK10092183 maltose O-acetyltransferase; Provisional 99.8
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl 99.8
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.79
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel be 99.78
TIGR01852254 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-ac 99.77
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and 99.77
KOG3121184 consensus Dynactin, subunit p25 [Cytoskeleton] 99.76
PRK12461255 UDP-N-acetylglucosamine acyltransferase; Provision 99.75
COG1043260 LpxA Acyl-[acyl carrier protein] 99.75
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl 99.75
TIGR01173451 glmU UDP-N-acetylglucosamine diphosphorylase/gluco 99.75
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 99.74
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d 99.74
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of 99.74
TIGR00965269 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate 99.73
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Lef 99.73
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-d 99.73
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate 99.72
KOG4042190 consensus Dynactin subunit p27/WS-3, involved in t 99.71
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfami 99.71
PRK11830272 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- 99.71
PRK11132273 cysE serine acetyltransferase; Provisional 99.71
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isole 99.71
cd03351254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltr 99.71
PRK05289262 UDP-N-acetylglucosamine acyltransferase; Provision 99.7
PRK14357448 glmU bifunctional N-acetylglucosamine-1-phosphate 99.7
PRK14355459 glmU bifunctional N-acetylglucosamine-1-phosphate 99.7
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thy 99.69
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT 99.69
PRK14353446 glmU bifunctional N-acetylglucosamine-1-phosphate 99.69
PRK14360450 glmU bifunctional N-acetylglucosamine-1-phosphate 99.68
PLN02694294 serine O-acetyltransferase 99.68
PRK14353446 glmU bifunctional N-acetylglucosamine-1-phosphate 99.68
PRK14352482 glmU bifunctional N-acetylglucosamine-1-phosphate 99.67
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransfe 99.67
PLN02739355 serine acetyltransferase 99.67
PRK14359430 glmU bifunctional N-acetylglucosamine-1-phosphate 99.67
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferas 99.67
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: 99.67
TIGR01853324 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosam 99.66
PRK13627196 carnitine operon protein CaiE; Provisional 99.64
PRK14358481 glmU bifunctional N-acetylglucosamine-1-phosphate 99.64
TIGR01172162 cysE serine O-acetyltransferase. Cysteine biosynth 99.63
PLN02296269 carbonate dehydratase 99.63
TIGR02287192 PaaY phenylacetic acid degradation protein PaaY. M 99.62
COG1045194 CysE Serine acetyltransferase [Amino acid transpor 99.62
PLN02472246 uncharacterized protein 99.61
PLN02357360 serine acetyltransferase 99.61
PRK14356456 glmU bifunctional N-acetylglucosamine-1-phosphate 99.6
PRK14354458 glmU bifunctional N-acetylglucosamine-1-phosphate 99.6
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbo 99.59
KOG4750269 consensus Serine O-acetyltransferase [Amino acid t 99.58
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thy 99.58
cd04745155 LbH_paaY_like paaY-like: This group is composed by 99.57
PRK10191146 putative acyl transferase; Provisional 99.56
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: T 99.56
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynact 99.55
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT cataly 99.54
PRK14360450 glmU bifunctional N-acetylglucosamine-1-phosphate 99.51
TIGR00965269 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate 99.51
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah 99.5
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase 99.5
TIGR01173451 glmU UDP-N-acetylglucosamine diphosphorylase/gluco 99.49
KOG1461 673 consensus Translation initiation factor 2B, epsilo 99.49
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxyla 99.48
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyl 99.48
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP 99.48
PRK14352482 glmU bifunctional N-acetylglucosamine-1-phosphate 99.48
PRK14355459 glmU bifunctional N-acetylglucosamine-1-phosphate 99.47
PRK11830272 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N- 99.46
PRK14358481 glmU bifunctional N-acetylglucosamine-1-phosphate 99.46
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynact 99.45
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl 99.41
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transfe 99.41
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate 99.4
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo 99.4
PRK14357448 glmU bifunctional N-acetylglucosamine-1-phosphate 99.39
TIGR02353 695 NRPS_term_dom non-ribosomal peptide synthetase ter 99.38
PRK14354458 glmU bifunctional N-acetylglucosamine-1-phosphate 99.38
PRK14359430 glmU bifunctional N-acetylglucosamine-1-phosphate 99.38
PRK14356456 glmU bifunctional N-acetylglucosamine-1-phosphate 99.38
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Lef 99.37
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl 99.35
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-a 99.35
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransfe 99.31
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrah 99.3
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed 99.3
TIGR02353695 NRPS_term_dom non-ribosomal peptide synthetase ter 99.29
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal 99.27
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central 99.26
KOG1461 673 consensus Translation initiation factor 2B, epsilo 99.25
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed 99.24
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix 99.23
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel be 99.22
PRK05293380 glgC glucose-1-phosphate adenylyltransferase; Prov 99.22
PRK11132273 cysE serine acetyltransferase; Provisional 99.21
PRK10502182 putative acyl transferase; Provisional 99.2
TIGR01172162 cysE serine O-acetyltransferase. Cysteine biosynth 99.18
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxyl 99.18
PRK10191146 putative acyl transferase; Provisional 99.18
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr 99.18
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or 99.16
COG1045194 CysE Serine acetyltransferase [Amino acid transpor 99.16
PLN02739355 serine acetyltransferase 99.15
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal 99.15
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central 99.14
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas 99.13
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarbo 99.13
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 99.1
PLN02694294 serine O-acetyltransferase 99.09
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix 99.07
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltr 99.06
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or 99.06
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera 99.05
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and 99.05
PLN02357360 serine acetyltransferase 99.04
TIGR01208353 rmlA_long glucose-1-phosphate thymidylylransferase 99.03
PLN02241436 glucose-1-phosphate adenylyltransferase 99.03
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase 99.01
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT cataly 99.0
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: 98.99
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransfera 98.97
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of 98.96
PRK10092183 maltose O-acetyltransferase; Provisional 98.94
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Prov 98.91
KOG1462433 consensus Translation initiation factor 2B, gamma 98.86
PRK05293380 glgC glucose-1-phosphate adenylyltransferase; Prov 98.86
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas 98.84
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT 98.84
TIGR01208353 rmlA_long glucose-1-phosphate thymidylylransferase 98.84
PLN02241436 glucose-1-phosphate adenylyltransferase 98.83
KOG3121184 consensus Dynactin, subunit p25 [Cytoskeleton] 98.82
TIGR02091361 glgC glucose-1-phosphate adenylyltransferase. This 98.73
KOG1460407 consensus GDP-mannose pyrophosphorylase [Carbohydr 98.68
TIGR02091361 glgC glucose-1-phosphate adenylyltransferase. This 98.63
KOG1462433 consensus Translation initiation factor 2B, gamma 98.63
PRK00844407 glgC glucose-1-phosphate adenylyltransferase; Prov 98.62
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfami 98.57
KOG4750269 consensus Serine O-acetyltransferase [Amino acid t 98.57
KOG4042190 consensus Dynactin subunit p27/WS-3, involved in t 98.57
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate t 98.57
TIGR02092369 glgD glucose-1-phosphate adenylyltransferase, GlgD 98.52
PRK00725425 glgC glucose-1-phosphate adenylyltransferase; Prov 98.52
PRK00725425 glgC glucose-1-phosphate adenylyltransferase; Prov 98.51
TIGR02092369 glgD glucose-1-phosphate adenylyltransferase, GlgD 98.5
PRK00844407 glgC glucose-1-phosphate adenylyltransferase; Prov 98.47
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Prov 98.44
KOG1322371 consensus GDP-mannose pyrophosphorylase/mannose-1- 98.4
KOG1460407 consensus GDP-mannose pyrophosphorylase [Carbohydr 98.39
PF1460234 Hexapep_2: Hexapeptide repeat of succinyl-transfer 98.36
PF1460234 Hexapep_2: Hexapeptide repeat of succinyl-transfer 98.26
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate t 98.2
PF0013236 Hexapep: Bacterial transferase hexapeptide (six re 98.08
KOG1322371 consensus GDP-mannose pyrophosphorylase/mannose-1- 98.07
PF0013236 Hexapep: Bacterial transferase hexapeptide (six re 97.73
COG4801 277 Predicted acyltransferase [General function predic 97.41
COG4801277 Predicted acyltransferase [General function predic 96.95
PF07959414 Fucokinase: L-fucokinase; InterPro: IPR012887 In t 87.66
PF07959414 Fucokinase: L-fucokinase; InterPro: IPR012887 In t 86.76
PF0461372 LpxD: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 84.99
PF1372083 Acetyltransf_11: Udp N-acetylglucosamine O-acyltra 84.39
>PLN02472 uncharacterized protein Back     alignment and domain information
Probab=100.00  E-value=3.8e-37  Score=270.47  Aligned_cols=246  Identities=85%  Similarity=1.319  Sum_probs=217.5

Q ss_pred             ChhhhhhhHhhhhhhcccchhhhhhhhhhhhhhccccccccccCCCCCCCCcccccccccccceeeecCCCCceeCCCcE
Q 039842            1 MAALARITRRALTTQLSHGHVIRRAFSTSAAATATATATTTKADAKSITPSADRVKWDYRGQRQIIPLGQWVPKVAVDAY   80 (284)
Q Consensus         1 ~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~   80 (284)
                      |++|+|+.+..++.....  .+++.++..++.+.+           ...+...+.+|+|..++++..+....|.++.+++
T Consensus         1 ~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~-----------~~~~~~~~~~~~~~~~~~~~~~~~~~p~i~~~~~   67 (246)
T PLN02472          1 ATSLARIARRALTSTAAA--QLRRGFAAEAAAAAT-----------PITPSPDRVKWDYRGQRQIIPLGQWVPKVAVDAY   67 (246)
T ss_pred             ChhHHHHHHHhhhhhhhh--hhcCCcchhhhcccC-----------CCCCcccccccCcCCcceEEecCCcCCccCCCCE
Confidence            788999988888766555  344444443333321           1345678899999999999999999999999999


Q ss_pred             EcCCcEEecceEECCCCEECCCCEEecCCCcEEECCCCEECCCCEEecCCCCCcccccceeeeecccccCCCCCcccccc
Q 039842           81 VAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNVQERCVLHAAWNSPYRFVGFVSLLIDLQMSCPRSNSLYIAW  160 (284)
Q Consensus        81 I~~~a~i~~~v~IG~~~~I~~~~~I~g~~~~v~IG~~~~I~~~~~I~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~  160 (284)
                      |.|++.+.+++.||+++.|+++++|+|+.+.++||++|.|+++|+|+.....+..                         
T Consensus        68 I~p~a~i~G~V~Ig~~a~I~~gavirgd~~~I~IG~~t~Ig~~~vI~~~~~~~~~-------------------------  122 (246)
T PLN02472         68 VAPNVVLAGQVTVWDGASVWNGAVLRGDLNKITVGFCSNVQERCVLHAAWNSPTG-------------------------  122 (246)
T ss_pred             ECCCCEEecCEEECCCCEEcCCCEEecCCcceEECCCCEECCCCEEeecCccccC-------------------------
Confidence            9999999999999999999999999999889999999999999999865421111                         


Q ss_pred             CCcceEECCCCEECCCceeeccEECCCCEECCCcEEcCCCEECCCCEEcCCCeeCCCCeeCCCCEEeccCceeeccCCHH
Q 039842          161 LPAETSIERFVTIGAYCSLRSCTIEPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPTGELWAGNPARFVRTLTHE  240 (284)
Q Consensus       161 ~~~~v~Ig~~v~Ig~~~~I~~v~Igd~v~IG~~s~I~~gv~Ig~~~~I~a~s~V~~~~~I~~~~vv~G~pa~~~~~~~~~  240 (284)
                      .+.+++||++|.||++|+|++++||++|+||.+|+|.++++||++++|+++++|.++..+|++.++.|+||++++.+.++
T Consensus       123 i~~~tvIG~~v~IG~~s~L~~~~Igd~v~IG~~svI~~gavIg~~~~Ig~gsvV~~g~~Ip~g~~~~G~PA~~~~~~~~~  202 (246)
T PLN02472        123 LPAETLIDRYVTIGAYSLLRSCTIEPECIIGQHSILMEGSLVETHSILEAGSVLPPGRRIPTGELWAGNPARFVRTLTNE  202 (246)
T ss_pred             CCCCcEECCCCEECCCcEECCeEEcCCCEECCCCEECCCCEECCCCEECCCCEECCCCEeCCCCEEEecCCEEeccCCHH
Confidence            23468999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhhhhhHHHHHHHHHHHHhccccchHHHHHHHHHHHHhCCCC
Q 039842          241 ETLEIPKLAVAINDLSKSHFSEFLPYSTVYLEVEKFKKSLGITI  284 (284)
Q Consensus       241 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  284 (284)
                      +...++...+.|.++.+.|.+.|.++...|.+.+++++++++.+
T Consensus       203 ~~~~l~~~a~~y~~l~k~~~~~~~~~~~~~~~~~~~~~~~~~~~  246 (246)
T PLN02472        203 ETLEIPKLAVAINDLSQSHFSEFLPYSTAYLEVEKLKKSLGIAL  246 (246)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhccccchhHHHHHHHHHHhccCC
Confidence            99999999999999999999999999999999999999999864



>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>PLN02296 carbonate dehydratase Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>PRK10502 putative acyl transferase; Provisional Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] Back     alignment and domain information
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>COG1043 LpxA Acyl-[acyl carrier protein] Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PLN02694 serine O-acetyltransferase Back     alignment and domain information
>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02739 serine acetyltransferase Back     alignment and domain information
>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>PRK13627 carnitine operon protein CaiE; Provisional Back     alignment and domain information
>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase Back     alignment and domain information
>PLN02296 carbonate dehydratase Back     alignment and domain information
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02472 uncharacterized protein Back     alignment and domain information
>PLN02357 serine acetyltransferase Back     alignment and domain information
>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>PRK10191 putative acyl transferase; Provisional Back     alignment and domain information
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition Back     alignment and domain information
>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>PRK14358 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport Back     alignment and domain information
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>PRK14357 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function Back     alignment and domain information
>PRK14354 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14359 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PRK14356 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional Back     alignment and domain information
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>KOG1461 consensus Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK11132 cysE serine acetyltransferase; Provisional Back     alignment and domain information
>PRK10502 putative acyl transferase; Provisional Back     alignment and domain information
>TIGR01172 cysE serine O-acetyltransferase Back     alignment and domain information
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>PRK10191 putative acyl transferase; Provisional Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02739 serine acetyltransferase Back     alignment and domain information
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon) Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed Back     alignment and domain information
>PLN02694 serine O-acetyltransferase Back     alignment and domain information
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma Back     alignment and domain information
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase Back     alignment and domain information
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>PLN02357 serine acetyltransferase Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>PLN02241 glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase Back     alignment and domain information
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>PRK10092 maltose O-acetyltransferase; Provisional Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>PLN02241 glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>KOG3121 consensus Dynactin, subunit p25 [Cytoskeleton] Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>KOG1462 consensus Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>KOG4750 consensus Serine O-acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4042 consensus Dynactin subunit p27/WS-3, involved in transport of organelles along microtubules [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1460 consensus GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A Back     alignment and domain information
>PF14602 Hexapep_2: Hexapeptide repeat of succinyl-transferase; PDB: 2P2O_B 2IC7_B 2RIJ_A 3FSY_B 3FSX_D 3CJ8_A 1QRE_A 1QRG_A 1THJ_B 1QRM_A Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix Back     alignment and domain information
>KOG1322 consensus GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF00132 Hexapep: Bacterial transferase hexapeptide (six repeats); InterPro: IPR001451 A variety of bacterial transferases contain a repeat structure composed of tandem repeats of a [LIV]-G-X(4) hexapeptide, which, in the tertiary structure of LpxA (UDP N-acetylglucosamine acyltransferase) [], has been shown to form a left-handed parallel beta helix Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>COG4801 Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] Back     alignment and domain information
>PF07959 Fucokinase: L-fucokinase; InterPro: IPR012887 In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase [] Back     alignment and domain information
>PF04613 LpxD: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD ; InterPro: IPR020573 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (2 Back     alignment and domain information
>PF13720 Acetyltransf_11: Udp N-acetylglucosamine O-acyltransferase; Domain 2; PDB: 3I3A_A 3I3X_A 3HSQ_B 2JF2_A 1LXA_A 2AQ9_A 2QIV_X 2QIA_A 2JF3_A 4EQY_F Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query284
3ixc_A191 Crystal Structure Of Hexapeptide Transferase Family 4e-27
1v3w_A173 Structure Of Ferripyochelin Binding Protein From Py 5e-20
3r1w_A189 Crystal Structure Of A Carbonic Anhydrase From A Cr 3e-19
1xhd_A173 X-Ray Crystal Structure Of Putative Acetyltransfera 4e-19
3tio_A183 Crystal Structures Of Yrda From Escherichia Coli, A 7e-19
3vnp_A183 Crystal Structure Of Hypothetical Protein (Gk2848) 1e-18
3r3r_A187 Structure Of The Yrda Ferripyochelin Binding Protei 1e-17
>pdb|3IXC|A Chain A, Crystal Structure Of Hexapeptide Transferase Family Protein From Anaplasma Phagocytophilum Length = 191 Back     alignment and structure

Iteration: 1

Score = 118 bits (295), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 66/196 (33%), Positives = 106/196 (54%), Gaps = 30/196 (15%) Query: 65 IIPLGQWVPKVAVDAYVAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNVQERC 124 ++P P V A++A N + G V + AS+W G+VLRGD++KI VG +N+Q+ Sbjct: 26 LVPYAGVSPSVDSTAFIAGNARIIGDVCIGKNASIWYGTVLRGDVDKIEVGEGTNIQDNT 85 Query: 125 VLHAAWNSPYRFVGFVSLLIDLQMSCPRSNSLYIAWLPAETSIERFVTIGAYCSLRSCTI 184 V+H ++S++ +T I +FVTIG C L +CT+ Sbjct: 86 VVH-------------------------TDSMH-----GDTVIGKFVTIGHSCILHACTL 115 Query: 185 EPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPTGELWAGNPARFVRTLTHEETLE 244 +G SI+M+ +++E ++L AGS+L G+ + +GELWAG PA+F+R +T EE L Sbjct: 116 GNNAFVGMGSIVMDRAVMEEGSMLAAGSLLTRGKIVKSGELWAGRPAKFLRMMTEEEILY 175 Query: 245 IPKLAVAINDLSKSHF 260 + K A LS+ + Sbjct: 176 LQKSAENYIALSRGYL 191
>pdb|1V3W|A Chain A, Structure Of Ferripyochelin Binding Protein From Pyrococcus Horikoshii Ot3 Length = 173 Back     alignment and structure
>pdb|3R1W|A Chain A, Crystal Structure Of A Carbonic Anhydrase From A Crude Oil Degrading Psychrophilic Library Length = 189 Back     alignment and structure
>pdb|1XHD|A Chain A, X-Ray Crystal Structure Of Putative Acetyltransferase, Product Of Bc4754 Gene [bacillus Cereus] Length = 173 Back     alignment and structure
>pdb|3TIO|A Chain A, Crystal Structures Of Yrda From Escherichia Coli, A Homologous Protein Of Gamma-Class Carbonic Anhydrase, Show Possible Allosteric Conformations Length = 183 Back     alignment and structure
>pdb|3VNP|A Chain A, Crystal Structure Of Hypothetical Protein (Gk2848) From Geobacillus Kaustophilus Length = 183 Back     alignment and structure
>pdb|3R3R|A Chain A, Structure Of The Yrda Ferripyochelin Binding Protein From Salmonella Enterica Length = 187 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query284
3r1w_A189 Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid 2e-54
3r3r_A187 Ferripyochelin binding protein; structural genomic 3e-53
3ixc_A191 Hexapeptide transferase family protein; niaid, ssg 2e-50
1xhd_A173 Putative acetyltransferase/acyltransferase; struct 1e-49
1v3w_A173 Ferripyochelin binding protein; beta-helix, carbon 6e-48
1qre_A247 Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth 8e-39
3kwd_A213 Carbon dioxide concentrating mechanism protein; LE 2e-33
3vbi_A205 ANTD, galactoside O-acetyltransferase; anthrose, a 2e-11
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 3e-10
3r8y_A240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac 9e-08
3c8v_A496 Putative acetyltransferase; YP_390128.1, structura 1e-07
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 2e-07
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 4e-07
4e8l_A219 Virginiamycin A acetyltransferase; structural geno 1e-06
1xat_A212 Xenobiotic acetyltransferase; chloramphenicol, LEF 2e-06
1mr7_A209 Streptogramin A acetyltransferase; LEFT-handed par 4e-06
3eev_A212 Chloramphenicol acetyltransferase; beta-helix, str 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
3fs8_A273 QDTC; acetyltransferase, natural product, deoxysug 5e-05
3jqy_B252 NEUO, polysialic acid O-acetyltransferase; LEFT-ha 3e-04
1krr_A203 Galactoside O-acetyltransferase; LEFT-handed paral 5e-04
3ftt_A199 Putative acetyltransferase sacol2570; galactoside 6e-04
>3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} Length = 189 Back     alignment and structure
 Score =  174 bits (442), Expect = 2e-54
 Identities = 58/198 (29%), Positives = 91/198 (45%), Gaps = 24/198 (12%)

Query: 65  IIPLGQWVPKVAVDAYVAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNVQERC 124
           +       PK+    +V  + V+ G V + D  SVWP +V+RGD++ I +G  ++VQ+  
Sbjct: 12  VRTYQGISPKLGERVFVDRSSVIIGDVELGDDCSVWPLAVIRGDMHHIRIGARTSVQDGS 71

Query: 125 VLHAAWNSPYRFVGFVSLLIDLQMSCPRSNSLYIAWLPAETSIERFVTIGAYCSLRSCTI 184
           VLH    S Y   G+                           I   VTIG    L  CTI
Sbjct: 72  VLHITHASDYNPGGY------------------------PLIIGDDVTIGHQAMLHGCTI 107

Query: 185 EPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPTGELWAGNPARFVRTLTHEETLE 244
               +IG  S++M+G++VE   I+ AG+ + PG+ + +G ++ G PA+ VR +T +E   
Sbjct: 108 GNRVLIGMKSMIMDGAIVEDEVIVAAGATVSPGKVLESGFVYMGTPAKKVRPITEKERSF 167

Query: 245 IPKLAVAINDLSKSHFSE 262
               A     L   H +E
Sbjct: 168 FTYGAGNYVRLKDKHLAE 185


>3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} Length = 187 Back     alignment and structure
>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Length = 191 Back     alignment and structure
>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Length = 173 Back     alignment and structure
>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Length = 173 Back     alignment and structure
>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A Length = 247 Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Length = 213 Back     alignment and structure
>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Length = 205 Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Length = 220 Back     alignment and structure
>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Length = 240 Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Length = 496 Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Length = 194 Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Length = 192 Back     alignment and structure
>4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} Length = 219 Back     alignment and structure
>1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* Length = 212 Back     alignment and structure
>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Length = 209 Back     alignment and structure
>3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} Length = 212 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Length = 273 Back     alignment and structure
>3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} Length = 252 Back     alignment and structure
>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Length = 203 Back     alignment and structure
>3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* Length = 199 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query284
3r1w_A189 Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid 99.96
3r3r_A187 Ferripyochelin binding protein; structural genomic 99.96
1v3w_A173 Ferripyochelin binding protein; beta-helix, carbon 99.96
1xhd_A173 Putative acetyltransferase/acyltransferase; struct 99.96
3ixc_A191 Hexapeptide transferase family protein; niaid, ssg 99.96
3tv0_A194 Dynactin subunit 6; LEFT-handed beta-helix, ARP11, 99.96
3pmo_A372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 99.93
3fs8_A273 QDTC; acetyltransferase, natural product, deoxysug 99.92
3eh0_A341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 99.92
3vbi_A205 ANTD, galactoside O-acetyltransferase; anthrose, a 99.92
4e79_A357 UDP-3-O-acylglucosamine N-acyltransferase; lipopol 99.92
3kwd_A213 Carbon dioxide concentrating mechanism protein; LE 99.92
1qre_A247 Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth 99.91
3hsq_A259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam 99.91
3r0s_A266 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.9
4e6u_A265 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.9
1j2z_A270 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.9
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 99.9
4eqy_A283 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.9
2qia_A262 UDP-N-acetylglucosamine acyltransferase; LEFT-hand 99.9
3t57_A305 UDP-N-acetylglucosamine O-acyltransferase domain- 99.9
3nz2_A195 Hexapeptide-repeat containing-acetyltransferase; s 99.88
3r8y_A240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac 99.88
3hjj_A190 Maltose O-acetyltransferase; LEFT-handed beta-heli 99.87
1krr_A203 Galactoside O-acetyltransferase; LEFT-handed paral 99.86
3jqy_B252 NEUO, polysialic acid O-acetyltransferase; LEFT-ha 99.86
3ftt_A199 Putative acetyltransferase sacol2570; galactoside 99.86
2wlg_A215 Polysialic acid O-acetyltransferase; enzyme, LEFT- 99.85
2iu8_A374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 99.85
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 99.85
3srt_A188 Maltose O-acetyltransferase; structural genomics, 99.85
4e79_A357 UDP-3-O-acylglucosamine N-acyltransferase; lipopol 99.84
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 99.84
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 99.84
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 99.83
1ocx_A182 Maltose O-acetyltransferase; LEFT-handed parallel 99.83
3gos_A276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.82
4hur_A220 Virginiamycin A acetyltransferase; structural geno 99.82
1j2z_A270 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.82
3eg4_A304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.82
4eqy_A283 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.82
2p2o_A185 Maltose transacetylase; GK1921, GKA001001921.1, ge 99.82
3tk8_A316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.81
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 99.81
3pmo_A372 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; 99.81
2iu8_A374 LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-a 99.8
3hsq_A259 Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosam 99.8
2qia_A262 UDP-N-acetylglucosamine acyltransferase; LEFT-hand 99.8
1xat_A212 Xenobiotic acetyltransferase; chloramphenicol, LEF 99.8
4e6u_A265 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.79
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 99.79
3c8v_A496 Putative acetyltransferase; YP_390128.1, structura 99.79
3eev_A212 Chloramphenicol acetyltransferase; beta-helix, str 99.79
3fs8_A273 QDTC; acetyltransferase, natural product, deoxysug 99.78
3r0s_A266 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam 99.77
3eh0_A341 UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltr 99.76
3q1x_A313 Serine acetyltransferase; cysteine biosynthesis, L 99.76
4e8l_A219 Virginiamycin A acetyltransferase; structural geno 99.74
3mc4_A287 WW/RSP5/WWP domain:bacterial transferase hexapept 99.73
3t57_A305 UDP-N-acetylglucosamine O-acyltransferase domain- 99.72
3ixc_A191 Hexapeptide transferase family protein; niaid, ssg 99.72
1mr7_A209 Streptogramin A acetyltransferase; LEFT-handed par 99.72
2ggo_A401 401AA long hypothetical glucose-1-phosphate thymid 99.71
3vbi_A205 ANTD, galactoside O-acetyltransferase; anthrose, a 99.71
3r3r_A187 Ferripyochelin binding protein; structural genomic 99.7
3f1x_A310 Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 99.7
1ssq_A267 SAT, serine acetyltransferase; LEFT-handed paralle 99.7
1xhd_A173 Putative acetyltransferase/acyltransferase; struct 99.7
1t3d_A289 SAT, serine acetyltransferase; LEFT-handed-beta-he 99.7
3kwd_A213 Carbon dioxide concentrating mechanism protein; LE 99.7
3tv0_A194 Dynactin subunit 6; LEFT-handed beta-helix, ARP11, 99.69
3r1w_A189 Carbonic anhydrase; beta-helix, lyase; 1.73A {Unid 99.69
3fsy_A332 Tetrahydrodipicolinate N-succinyltransferase; beta 99.69
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 99.68
3r5d_A347 Tetrahydrodipicolinate N-succinyletransferase; 1.8 99.68
1qre_A247 Carbonic anhydrase; beta-helix, lyase; 1.46A {Meth 99.65
2v0h_A456 Bifunctional protein GLMU; cell WALL, magnesium, c 99.63
1v3w_A173 Ferripyochelin binding protein; beta-helix, carbon 99.63
3eg4_A304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.62
3jqy_B252 NEUO, polysialic acid O-acetyltransferase; LEFT-ha 99.59
2pig_A334 Putative transferase; SCR6, NESG, YDCK, structural 99.58
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 99.57
3gos_A276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.57
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 99.56
3mqg_A192 Lipopolysaccharides biosynthesis acetyltransferas; 99.55
3tk8_A316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- su 99.53
2wlg_A215 Polysialic acid O-acetyltransferase; enzyme, LEFT- 99.52
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 99.52
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 99.49
3fsy_A332 Tetrahydrodipicolinate N-succinyltransferase; beta 99.49
3st8_A501 Bifunctional protein GLMU; acetyltransferase, pyro 99.48
3q1x_A313 Serine acetyltransferase; cysteine biosynthesis, L 99.48
3r8y_A240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- ac 99.48
2rij_A387 Putative 2,3,4,5-tetrahydropyridine-2-carboxylate 99.48
3bfp_A194 Acetyltransferase; LEFT-handed beta helix, COA bin 99.47
3r5d_A347 Tetrahydrodipicolinate N-succinyletransferase; 1.8 99.45
3c8v_A496 Putative acetyltransferase; YP_390128.1, structura 99.43
3nz2_A195 Hexapeptide-repeat containing-acetyltransferase; s 99.38
3f1x_A310 Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 99.36
2pig_A334 Putative transferase; SCR6, NESG, YDCK, structural 99.36
3hjj_A190 Maltose O-acetyltransferase; LEFT-handed beta-heli 99.33
1yp2_A451 Glucose-1-phosphate adenylyltransferase small subu 99.31
3mc4_A287 WW/RSP5/WWP domain:bacterial transferase hexapept 99.28
3ftt_A199 Putative acetyltransferase sacol2570; galactoside 99.27
2rij_A387 Putative 2,3,4,5-tetrahydropyridine-2-carboxylate 99.26
1ssq_A267 SAT, serine acetyltransferase; LEFT-handed paralle 99.25
1krr_A203 Galactoside O-acetyltransferase; LEFT-handed paral 99.25
4hur_A220 Virginiamycin A acetyltransferase; structural geno 99.24
3eev_A212 Chloramphenicol acetyltransferase; beta-helix, str 99.22
1t3d_A289 SAT, serine acetyltransferase; LEFT-handed-beta-he 99.22
3srt_A188 Maltose O-acetyltransferase; structural genomics, 99.21
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 99.13
1ocx_A182 Maltose O-acetyltransferase; LEFT-handed parallel 99.13
4e8l_A219 Virginiamycin A acetyltransferase; structural geno 99.11
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-gluco 99.09
2p2o_A185 Maltose transacetylase; GK1921, GKA001001921.1, ge 99.08
1xat_A212 Xenobiotic acetyltransferase; chloramphenicol, LEF 98.85
1mr7_A209 Streptogramin A acetyltransferase; LEFT-handed par 98.77
>3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} Back     alignment and structure
Probab=99.96  E-value=1.5e-28  Score=207.25  Aligned_cols=173  Identities=33%  Similarity=0.516  Sum_probs=154.2

Q ss_pred             eecCCCCceeCCCcEEcCCcEEecceEECCCCEECCCCEEecCCCcEEECCCCEECCCCEEecCCCCCcccccceeeeec
Q 039842           66 IPLGQWVPKVAVDAYVAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNVQERCVLHAAWNSPYRFVGFVSLLID  145 (284)
Q Consensus        66 ~~~~~~~~~i~~~~~I~~~a~i~~~v~IG~~~~I~~~~~I~g~~~~v~IG~~~~I~~~~~I~~~~~~~~~~~g~~~~~~~  145 (284)
                      ..+....+.++++++|++++.|.+++.||++|.|++++.|.++...+.||++|.|+++++|....+....          
T Consensus        13 ~~~~~~~~~ig~~~~I~~~~~i~~~v~IG~~~~I~~~~~i~~~~~~i~IG~~~~I~~~~~I~~~~~~~~~----------   82 (189)
T 3r1w_A           13 RTYQGISPKLGERVFVDRSSVIIGDVELGDDCSVWPLAVIRGDMHHIRIGARTSVQDGSVLHITHASDYN----------   82 (189)
T ss_dssp             ECBTTBCCEECTTCEECTTCEEEEEEEECTTCEECTTCEEEEEEEEEEECTTCEECTTCEEECBCCSSSS----------
T ss_pred             eeccCcCCEECCCcEECCCCEEeeeeEECCCCEECCCCEEecCCCceEECCCCEECCCCEEecCCcccCC----------
Confidence            3455667889999999999999999999999999999999866556899999999999999765331111          


Q ss_pred             ccccCCCCCccccccCCcceEECCCCEECCCceeeccEECCCCEECCCcEEcCCCEECCCCEEcCCCeeCCCCeeCCCCE
Q 039842          146 LQMSCPRSNSLYIAWLPAETSIERFVTIGAYCSLRSCTIEPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPTGEL  225 (284)
Q Consensus       146 ~~~~~~~~~~~~~~~~~~~v~Ig~~v~Ig~~~~I~~v~Igd~v~IG~~s~I~~gv~Ig~~~~I~a~s~V~~~~~I~~~~v  225 (284)
                                    ....+++||++|+|+++|.|++++||++|+||++++|.++++||++|+|+++++|.++++||++++
T Consensus        83 --------------~~~~~~~Ig~~~~Ig~~~~i~~~~Ig~~~~Ig~~~~i~~~v~Ig~~~~Ig~~s~V~~g~~i~~~~v  148 (189)
T 3r1w_A           83 --------------PGGYPLIIGDDVTIGHQAMLHGCTIGNRVLIGMKSMIMDGAIVEDEVIVAAGATVSPGKVLESGFV  148 (189)
T ss_dssp             --------------TTCBCEEECSSEEECTTCEEESCEECSSEEECTTCEECTTCEECSSCEECTTCEECTTCEECTTEE
T ss_pred             --------------CCCCCeEECCCCEECCCCEEeCcEECCCcEECCCCEEcCCCEECCCCEEccCCEECCCCEeCCCCE
Confidence                          022369999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeccCceeeccCCHHHHhhhhhhHHHHHHHHHHHHhc
Q 039842          226 WAGNPARFVRTLTHEETLEIPKLAVAINDLSKSHFSE  262 (284)
Q Consensus       226 v~G~pa~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  262 (284)
                      ++|+||++++.+++++..++....+.|.++.+.|.++
T Consensus       149 v~G~pa~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~  185 (189)
T 3r1w_A          149 YMGTPAKKVRPITEKERSFFTYGAGNYVRLKDKHLAE  185 (189)
T ss_dssp             EETTTTEEEEECCHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             EECCccccccCCCHHHHHHHHHHHHHHHHHHHHHhhc
Confidence            9999999999999999999999999999999988654



>3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A Back     alignment and structure
>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Back     alignment and structure
>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Back     alignment and structure
>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Back     alignment and structure
>3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Back     alignment and structure
>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Back     alignment and structure
>4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Back     alignment and structure
>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* Back     alignment and structure
>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 Back     alignment and structure
>4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Back     alignment and structure
>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Back     alignment and structure
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Back     alignment and structure
>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* Back     alignment and structure
>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Back     alignment and structure
>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* Back     alignment and structure
>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Back     alignment and structure
>3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} Back     alignment and structure
>3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A Back     alignment and structure
>2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* Back     alignment and structure
>4e79_A UDP-3-O-acylglucosamine N-acyltransferase; lipopolysaccaride synthesis; 2.66A {Acinetobacter baumannii} PDB: 4e75_A Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Back     alignment and structure
>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 Back     alignment and structure
>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A Back     alignment and structure
>4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A Back     alignment and structure
>1j2z_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; UDP-N-acetylglucosamine acyltransferase, LPXA, LEFT-handed B structure; HET: SOG TLA; 2.10A {Helicobacter pylori} SCOP: b.81.1.1 Back     alignment and structure
>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} Back     alignment and structure
>4eqy_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; ssgcid, beta helix, structural genomics, seattle structural center for infectious disease, transferase; 1.80A {Burkholderia thailandensis} Back     alignment and structure
>2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A Back     alignment and structure
>3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Back     alignment and structure
>3pmo_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltr; lipid A biosynthesis pathway, transferase; 1.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2iu8_A LPXD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; UDP-3- O-acyl-glucosamine N-acyltransferase, lipid A biosynthesis; HET: PLM UD1; 2.2A {Chlamydia trachomatis} PDB: 2iu9_A* 2iua_A* Back     alignment and structure
>3hsq_A Acyl-[acyl-carrier-protein]--UDP-N- acetylglucosamine O-acyltransferase; L.interrogans LPXA, LPXA, LPXA acyltransferase; 2.10A {Leptospira interrogans} SCOP: b.81.1.0 PDB: 3i3a_A* 3i3x_A* Back     alignment and structure
>2qia_A UDP-N-acetylglucosamine acyltransferase; LEFT-handed parallel beta helix; HET: U20; 1.74A {Escherichia coli K12} SCOP: b.81.1.1 PDB: 1lxa_A 2jf3_A* 2aq9_A* 2qiv_X* 2jf2_A Back     alignment and structure
>1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* Back     alignment and structure
>4e6u_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; lipopolysaccaride synthesis; 1.41A {Acinetobacter baumannii} PDB: 4e6t_A* Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 Back     alignment and structure
>3fs8_A QDTC; acetyltransferase, natural product, deoxysugar; HET: ACO; 1.70A {Thermoanaerobacteriumthermosaccharolyticum} PDB: 3fsb_A* 3fsc_A* Back     alignment and structure
>3r0s_A Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam acyltransferase; structural genomics; 2.30A {Campylobacter jejuni subsp} SCOP: b.81.1.0 Back     alignment and structure
>3eh0_A UDP-3-O-[3-hydroxymyristoyl] glucosamine N- acyltransferase; LPXD, LEFT-handed parallel beta helix, acyl carrier protein, antibiotic resistance; 2.60A {Escherichia coli} Back     alignment and structure
>3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A Back     alignment and structure
>4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} Back     alignment and structure
>3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} Back     alignment and structure
>3t57_A UDP-N-acetylglucosamine O-acyltransferase domain- protein; LEFT-handed parallel beta helix, lipid A biosynthesis, lipid synthesis; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3ixc_A Hexapeptide transferase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, GRAM-negative bacteria; 1.61A {Anaplasma phagocytophilum} Back     alignment and structure
>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Back     alignment and structure
>2ggo_A 401AA long hypothetical glucose-1-phosphate thymidylyltransferase; beta barrel; 1.80A {Sulfolobus tokodaii} PDB: 2ggq_A* Back     alignment and structure
>3vbi_A ANTD, galactoside O-acetyltransferase; anthrose, acylated sugar, LEFT-handed beta helix, sugar N-AC transferase; HET: COA 0FX; 1.80A {Bacillus cereus} PDB: 3vbj_A* 3vbm_A* 3vbk_A* 3vbp_A* 3vbl_A* 3vbn_A* Back     alignment and structure
>3r3r_A Ferripyochelin binding protein; structural genomics, csgid, center for structural genomics O infectious diseases, all beta protein; 1.20A {Salmonella enterica subsp} SCOP: b.81.1.0 PDB: 3tio_A 3tis_A Back     alignment and structure
>3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* Back     alignment and structure
>1xhd_A Putative acetyltransferase/acyltransferase; structural genomics, protein structure initiative, medwest C structural genomics, MCSG; 1.90A {Bacillus cereus} SCOP: b.81.1.5 PDB: 3vnp_A 2eg0_A Back     alignment and structure
>1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 Back     alignment and structure
>3kwd_A Carbon dioxide concentrating mechanism protein; LEFT-handed beta helix, gamma carbonic anhydrase, disulfide dependent activity; 1.10A {Thermosynechococcus elongatus} PDB: 3kwe_A 3kwc_A Back     alignment and structure
>3tv0_A Dynactin subunit 6; LEFT-handed beta-helix, ARP11, cytosol, structural; 2.15A {Homo sapiens} Back     alignment and structure
>3r1w_A Carbonic anhydrase; beta-helix, lyase; 1.73A {Unidentified} Back     alignment and structure
>3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Back     alignment and structure
>3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A Back     alignment and structure
>1qre_A Carbonic anhydrase; beta-helix, lyase; 1.46A {Methanosarcina thermophila} SCOP: b.81.1.5 PDB: 1qq0_A 1qrf_A 1qrg_A 1qrm_A 1qrl_A 1thj_A 3otm_A 3ow5_A 3ou9_A 3otz_A 3oup_A Back     alignment and structure
>2v0h_A Bifunctional protein GLMU; cell WALL, magnesium, cell shape, transferase, peptidoglycan synthesis, associative mechanism; 1.79A {Haemophilus influenzae} PDB: 2v0i_A* 2v0j_A* 2v0k_A* 2v0l_A* 2vd4_A* 2w0v_A* 2w0w_A* 3twd_A* Back     alignment and structure
>1v3w_A Ferripyochelin binding protein; beta-helix, carbonic anhydrase, structural genomics, riken S genomics/proteomics initiative, RSGI, lyase; 1.50A {Pyrococcus horikoshii} SCOP: b.81.1.5 PDB: 1v67_A 2fko_A Back     alignment and structure
>3eg4_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid, beta helix, acyltransferase, amino-acid biosynthesis, cytoplasm; 1.87A {Brucella suis} Back     alignment and structure
>3jqy_B NEUO, polysialic acid O-acetyltransferase; LEFT-handed beta-helix polysia; HET: PEG; 1.70A {Escherichia coli} Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Back     alignment and structure
>3gos_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransfera acyltransferase; 1.80A {Yersinia pestis} SCOP: b.81.1.2 PDB: 1kgq_A* 1kgt_A* 2tdt_A* 3tdt_A* 3bxy_A 1tdt_A Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Back     alignment and structure
>3mqg_A Lipopolysaccharides biosynthesis acetyltransferas; beta helix, acetyl transferase, transferase; HET: ACO U5P UDP PE4; 1.43A {Bordetella petrii} PDB: 3mqh_A* Back     alignment and structure
>3tk8_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase; ssgcid; 1.80A {Burkholderia pseudomallei} Back     alignment and structure
>2wlg_A Polysialic acid O-acetyltransferase; enzyme, LEFT-handed beta HEL; HET: SOP; 1.90A {Neisseria meningitidis serogroup Y} PDB: 2wld_A 2wle_A* 2wlf_A* 2wlc_A* Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Back     alignment and structure
>3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium tuberculosis} PDB: 3fsx_A* Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Back     alignment and structure
>3q1x_A Serine acetyltransferase; cysteine biosynthesis, LEFT handed helix, OASS; 1.59A {Entamoeba histolytica} PDB: 3p47_A 3p1b_A Back     alignment and structure
>3r8y_A 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- acetyltransferase; structural genomics, csgid; 1.70A {Bacillus anthracis} PDB: 3cj8_A* Back     alignment and structure
>2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} Back     alignment and structure
>3bfp_A Acetyltransferase; LEFT-handed beta helix, COA binding protein, N-glycan biosynthesis, bacillosamine, structural genomics, MKBSGI; HET: FLC; 1.75A {Campylobacter jejuni} SCOP: b.81.1.8 PDB: 2vhe_A* 3bsw_A* 3bss_A* 3bsy_A* 2npo_A Back     alignment and structure
>3r5d_A Tetrahydrodipicolinate N-succinyletransferase; 1.80A {Pseudomonas aeruginosa} PDB: 3r5b_A* 3r5c_A* 3r5a_A Back     alignment and structure
>3c8v_A Putative acetyltransferase; YP_390128.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.28A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3nz2_A Hexapeptide-repeat containing-acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: ACO; 2.35A {Vibrio cholerae o1 biovar eltor} SCOP: b.81.1.0 PDB: 3ect_A* Back     alignment and structure
>3f1x_A Serine acetyltransferase; NESG X-RAY BVR62 A6KZB9 A6KZB9_BACV8, structural genomics, P protein structure initiative; 2.00A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2pig_A Putative transferase; SCR6, NESG, YDCK, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.38A {Salmonella paratyphi} PDB: 2f9c_A Back     alignment and structure
>3hjj_A Maltose O-acetyltransferase; LEFT-handed beta-helix, acyltransferase, struct genomics; 2.15A {Bacillus anthracis} SCOP: b.81.1.0 PDB: 3igj_A* Back     alignment and structure
>1yp2_A Glucose-1-phosphate adenylyltransferase small subunit; ADP-glucose synthase, ADP-glucose pyrophosphorylase, agpase B; HET: PMB; 2.11A {Solanum tuberosum} SCOP: b.81.1.4 c.68.1.6 PDB: 1yp3_A* 1yp4_A* Back     alignment and structure
>3mc4_A WW/RSP5/WWP domain:bacterial transferase hexapept repeat:serine O-acetyltransferase...; ssgcid, structural genomics; 1.95A {Brucella melitensis biovar abortus} Back     alignment and structure
>3ftt_A Putative acetyltransferase sacol2570; galactoside O-acetyltransferase, enzyme, structural genomics, acyltransferase; 1.60A {Staphylococcus aureus subsp} PDB: 3v4e_A* 4dcl_A 4egg_A Back     alignment and structure
>2rij_A Putative 2,3,4,5-tetrahydropyridine-2-carboxylate succinyltransferase; structural genomics, joint center for structural genomics; HET: MSE CIT; 1.90A {Campylobacter jejuni} Back     alignment and structure
>1ssq_A SAT, serine acetyltransferase; LEFT-handed parallel beta helix; 1.85A {Haemophilus influenzae} SCOP: b.81.1.6 PDB: 1sst_A* 1s80_A 1ssm_A 3gvd_A* Back     alignment and structure
>1krr_A Galactoside O-acetyltransferase; LEFT-handed parallel beta helix; HET: ACO; 2.50A {Escherichia coli} SCOP: b.81.1.3 PDB: 1kqa_A* 1kru_A* 1krv_A* Back     alignment and structure
>4hur_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); HET: ACO; 2.15A {Staphylococcus aureus} PDB: 4hus_A* 4e8l_A Back     alignment and structure
>3eev_A Chloramphenicol acetyltransferase; beta-helix, structural genomics, center for STR genomics of infectious diseases, csgid; 2.61A {Vibrio cholerae o1 biovar el tor} SCOP: b.81.1.3 Back     alignment and structure
>1t3d_A SAT, serine acetyltransferase; LEFT-handed-beta-helix, dimer of trimers; 2.20A {Escherichia coli} SCOP: b.81.1.6 Back     alignment and structure
>3srt_A Maltose O-acetyltransferase; structural genomics, the center structural genomics of infectious diseases, csgid; 2.50A {Clostridium difficile} PDB: 4ebh_A* Back     alignment and structure
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Back     alignment and structure
>1ocx_A Maltose O-acetyltransferase; LEFT-handed parallel beta-helix; 2.15A {Escherichia coli} SCOP: b.81.1.3 Back     alignment and structure
>4e8l_A Virginiamycin A acetyltransferase; structural genomics, antibiotic resistance, center for struc genomics of infectious diseases (csgid); 2.70A {Staphylococcus aureus} Back     alignment and structure
>3brk_X Glucose-1-phosphate adenylyltransferase; ADP-glucose pyrophosphorylase, allostery, kinetics, structure-function relationships; 2.10A {Agrobacterium tumefaciens} Back     alignment and structure
>2p2o_A Maltose transacetylase; GK1921, GKA001001921.1, geobacillus kaustophilus structural genomics, PSI; 1.74A {Geobacillus kaustophilus} PDB: 2ic7_A Back     alignment and structure
>1xat_A Xenobiotic acetyltransferase; chloramphenicol, LEFT-handed helix; 3.20A {Pseudomonas aeruginosa} SCOP: b.81.1.3 PDB: 2xat_A* Back     alignment and structure
>1mr7_A Streptogramin A acetyltransferase; LEFT-handed parallel beta-helix domain; 1.80A {Enterococcus faecium} SCOP: b.81.1.3 PDB: 1khr_A* 1kk5_A 1kk4_A 1kk6_A 1mr9_A* 1mrl_A* 3dho_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 284
d1v3wa_173 b.81.1.5 (A:) Ferripyochelin binding protein {Arch 6e-18
d1qrea_210 b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon M 3e-17
d1xhda_172 b.81.1.5 (A:) Putative acetyltransferase/acyltrans 6e-17
d1xata_208 b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudo 6e-09
d1g97a1196 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phospha 5e-08
d1ocxa_182 b.81.1.3 (A:) Maltose O-acetyltransferase {Escheri 1e-06
d1mr7a_203 b.81.1.3 (A:) Xenobiotic acetyltransferase {Entero 1e-06
d1krra_200 b.81.1.3 (A:) Galactoside acetyltransferase {Esche 2e-06
d1ssqa_241 b.81.1.6 (A:) Serine acetyltransferase {Haemophilu 7e-06
d3bswa1193 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylo 8e-05
d2jf2a1262 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltra 0.003
d1fxja178 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phospha 0.003
>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 173 Back     information, alignment and structure

class: All beta proteins
fold: Single-stranded left-handed beta-helix
superfamily: Trimeric LpxA-like enzymes
family: gamma-carbonic anhydrase-like
domain: Ferripyochelin binding protein
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]
 Score = 77.3 bits (189), Expect = 6e-18
 Identities = 57/195 (29%), Positives = 87/195 (44%), Gaps = 31/195 (15%)

Query: 65  IIPLGQWVPKVAVDAYVAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNVQERC 124
           I  +    P++   A+V  N V+ G V + +  SVWP +VLRGD+ +I VG  SNVQ+  
Sbjct: 3   IYEINGKKPRIHPSAFVDENAVVIGDVVLEEKTSVWPSAVLRGDIEQIYVGKYSNVQDNV 62

Query: 125 VLHAAWNSPYRFVGFVSLLIDLQMSCPRSNSLYIAWLPAETSIERFVTIGAYCSLRSCTI 184
            +H +   P                                    +VTIG    +    +
Sbjct: 63  SIHTSHGYPTEI-------------------------------GEYVTIGHNAMVHGAKV 91

Query: 185 EPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPTGELWAGNPARFVRTLTHEETLE 244
               IIG  S++++G+ +  H I+ AG+V+PP + IP   L  G P + VR LT EE   
Sbjct: 92  GNYVIIGISSVILDGAKIGDHVIIGAGAVVPPNKEIPDYSLVLGVPGKVVRQLTEEEIEW 151

Query: 245 IPKLAVAINDLSKSH 259
             K A    +L++ H
Sbjct: 152 TKKNAEIYVELAEKH 166


>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Length = 210 Back     information, alignment and structure
>d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} Length = 172 Back     information, alignment and structure
>d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} Length = 208 Back     information, alignment and structure
>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 196 Back     information, alignment and structure
>d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} Length = 182 Back     information, alignment and structure
>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Length = 203 Back     information, alignment and structure
>d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} Length = 241 Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Length = 193 Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Length = 262 Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 78 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query284
d1xhda_172 Putative acetyltransferase/acyltransferase BC4754 99.97
d1v3wa_173 Ferripyochelin binding protein {Archaeon Pyrococcu 99.96
d2jf2a1262 UDP N-acetylglucosamine acyltransferase {Escherich 99.93
d1qrea_210 gamma-carbonic anhydrase {Archaeon Methanosarcina 99.92
d1krra_200 Galactoside acetyltransferase {Escherichia coli [T 99.91
d1j2za_259 UDP N-acetylglucosamine acyltransferase {Helicobac 99.91
d1ocxa_182 Maltose O-acetyltransferase {Escherichia coli [Tax 99.87
d1g97a1196 N-acetylglucosamine 1-phosphate uridyltransferase 99.85
d3bswa1193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 99.84
d1mr7a_203 Xenobiotic acetyltransferase {Enterococcus faecium 99.84
d1xata_208 Xenobiotic acetyltransferase {Pseudomonas aerugino 99.83
d2oi6a1201 N-acetylglucosamine 1-phosphate uridyltransferase 99.75
d1j2za_259 UDP N-acetylglucosamine acyltransferase {Helicobac 99.75
d1ssqa_241 Serine acetyltransferase {Haemophilus influenzae [ 99.71
d1xhda_172 Putative acetyltransferase/acyltransferase BC4754 99.68
d1qrea_210 gamma-carbonic anhydrase {Archaeon Methanosarcina 99.66
d2jf2a1262 UDP N-acetylglucosamine acyltransferase {Escherich 99.61
d3tdta_274 Tetrahydrodipicolinate-N-succinlytransferase, THDP 99.59
d1g97a1196 N-acetylglucosamine 1-phosphate uridyltransferase 99.53
d1v3wa_173 Ferripyochelin binding protein {Archaeon Pyrococcu 99.5
d2oi6a1201 N-acetylglucosamine 1-phosphate uridyltransferase 99.49
d1krra_200 Galactoside acetyltransferase {Escherichia coli [T 99.45
d1fxja178 N-acetylglucosamine 1-phosphate uridyltransferase 99.44
d3bswa1193 Acetyltransferase PglD {Campylobacter jejuni [TaxI 99.44
d1fxja178 N-acetylglucosamine 1-phosphate uridyltransferase 99.41
d1yp2a1135 Glucose-1-phosphate adenylyltransferase small subu 99.38
d1ocxa_182 Maltose O-acetyltransferase {Escherichia coli [Tax 99.26
d3tdta_274 Tetrahydrodipicolinate-N-succinlytransferase, THDP 99.26
d1yp2a1135 Glucose-1-phosphate adenylyltransferase small subu 99.23
d1mr7a_203 Xenobiotic acetyltransferase {Enterococcus faecium 99.2
d1ssqa_241 Serine acetyltransferase {Haemophilus influenzae [ 99.17
d1xata_208 Xenobiotic acetyltransferase {Pseudomonas aerugino 99.1
d2f9ca1320 Hypothetical protein YdcK {Salmonella enterica [Ta 99.03
d2f9ca1320 Hypothetical protein YdcK {Salmonella enterica [Ta 98.8
>d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
class: All beta proteins
fold: Single-stranded left-handed beta-helix
superfamily: Trimeric LpxA-like enzymes
family: gamma-carbonic anhydrase-like
domain: Putative acetyltransferase/acyltransferase BC4754
species: Bacillus cereus [TaxId: 1396]
Probab=99.97  E-value=2.7e-29  Score=207.20  Aligned_cols=166  Identities=31%  Similarity=0.555  Sum_probs=150.9

Q ss_pred             ceeeecCCCCceeCCCcEEcCCcEEecceEECCCCEECCCCEEecCCCcEEECCCCEECCCCEEecCCCCCcccccceee
Q 039842           63 RQIIPLGQWVPKVAVDAYVAPNVVLAGQVTVCDGASVWPGSVLRGDLNKITVGFCSNVQERCVLHAAWNSPYRFVGFVSL  142 (284)
Q Consensus        63 ~~~~~~~~~~~~i~~~~~I~~~a~i~~~v~IG~~~~I~~~~~I~g~~~~v~IG~~~~I~~~~~I~~~~~~~~~~~g~~~~  142 (284)
                      .+++++....+.|+++++|+|+++|.+++.||++|.|+++|+|.++...+.||+++.+++++.++.+..           
T Consensus         3 a~i~~~~~~~~~Ig~~~~I~~~a~I~~~v~IG~~~~Ig~~~~I~~~~~~i~IG~~~~i~~~~~~~~~~~-----------   71 (172)
T d1xhda_           3 AMIYPYKEKKPKIASSAFIADYVTITGDVYVGEESSIWFNTVIRGDVSPTIIGDRVNVQDQCTLHQSPQ-----------   71 (172)
T ss_dssp             CEEECBTTBCCEECTTCEECTTCEEEEEEEECTTCEECTTCEEEEEEEEEEECTTCEECTTCEEECCTT-----------
T ss_pred             cEEEecCCcCCEECCCcEECCCCEEeCCEEECCCcEecCCcccccccccccccceeeeeeeceeccCCc-----------
Confidence            345566777789999999999999999999999999999999986666789999999999999986533           


Q ss_pred             eecccccCCCCCccccccCCcceEECCCCEECCCceeeccEECCCCEECCCcEEcCCCEECCCCEEcCCCeeCCCCeeCC
Q 039842          143 LIDLQMSCPRSNSLYIAWLPAETSIERFVTIGAYCSLRSCTIEPECIIGQHSILMEGSMVETHAILEAGSVLPPGRRIPT  222 (284)
Q Consensus       143 ~~~~~~~~~~~~~~~~~~~~~~v~Ig~~v~Ig~~~~I~~v~Igd~v~IG~~s~I~~gv~Ig~~~~I~a~s~V~~~~~I~~  222 (284)
                                          .+++||+++.++.++.+++++|+++|+||.+++|.++++||++|+|+++|+|.++++||+
T Consensus        72 --------------------~~~~ig~~~~~~~~~~~~~~~i~~~~~ig~~~~i~~gv~IG~~~~IgagsvV~~~~~i~~  131 (172)
T d1xhda_          72 --------------------YPLILEDDVTVGHQVILHSCHIKKDALIGMGSIILDGAEIGEGAFIGAGSLVSQGKKIPP  131 (172)
T ss_dssp             --------------------CCEEECTTCEECTTCEEESCEECTTCEECTTCEECTTCEECTTCEECTTCEECTTCEECT
T ss_pred             --------------------CCeeeeeeeeeeeeecccccccccceEEecccEeeCCcEEcCcccccceEEEeeCeEECC
Confidence                                358999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCEEeccCceeeccCCHHHHhhhhhhHHHHHHHHHHH
Q 039842          223 GELWAGNPARFVRTLTHEETLEIPKLAVAINDLSKSH  259 (284)
Q Consensus       223 ~~vv~G~pa~~~~~~~~~~~~~~~~~~~~~~~~~~~~  259 (284)
                      +++++|+||+++++++.++..++.+..+.|.++.+.|
T Consensus       132 ~~v~~G~Pak~i~~~~~~~~~~~~~~~~~y~~~~k~y  168 (172)
T d1xhda_         132 NTLAFGRPAKVIRELTAEDRKDMERIRTQYVEKGQYY  168 (172)
T ss_dssp             TEEEEETTEEEEEECCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CeEEEecCcEEECCCCHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999888888888777776654



>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Back     information, alignment and structure
>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Back     information, alignment and structure
>d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Back     information, alignment and structure
>d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j2za_ b.81.1.1 (A:) UDP N-acetylglucosamine acyltransferase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xhda_ b.81.1.5 (A:) Putative acetyltransferase/acyltransferase BC4754 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1qrea_ b.81.1.5 (A:) gamma-carbonic anhydrase {Archaeon Methanosarcina thermophila [TaxId: 2210]} Back     information, alignment and structure
>d2jf2a1 b.81.1.1 (A:1-262) UDP N-acetylglucosamine acyltransferase {Escherichia coli, gene lpxA [TaxId: 562]} Back     information, alignment and structure
>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Back     information, alignment and structure
>d1g97a1 b.81.1.4 (A:252-447) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1v3wa_ b.81.1.5 (A:) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2oi6a1 b.81.1.4 (A:252-452) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1krra_ b.81.1.3 (A:) Galactoside acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bswa1 b.81.1.8 (A:3-195) Acetyltransferase PglD {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1fxja1 b.81.1.4 (A:252-329) N-acetylglucosamine 1-phosphate uridyltransferase GlmU, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1ocxa_ b.81.1.3 (A:) Maltose O-acetyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3tdta_ b.81.1.2 (A:) Tetrahydrodipicolinate-N-succinlytransferase, THDP-succinlytransferase, DapD {Mycobacterium bovis [TaxId: 1765]} Back     information, alignment and structure
>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1mr7a_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Enterococcus faecium, VAT(D) [TaxId: 1352]} Back     information, alignment and structure
>d1ssqa_ b.81.1.6 (A:) Serine acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xata_ b.81.1.3 (A:) Xenobiotic acetyltransferase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure