Citrus Sinensis ID: 039863

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560---
MSSFSGSDNQNAETRRERLRSVREKNIQLMDNLYEAAVEGHVGKFEEHKAVLHQILTPNENTILHIHITALPNKTMKPNNKANSLWRMISTFKKQSSSDDREVIRGENFVRVILEMCPILLLKANAKGETLLHIAARHGHYDIVKVLIAECKKPHQNNPEEGVAAARLMLGTTNEAKDTALHEAVRYNQVDVVKMLTKEDPNLSYDANEAGETPLYLAAERGYKDVMEDILSTCESPVDHGPMGRTALHAAAFREYTLQTYYYFFRKDREIIKVLLRSSKGTQTTKPDQQGWLPLHLAAHLGNYYVVKELLKADISAAYKPDNEGKIPLHLAAGKGRAYTMQELIRSCPSSCELVDDRGWNVFHFAAHSGSRRTVEFLLENPSLGNLMNEKNYDGNTPLLEHAVSGSFIKSFVCHPKVDRLAFNHQNNSAEDIIRSKKVLIWENEESFLGCLARLNPIRCQRHIVNGNGERKEQGSNTSTEDKKSNDRKEKSSSRYEELEQSVNESKESHLVVAALIATVTFTAGITVPGGYINGIDPDQGAAVLAKRSAFQAFVVKSSHPSR
cccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHccHHHHHHHHHHHHHHcccccccccHHHHHccccccccccccccccHHHHHHHHHccccHHHHHHHcHHHHHHHHHHccHHHHccccccccHHHHHHHHccHHHHHHHHHcccccccccccHHHHHHHHHHcccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHccccccHHHHHccccHHHHHHHHHcccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHccccccccccccccccccHHHHHHHcccHHHHHHHcccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEccccccc
cHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHHcccHHHHHHHHHcccccccEccccccHHHHHHHcccHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccHHcccHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccccHHHHHHHcccHHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccHHHHHcHHHHHHHHHHHccccccHcccccccHHHHHHHcccHHHHHHHHHccccHHHEEEEcccccc
mssfsgsdnqnAETRRERLRSVREKNIQLMDNLYEAAVEGHVGKFEEHKAVLHQILTPNENTILHIHITalpnktmkpnnkaNSLWRMISTFkkqsssddrevirgENFVRVILEMCPILLLKANAKGETLLHIAARHGHYDIVKVLIAECkkphqnnpeEGVAAARLMLGTTNEAKDTALHEAVRYNQVDVVKMLtkedpnlsydaneagetplYLAAERGYKDVMEDILStcespvdhgpmgrtALHAAAFREYTLQTYYYFFRKDREIIKVLLRsskgtqttkpdqqgwlplhlAAHLGNYYVVKELLKADIsaaykpdnegkiplhlaagkgRAYTMQELIRscpsscelvddrgwNVFHFaahsgsrrTVEFLlenpslgnlmneknydgntpllehavsgsfiksfvchpkvdrlafnhqnnsaeDIIRSKKVLIWENEESFLGCLarlnpircqrhivngngerkeqgsntstedkksndrkekssSRYEELEQSVNESKESHLVVAALIATVTftagitvpggyingidpdqGAAVLAKRSAFQAFVVKSSHPSR
mssfsgsdnqnaetRRERLRSVREKNIQLMDNLYEAAVEGHVGKFEEHKAVLHQILTPNENTILHIHItalpnktmkpnNKANSLWRMISTfkkqsssddrevIRGENFVRVILEMCPILLLKANAKGETLLHIAARHGHYDIVKVLIAECKKPHQNNPEEGVAAARLMLGTTNEAKDTALHEAVRYNQVDVVKMLTKedpnlsydaneagETPLYLAAERGYKDVMEDILSTCESPVDHGPMGRTALHAAAFREYTLQTYYYFFRKDREIIKVLLrsskgtqttkpdqqgwLPLHLAAHLGNYYVVKELLKADISAAYKPDNEGKIPLHLAAGKGRAYTMQELIRSCPSSCELVDDRGWNVFHFaahsgsrrtVEFLLENPSLGNLMNEKNYDGNTPLLEHAVSGSFIKSFVCHPKVDRLafnhqnnsaediiRSKKVLIWENEESFLGCLARLNPIRCQRHIvngngerkeqgsntstedkksndrkeksssryEELEQSVNESKESHLVVAALIATVTFTAGITVPGGYINGIDPDQGAAVLAKRSAFQafvvksshpsr
MSSFSGSDNQNAETRRERLRSVREKNIQLMDNLYEAAVEGHVGKFEEHKAVLHQILTPNENTILHIHITALPNKTMKPNNKANSLWRMISTFKKQSSSDDREVIRGENFVRVILEMCPILLLKANAKGETLLHIAARHGHYDIVKVLIAECKKPHQNNPEEGVAAARLMLGTTNEAKDTALHEAVRYNQVDVVKMLTKEDPNLSYDANEAGETPLYLAAERGYKDVMEDILSTCESPVDHGPMGRTALHAAAFREYTLQTYYYFFRKDREIIKVLLRSSKGTQTTKPDQQGWLPLHLAAHLGNYYVVKELLKADISAAYKPDNEGKIPLHLAAGKGRAYTMQELIRSCPSSCELVDDRGWNVFHFAAHSGSRRTVEFLLENPSLGNLMNEKNYDGNTPLLEHAVSGSFIKSFVCHPKVDRLAFNHQNNSAEDIIRSKKVLIWENEESFLGCLARLNPIRCQRHIVNGNGERKEQGSNTSTEDKKSNDRKEKSSSRYEELEQSVNESKESHLVVAALIATVTFTAGITVPGGYINGIDPDQGAAVLAKRSAFQAFVVKSSHPSR
**************************IQLMDNLYEAAVEGHVGKFEEHKAVLHQILTPNENTILHIHITALPN***********LWRMIS************VIRGENFVRVILEMCPILLLKANAKGETLLHIAARHGHYDIVKVLIAECK*************ARLMLGTTNEAKDTALHEAVRYNQVDVVKMLTKE***LSYDA**AGETPLYLAAERGYKDVMEDILSTCESPVDHGPMGRTALHAAAFREYTLQTYYYFFRKDREIIKVLLRS***********QGWLPLHLAAHLGNYYVVKELLKADISAAYKPDNEGKIPLHLAAGKGRAYTMQELIRSCPSSCELVDDRGWNVFHFAAHSGSRRTVEFLLENPSLGNLMNEKNYDGNTPLLEHAVSGSFIKSFVCHPKVDRLAFNHQNNSAEDIIRSKKVLIWENEESFLGCLARLNPIRCQRHIVN*******************************************HLVVAALIATVTFTAGITVPGGYINGIDPDQGAAVLAKRSAFQAFVV*******
*SSFSGSDNQNAETRRERLRSVREKNIQLMDNLYEAAVEGHVGKFEEHKAVLHQILTPNENTILHIHITALPNKTMKPNNKANSLWRMISTFKKQSSSDDREVIRGENFVRVILEMCPILLLKANAKGETLLHIAARHGHYDIVKVLIAECKKPHQNNPEEGVAAARLMLGTTNEAKDTALHEAVRYNQVDVVKMLTKEDPNLSYDANEAGETPLYLAAERGYKDVMEDILSTCESPVDHGPMGRTALHAAAFREYTLQTYYYFFRKDREIIKVLLRSSKGTQTTKPDQQGWLPLHLAAHLGNYYVVKELLKADISAAYKPDNEGKIPLHLAAGKGRAYTMQELIRSCPSSCELVDDRGWNVFHFAAHSGSRRTVEFLLENPSLGNLMNEKNYDGNTPLLEHAVSGSFIKSFVCHPKVDRLAFNHQNNSAEDIIRSKKVLIWENEESFLGCLARLNPIRCQRH**************************************SVNESKESHLVVAALIATVTFTAGITVPGGYINGIDPDQGAAVLAKRSAFQAFVVKSSHP**
*******************RSVREKNIQLMDNLYEAAVEGHVGKFEEHKAVLHQILTPNENTILHIHITALPNKTMKPNNKANSLWRMISTF*********EVIRGENFVRVILEMCPILLLKANAKGETLLHIAARHGHYDIVKVLIAECKKPHQNNPEEGVAAARLMLGTTNEAKDTALHEAVRYNQVDVVKMLTKEDPNLSYDANEAGETPLYLAAERGYKDVMEDILSTCESPVDHGPMGRTALHAAAFREYTLQTYYYFFRKDREIIKVLLRSSKGTQTTKPDQQGWLPLHLAAHLGNYYVVKELLKADISAAYKPDNEGKIPLHLAAGKGRAYTMQELIRSCPSSCELVDDRGWNVFHFAAHSGSRRTVEFLLENPSLGNLMNEKNYDGNTPLLEHAVSGSFIKSFVCHPKVDRLAFNHQNNSAEDIIRSKKVLIWENEESFLGCLARLNPIRCQRHIVNGNG**************************************ESHLVVAALIATVTFTAGITVPGGYINGIDPDQGAAVLAKRSAFQAF*********
MSSFSGSDNQNAETRRERLRSVREKNIQLMDNLYEAAVEGHVGKFEEHKAVLHQILTPNENTILHIHITALPNKTMKPNNKANSLWRMISTFKKQSSSDDREVIRGENFVRVILEMCPILLLKANAKGETLLHIAARHGHYDIVKVLIAECKKPHQNNPEEGVAAARLMLGTTNEAKDTALHEAVRYNQVDVVKMLTKEDPNLSYDANEAGETPLYLAAERGYKDVMEDILSTCESPVDHGPMGRTALHAAAFREYTLQTYYYFFRKDREIIKVLLRSSKGTQTTKPDQQGWLPLHLAAHLGNYYVVKELLKADISAAYKPDNEGKIPLHLAAGKGRAYTMQELIRSCPSSCELVDDRGWNVFHFAAHSGSRRTVEFLLENPSLGNLMNEKNYDGNTPLLEHAVSGSFIKSFVCHPKVDRLAFNHQNNSAEDIIRSKKVLIWENEESFLGCLARLNPIRCQRHIVNGNGERKEQGSNTSTEDKKSNDRKEKSSSRYEELEQSVNESKESHLVVAALIATVTFTAGITVPGGYINGIDPDQGAAVLAKRSAFQAFVVKSS****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSFSGSDNQNAETRRERLRSVREKNIQLMDNLYEAAVEGHVGKFEEHKAVLHQILTPNENTILHIHITALPNKTMKPNNKANSLWRMISTFKKQSSSDDREVIRGENFVRVILEMCPILLLKANAKGETLLHIAARHGHYDIVKVLIAECKKPHQNNPEEGVAAARLMLGTTNEAKDTALHEAVRYNQVDVVKMLTKEDPNLSYDANEAGETPLYLAAERGYKDVMEDILSTCESPVDHGPMGRTALHAAAFREYTLQTYYYFFRKDREIIKVLLRSSKGTQTTKPDQQGWLPLHLAAHLGNYYVVKELLKADISAAYKPDNEGKIPLHLAAGKGRAYTMQELIRSCPSSCELVDDRGWNVFHFAAHSGSRRTVEFLLENPSLGNLMNEKNYDGNTPLLEHAVSGSFIKSFVCHPKVDRLAFNHQNNSAEDIIRSKKVLIWENEESFLGCLARLNPIRCQRHIVNGNGERKEQGSNTSTEDKKSNDRxxxxxxxxxxxxxxxxxxxxxHLVVAALIATVTFTAGITVPGGYINGIDPDQGAAVLAKRSAFQAFVVKSSHPSR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query563 2.2.26 [Sep-21-2011]
Q6AWW5524 Ankyrin repeat-containing no no 0.406 0.437 0.288 5e-20
Q9C7A2 590 Ankyrin repeat-containing no no 0.568 0.542 0.272 1e-17
P57078832 Receptor-interacting seri yes no 0.428 0.289 0.302 2e-17
Q9ERK0786 Receptor-interacting seri yes no 0.429 0.307 0.298 2e-16
Q8BZ25745 Ankyrin repeat and protei no no 0.408 0.308 0.302 3e-16
Q505D1 1053 Serine/threonine-protein no no 0.449 0.240 0.300 5e-16
O15084 1053 Serine/threonine-protein no no 0.449 0.240 0.300 2e-15
P53355 1430 Death-associated protein no no 0.312 0.123 0.321 2e-15
P16157 1881 Ankyrin-1 OS=Homo sapiens no no 0.559 0.167 0.280 2e-15
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no no 0.410 0.117 0.273 2e-14
>sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 Back     alignment and function desciption
 Score = 99.8 bits (247), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 76/263 (28%), Positives = 128/263 (48%), Gaps = 34/263 (12%)

Query: 120 LLLKANAKGETLLHIAARHGHYDIVKVLIAECKKPHQNNPEEGVAAARLMLGTTNEAKDT 179
           LL + N  GET L++AA +G+ D+VK+L+      H ++         ++ GT  +    
Sbjct: 48  LLAEQNQSGETALYVAAEYGYTDMVKILM-----KHSDS---------VLAGTKAKNGFD 93

Query: 180 ALHEAVRYNQVDVVKMLTKEDPNLSYDANEAGETPLYLAAERGYKDVMEDILSTCESPVD 239
           A H A +   + V+ +L + +P LS+  + +  T L+ AA +G+ +++  +L   +  VD
Sbjct: 94  AFHIAAKNGNLQVLDVLIEANPELSFTFDSSKTTALHTAASQGHGEIVCFLL---DKGVD 150

Query: 240 HGPM----GRTALHAAAFREYTLQTYYYFFRKDREIIKVLLRSSKGTQTTKPDQQGWLPL 295
              +    G+TALH+AA   +T+            I+K L+    G   T+ D++G   L
Sbjct: 151 LAAIARSNGKTALHSAARNGHTV------------IVKKLIEKKAG-MVTRVDKKGQTAL 197

Query: 296 HLAAHLGNYYVVKELLKADISAAYKPDNEGKIPLHLAAGKGRAYTMQELIRSCPSSCELV 355
           H+A    N  +V  L++AD S     DN+G  PLH+A  K RA  +Q +++ C  S   V
Sbjct: 198 HMAVKGQNTEIVDVLMEADGSLINSADNKGNTPLHIAVRKNRAEIVQTVLKYCEVSRVAV 257

Query: 356 DDRGWNVFHFAAHSGSRRTVEFL 378
           +  G      A  +G    V  L
Sbjct: 258 NKSGETALDIAEKTGLHEIVPLL 280

Arabidopsis thaliana (taxid: 3702)
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function description
>sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 Back     alignment and function description
>sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 Back     alignment and function description
>sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 Back     alignment and function description
>sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 Back     alignment and function description
>sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 Back     alignment and function description
>sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query563
147772498 708 hypothetical protein VITISV_032148 [Viti 0.808 0.642 0.364 2e-80
255585399575 ankyrin repeat-containing protein, putat 0.801 0.784 0.367 1e-79
225432914596 PREDICTED: ankyrin repeat-containing pro 0.825 0.780 0.360 6e-76
356510752629 PREDICTED: ankyrin-2-like [Glycine max] 0.818 0.732 0.363 3e-75
224127106575 predicted protein [Populus trichocarpa] 0.809 0.793 0.373 6e-74
359477901622 PREDICTED: ankyrin repeat-containing pro 0.714 0.646 0.411 7e-72
255551947582 ankyrin repeat-containing protein, putat 0.690 0.668 0.389 1e-70
359478087608 PREDICTED: ankyrin repeat-containing pro 0.722 0.669 0.398 3e-69
147805307603 hypothetical protein VITISV_007868 [Viti 0.722 0.674 0.398 3e-69
359478091637 PREDICTED: ankyrin-1-like [Vitis vinifer 0.841 0.744 0.368 4e-66
>gi|147772498|emb|CAN60780.1| hypothetical protein VITISV_032148 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  306 bits (783), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 195/535 (36%), Positives = 278/535 (51%), Gaps = 80/535 (14%)

Query: 32  NLYEAAVEGHVGKFEEHKAVLHQILTPNENTILHIHITALPNKTMKPNNKANSLWRMIST 91
           N+YEAAVEG +  F ++   L + LTPN+NT+LHIHI     K                 
Sbjct: 136 NVYEAAVEGKM-DFLQNIVHLDRELTPNKNTVLHIHIRGGQAK----------------- 177

Query: 92  FKKQSSSDDREVIRGENFVRVILEMCPILLLKANAKGETLLHIAARHGHYDIVKVLIAEC 151
                          +  V  ++  CP LL K N K ET LH+AAR G   IV  L+ + 
Sbjct: 178 ---------------KEHVIAMVRQCPSLLQKTNNKDETPLHMAAREGLIQIVGALVDQV 222

Query: 152 KKPHQNNP--EEG-VAAARLMLGTTNEAKDTALHEAVRYNQVDVVKMLTKEDPNLSYDAN 208
           K PH N+   E G   + R M+G  N+ +DTALHEAVRY +++VV  L   DP   Y  N
Sbjct: 223 KAPHANDADLESGRTLSVREMIGMRNKEEDTALHEAVRYRRLEVVNSLIDADPEFEYCRN 282

Query: 209 EAGETPLYLAAERGYKDVMEDILSTCESPVDH-GPMGRTALHAAAFREYTLQTYYYFFRK 267
            AGETPLY+A +RG+ ++++ IL TC SP  + GP G TALH A              + 
Sbjct: 283 RAGETPLYMAVKRGFDELVDRILRTCRSPAHYQGPNGLTALHQAIICSDAKG------KV 336

Query: 268 DREIIKVLLRSSKGTQTTKPDQQGWLPLHLAAHLGNYYVVKELLKADISAAYKPDNEGKI 327
            R+I++ +         TK D  GW PLH AA+ G     + LLK D SAAY  DN+GK 
Sbjct: 337 GRKILEKM-----PDLATKTDDNGWTPLHYAAYFGKVSQAEALLKRDESAAYIADNDGKT 391

Query: 328 PLHLAAGKGRAYTMQELIRSCPSSCELVDDRGWNVFHFAAHSGSRRTVEFLLENPSLGNL 387
           PLH+AA +  A  M++LI  CP   E+VD++  NV H A  +  R  +E +L+N    NL
Sbjct: 392 PLHIAASRNHAQIMKKLISYCPDCSEVVDEKRRNVLHLAVQTRGREAMELILKNSWGSNL 451

Query: 388 MNEKNYDGNTPLLEHAVSGSFIKSFVC-HPKVDRLAFNHQNNSAEDIIRSKKVLIWENEE 446
           +N+K+ DGNTPL   A S SF+ + +  HP+VD++A N++  +A DI+ S        + 
Sbjct: 452 INDKDADGNTPLHMFASSLSFVPTLMLSHPRVDKMAVNNKGLTAADILSSN------TQA 505

Query: 447 SFLGCLARL-----NPIRCQRHIVNGNGERKEQGSNTSTEDKKSNDRKEKSSSRYEELEQ 501
             L  L R      +P   +  + N +G+  ++G+     +                   
Sbjct: 506 PLLKGLVRFALKIYDPTPARPSVTNDHGDXYDRGAKDRVXE------------------- 546

Query: 502 SVNESKESHLVVAALIATVTFTAGITVPGGYINGIDPDQGAAVLAKRSAFQAFVV 556
            + ++ ++HL+VAALIATV + AG T+PGGY       +G AVLA ++ F AF +
Sbjct: 547 -IKKASKTHLIVAALIATVAYAAGFTLPGGYKGEKGSHRGMAVLANKATFIAFYI 600

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255585399|ref|XP_002533395.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223526769|gb|EEF28995.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225432914|ref|XP_002280197.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356510752|ref|XP_003524098.1| PREDICTED: ankyrin-2-like [Glycine max] Back     alignment and taxonomy information
>gi|224127106|ref|XP_002329398.1| predicted protein [Populus trichocarpa] gi|222870448|gb|EEF07579.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359477901|ref|XP_003632040.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255551947|ref|XP_002517018.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223543653|gb|EEF45181.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359478087|ref|XP_002267876.2| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147805307|emb|CAN73752.1| hypothetical protein VITISV_007868 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359478091|ref|XP_002270351.2| PREDICTED: ankyrin-1-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query563
TAIR|locus:2020833616 AT1G03670 "AT1G03670" [Arabido 0.547 0.5 0.3 1.7e-37
TAIR|locus:2128781677 AT4G03460 "AT4G03460" [Arabido 0.554 0.460 0.285 6.1e-36
TAIR|locus:2128791 683 AT4G03470 [Arabidopsis thalian 0.492 0.405 0.305 2.1e-28
TAIR|locus:2138391572 AT4G05040 "AT4G05040" [Arabido 0.506 0.498 0.279 8.7e-28
TAIR|locus:2129685694 AT4G14390 "AT4G14390" [Arabido 0.563 0.456 0.283 3.9e-27
TAIR|locus:2128771 641 AT4G03450 "AT4G03450" [Arabido 0.493 0.433 0.292 8e-27
TAIR|locus:2129690670 ACD6 "AT4G14400" [Arabidopsis 0.571 0.480 0.257 2e-25
TAIR|locus:2075009 607 AT3G09550 [Arabidopsis thalian 0.582 0.540 0.289 1.5e-19
TAIR|locus:2181768 524 ANK1 "ankyrin-like1" [Arabidop 0.651 0.700 0.281 1.7e-19
TAIR|locus:2009046 573 AT1G34050 "AT1G34050" [Arabido 0.657 0.645 0.267 2.9e-19
TAIR|locus:2020833 AT1G03670 "AT1G03670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 355 (130.0 bits), Expect = 1.7e-37, Sum P(2) = 1.7e-37
 Identities = 102/340 (30%), Positives = 173/340 (50%)

Query:   108 NFVRVILEMCPILLLKANAKGETLLHIAARHGHYDIVKVLIAECKKPHQNNPEEGVAAAR 167
             + V  I+   P LL   N  GET LH+AAR G  +IV++L+       +++  +   AA+
Sbjct:    86 HIVEFIISTFPNLLQNVNLMGETTLHVAARAGSLNIVEILVRFIT---ESSSYDAFIAAK 142

Query:   168 LMLGTTNEAKDTALHEAVRYNQVDVVKMLTKEDPNLSYDANEAGETPLYLAAERGYKDVM 227
                G      DTALH A++   V+V   L     ++S+D N    +PLY+A E GY +++
Sbjct:   143 SKNG------DTALHAALKGKHVEVAFCLVSVKHDVSFDKNNDEASPLYMAVEAGYHELV 196

Query:   228 EDILSTCESPVDHGPM--GRTALHAAAFREYTLQTYYYFFRKDREIIKVLLRSSKGTQTT 285
               +L +  SP     M  G++ +HAA              R+D  I+ ++LR   G    
Sbjct:   197 LKMLESSSSPSILASMFSGKSVIHAAMKAN----------RRD--ILGIVLRQDPGLIEL 244

Query:   286 KPDQQGWLPLHLAAHLGNY----YVVKELLKADISAAYKPDNEGKIPLHLAAGKGRAYTM 341
             + +++G   L   A +G Y    Y++ E  KA  S  Y  D++G  P+H+AA +G    +
Sbjct:   245 R-NEEGRTCLSYGASMGCYEGIRYILAEFDKAASSLCYVADDDGFTPIHMAAKEGHVRII 303

Query:   342 QELIRSCPSSCELVDDRGWNVFHFAAHSGSRRTVEFLLENPSLGNLMNEKNYDGNTPL-- 399
             +E ++ CP S EL++++  N+FH AA +G  + V++LL+      +MNE++ +GNTPL  
Sbjct:   304 KEFLKHCPDSRELLNNQCQNIFHVAAIAGKSKVVKYLLKLDEGKRMMNEQDINGNTPLHL 363

Query:   400 -LEHAVSGSFIKSFVCHPKVDRLAFNHQNNSAEDIIRSKK 438
               +H      +     +  ++  A N++  +A DI  + K
Sbjct:   364 ATKHRYP-IVVNMLTWNDGINLRALNNEGFTALDIAETMK 402
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2128781 AT4G03460 "AT4G03460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128791 AT4G03470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2138391 AT4G05040 "AT4G05040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129685 AT4G14390 "AT4G14390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128771 AT4G03450 "AT4G03450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129690 ACD6 "AT4G14400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075009 AT3G09550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181768 ANK1 "ankyrin-like1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009046 AT1G34050 "AT1G34050" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_scaffold_120000037
hypothetical protein (575 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query563
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-20
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-20
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-20
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-19
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-19
pfam13962114 pfam13962, PGG, Domain of unknown function 3e-16
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-14
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-10
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-08
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-06
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-06
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 4e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 7e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-05
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-05
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-05
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 9e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-04
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 3e-04
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 6e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 6e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 8e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 8e-04
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 0.001
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.001
smart0024830 smart00248, ANK, ankyrin repeats 0.001
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.002
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.002
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 0.002
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 0.002
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.002
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.003
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 0.003
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 0.003
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information 
 Score = 87.4 bits (217), Expect = 1e-20
 Identities = 42/112 (37%), Positives = 58/112 (51%), Gaps = 5/112 (4%)

Query: 288 DQQGWLPLHLAAHLGNYYVVKELLKADISAAYKPDNEGKIPLHLAAGKGRAYTMQELIRS 347
           D+ G  PLHLAA  G+  VVK LL+       K DN+G+ PLHLAA  G    ++ L+  
Sbjct: 4   DEDGRTPLHLAASNGHLEVVKLLLENGADVNAK-DNDGRTPLHLAAKNGHLEIVKLLLEK 62

Query: 348 CPSSCELVDDRGWNVFHFAAHSGSRRTVEFLLENPSLGNLMNEKNYDGNTPL 399
                   D  G    H AA +G+   V+ LL++   G  +N ++ DG TPL
Sbjct: 63  GADVN-ARDKDGNTPLHLAARNGNLDVVKLLLKH---GADVNARDKDGRTPL 110

The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222475 pfam13962, PGG, Domain of unknown function Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 563
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
KOG0508 615 consensus Ankyrin repeat protein [General function 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02792631 ankyrin-like protein; Provisional 100.0
KOG0508615 consensus Ankyrin repeat protein [General function 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
PHA02792631 ankyrin-like protein; Provisional 100.0
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.97
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.94
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.94
PHA02859209 ankyrin repeat protein; Provisional 99.94
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.94
PHA02795437 ankyrin-like protein; Provisional 99.94
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.93
PHA02795437 ankyrin-like protein; Provisional 99.93
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.91
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.9
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.9
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.9
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.89
PLN03192823 Voltage-dependent potassium channel; Provisional 99.89
PLN03192823 Voltage-dependent potassium channel; Provisional 99.89
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.87
KOG0514452 consensus Ankyrin repeat protein [General function 99.86
KOG0514452 consensus Ankyrin repeat protein [General function 99.85
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.84
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.82
PHA02743166 Viral ankyrin protein; Provisional 99.82
PHA02743166 Viral ankyrin protein; Provisional 99.8
PHA02741169 hypothetical protein; Provisional 99.79
PHA02884300 ankyrin repeat protein; Provisional 99.79
PHA02741169 hypothetical protein; Provisional 99.78
PHA02884300 ankyrin repeat protein; Provisional 99.77
PF13962113 PGG: Domain of unknown function 99.77
PHA02736154 Viral ankyrin protein; Provisional 99.77
PHA02736154 Viral ankyrin protein; Provisional 99.74
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.73
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.68
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.68
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.67
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.65
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.62
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.61
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.6
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.58
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.43
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.42
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.37
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.35
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.3
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.3
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.23
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.23
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.22
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.22
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.22
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.21
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.18
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.16
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.6
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.6
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.59
PF1360630 Ank_3: Ankyrin repeat 98.58
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.56
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.5
PF1360630 Ank_3: Ankyrin repeat 98.4
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.39
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.35
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.3
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.28
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.27
KOG0522560 consensus Ankyrin repeat protein [General function 98.16
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.14
KOG0522 560 consensus Ankyrin repeat protein [General function 98.14
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.09
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.04
KOG0705749 consensus GTPase-activating protein Centaurin gamm 97.91
KOG0511516 consensus Ankyrin repeat protein [General function 97.85
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.82
KOG0520975 consensus Uncharacterized conserved protein, conta 97.66
KOG0511516 consensus Ankyrin repeat protein [General function 97.55
KOG2384223 consensus Major histocompatibility complex protein 97.54
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.52
KOG2384223 consensus Major histocompatibility complex protein 97.43
KOG0520975 consensus Uncharacterized conserved protein, conta 97.37
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.35
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.91
KOG2505591 consensus Ankyrin repeat protein [General function 95.74
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 95.44
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 95.06
KOG2505591 consensus Ankyrin repeat protein [General function 94.83
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 91.75
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 90.47
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 90.13
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 88.92
cd07920322 Pumilio Pumilio-family RNA binding domain. Puf rep 80.47
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.9e-47  Score=412.62  Aligned_cols=367  Identities=20%  Similarity=0.175  Sum_probs=306.1

Q ss_pred             hchhhHHHHHHHHHcCChhhhhhhhhcccc---ccCCCCCceeeeecccCCCCCCCCCC------------ccc------
Q 039863           25 KNIQLMDNLYEAAVEGHVGKFEEHKAVLHQ---ILTPNENTILHIHITALPNKTMKPNN------------KAN------   83 (563)
Q Consensus        25 ~~~~~~~~L~~Aa~~g~~~~v~~Ll~~~~~---~~~~~g~t~Lh~A~~~~~~~~~~~~~------------~~~------   83 (563)
                      .+..++||||.|+..|+.++|+.|++.+++   ..+..|+||||+|+..+..  ++..-            +..      
T Consensus        37 ~~~~~~t~LH~A~~~g~~e~V~~ll~~~~~~~~~~~~~~~tpLh~a~~~~~~--~~~~~~l~~~~~~~~~~~~~~~~~~~  114 (682)
T PHA02876         37 NESIPFTAIHQALQLRQIDIVEEIIQQNPELIYITDHKCHSTLHTICIIPNV--MDIVISLTLDCDIILDIKYASIILNK  114 (682)
T ss_pred             cccccchHHHHHHHHHhhhHHHHHHHhCcccchhhchhhccccccccCCCCc--cccccccccchhhcccccHHHHHHHH
Confidence            355678999999999999999999999766   4788899999999974321  11000            000      


Q ss_pred             ----------------------------hhHHHHhhhhccCCCchhhhhhhhhHHHHHHHhCchhhhcccCCCCcHHHHH
Q 039863           84 ----------------------------SLWRMISTFKKQSSSDDREVIRGENFVRVILEMCPILLLKANAKGETLLHIA  135 (563)
Q Consensus        84 ----------------------------~~~~~~~~~~~~~g~~~~~~~~~~~~v~~Ll~~~~~~l~~~~~~g~t~Lh~A  135 (563)
                                                  .........+...|        +.+++++|++.+.+ ++.+|..|.||||+|
T Consensus       115 ~~~~~~~~~il~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~--------~~~i~k~Ll~~Gad-vn~~d~~G~TpLh~A  185 (682)
T PHA02876        115 HKLDEACIHILKEAISGNDIHYDKINESIEYMKLIKERIQQD--------ELLIAEMLLEGGAD-VNAKDIYCITPIHYA  185 (682)
T ss_pred             HHHHHHHHHHHHHHhcCCcccHHhhccchhhhHHHHHHHHCC--------cHHHHHHHHhCCCC-CCCCCCCCCCHHHHH
Confidence                                        00001112223456        89999999999987 678899999999999


Q ss_pred             HHcCcHHHHHHHHHhcCCCCCCCCchhHHHHHHHhccCCCCCCcHHHHHHHcCCHHHHHHHHhcCC--------------
Q 039863          136 ARHGHYDIVKVLIAECKKPHQNNPEEGVAAARLMLGTTNEAKDTALHEAVRYNQVDVVKMLTKEDP--------------  201 (563)
Q Consensus       136 ~~~g~~~iv~~Ll~~~~~~~~~~~~~~~~~~~~~l~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~~~--------------  201 (563)
                      |..|+.++|++|++.|++...                .+..|.||||+|+..|+.+++++|++.++              
T Consensus       186 a~~G~~~iv~~LL~~Gad~n~----------------~~~~g~t~L~~A~~~~~~~ivk~Ll~~~~~~~~~~~~L~~ai~  249 (682)
T PHA02876        186 AERGNAKMVNLLLSYGADVNI----------------IALDDLSVLECAVDSKNIDTIKAIIDNRSNINKNDLSLLKAIR  249 (682)
T ss_pred             HHCCCHHHHHHHHHCCCCcCc----------------cCCCCCCHHHHHHHcCCHHHHHHHHhcCCCCCCCcHHHHHHHH
Confidence            999999999999999998543                56677788888888777777777666544              


Q ss_pred             ---------------CCccccCcCCCcHHHHHHHcCCH-HHHHHHHhcCCCCCCCCCCCCcHHHHHHhhccccchhhhhh
Q 039863          202 ---------------NLSYDANEAGETPLYLAAERGYK-DVMEDILSTCESPVDHGPMGRTALHAAAFREYTLQTYYYFF  265 (563)
Q Consensus       202 ---------------~~~~~~~~~g~tpL~~A~~~g~~-~~v~~Ll~~~~~~~~~~~~g~t~Lh~A~~~~~~~~~~~~~~  265 (563)
                                     +++ ..+..|.||||+|+..++. +++++|++.|++++..+..|.||||.|+..++         
T Consensus       250 ~~~~~~~~~Ll~~g~~vn-~~d~~g~TpLh~Aa~~~~~~~iv~lLl~~gadin~~d~~g~TpLh~Aa~~g~---------  319 (682)
T PHA02876        250 NEDLETSLLLYDAGFSVN-SIDDCKNTPLHHASQAPSLSRLVPKLLERGADVNAKNIKGETPLYLMAKNGY---------  319 (682)
T ss_pred             cCCHHHHHHHHHCCCCCC-CCCCCCCCHHHHHHhCCCHHHHHHHHHHCCCCCCCcCCCCCCHHHHHHHhCC---------
Confidence                           333 3466799999999999986 69999999999999999999999999998872         


Q ss_pred             cccHHHHHHHHhccCCCCCccCCCCCCCHHHHHHHc-CChHHHHHHHhcCCCCCccCCCCCChHHHHHHhcCCHHHHHHH
Q 039863          266 RKDREIIKVLLRSSKGTQTTKPDQQGWLPLHLAAHL-GNYYVVKELLKADISAAYKPDNEGKIPLHLAAGKGRAYTMQEL  344 (563)
Q Consensus       266 ~~~~~~~~~Ll~~~~~~~~~~~d~~g~tpLh~A~~~-g~~~~v~~Ll~~~~~~~~~~~~~g~tpL~~A~~~g~~~~v~~L  344 (563)
                        ..++++.|+..  +.+++..|..|.||||+|+.. ++.++++.|++.|+++ +.+|..|.||||+|+..|+.+++++|
T Consensus       320 --~~~~v~~Ll~~--gadin~~d~~g~TpLh~A~~~~~~~~iv~lLl~~gadi-n~~d~~G~TpLh~Aa~~~~~~iv~~L  394 (682)
T PHA02876        320 --DTENIRTLIML--GADVNAADRLYITPLHQASTLDRNKDIVITLLELGANV-NARDYCDKTPIHYAAVRNNVVIINTL  394 (682)
T ss_pred             --CHHHHHHHHHc--CCCCCCcccCCCcHHHHHHHhCCcHHHHHHHHHcCCCC-ccCCCCCCCHHHHHHHcCCHHHHHHH
Confidence              47899999987  899999999999999999986 4788999999999988 56799999999999999999999999


Q ss_pred             HHhCCCCccccccCCChHHHHHHHcCC-hHHHHHhhhCCCcccCCCCCCCCCChHHHHHHHcC--CchhhhccCcccCcc
Q 039863          345 IRSCPSSCELVDDRGWNVFHFAAHSGS-RRTVEFLLENPSLGNLMNEKNYDGNTPLLEHAVSG--SFIKSFVCHPKVDRL  421 (563)
Q Consensus       345 l~~~~~~~~~~d~~g~t~Lh~A~~~~~-~~iv~~Ll~~~~~~~~in~~d~~G~TpLh~A~~~~--~~~~~~l~~~g~d~~  421 (563)
                      ++.+++. +..+..|.||||+|+..+. ..++++|++.   |+++|.+|..|+||||+|+..+  ..++++|++.|+|++
T Consensus       395 l~~gad~-~~~~~~g~T~Lh~A~~~~~~~~~vk~Ll~~---gadin~~d~~G~TpLh~Aa~~~~~~~iv~lLl~~Gad~n  470 (682)
T PHA02876        395 LDYGADI-EALSQKIGTALHFALCGTNPYMSVKTLIDR---GANVNSKNKDLSTPLHYACKKNCKLDVIEMLLDNGADVN  470 (682)
T ss_pred             HHCCCCc-cccCCCCCchHHHHHHcCCHHHHHHHHHhC---CCCCCcCCCCCChHHHHHHHhCCcHHHHHHHHHCCCCCC
Confidence            9998876 6688999999999998766 5679999998   8999999999999999999976  357799999999999


Q ss_pred             ccccCCCCHHHHHHhc
Q 039863          422 AFNHQNNSAEDIIRSK  437 (563)
Q Consensus       422 ~~n~~g~t~l~~a~~~  437 (563)
                      .+|..|.||+++|...
T Consensus       471 ~~d~~g~tpl~~a~~~  486 (682)
T PHA02876        471 AINIQNQYPLLIALEY  486 (682)
T ss_pred             CCCCCCCCHHHHHHHh
Confidence            9999999999998753

>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF13962 PGG: Domain of unknown function Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd07920 Pumilio Pumilio-family RNA binding domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query563
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 4e-16
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 7e-09
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 8e-12
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 3e-10
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-07
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-11
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 6e-11
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-10
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 5e-10
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 9e-10
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 3e-06
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 1e-09
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 1e-06
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-09
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 4e-06
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 4e-09
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 5e-09
2xee_A157 Structural Determinants For Improved Thermal Stabil 7e-09
2xeh_A157 Structural Determinants For Improved Thermal Stabil 8e-09
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 1e-08
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 1e-07
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 1e-08
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-08
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 5e-08
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 6e-08
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 4e-07
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 2e-05
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 9e-08
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-07
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 1e-07
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 1e-07
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 1e-07
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 1e-07
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 3e-07
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-05
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 6e-07
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 6e-07
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 6e-07
1uoh_A226 Human Gankyrin Length = 226 7e-07
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 8e-07
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 9e-07
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 2e-06
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 3e-06
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 2e-06
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-06
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 3e-06
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 3e-06
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 4e-05
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 6e-06
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 7e-06
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 9e-06
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 9e-06
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 4e-05
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 4e-05
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 5e-05
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 6e-05
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 8e-05
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 2e-04
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 3e-04
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 3e-04
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 3e-04
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 3e-04
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 3e-04
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 8e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure 
Iteration: 1

 Score = 79.0 bits (193), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 92/305 (30%), Positives = 133/305 (43%), Gaps = 49/305 (16%)
Query: 108 NFVRVILE--MCPILLLKANAKGETLLHIAARHGHYDIVKVLIAECKKPHQNNPEEGVAA 165
           N V+++LE    P L   A   G T LHIAAR GH + V  L+            E  A+
Sbjct: 94  NMVKLLLENNANPNL---ATTAGHTPLHIAAREGHVETVLALL------------EKEAS 138
Query: 166 ARLMLGTTNEAKDTALHEAVRYNQVDVVKMLTKED--PNLSYDANEAGETPLYLAAERGY 223
              M     +   T LH A +Y +V V ++L + D  PN    A + G TPL++A     
Sbjct: 139 QACM----TKKGFTPLHVAAKYGKVRVAELLLERDAHPN---AAGKNGLTPLHVAVHHNN 191
Query: 224 KDVMEDILSTCESPVDHGPM--GRTALHAAAFREYTLQTYYYFFRKDREIIKVLLRSSKG 281
            D+++ +L    SP  H P   G T LH AA +               E+ + LL+   G
Sbjct: 192 LDIVKLLLPRGGSP--HSPAWNGYTPLHIAAKQNQV------------EVARSLLQY--G 235
Query: 282 TQTTKPDQQGWLPLHLAAHLGNYYVVKELLKADISAAYKPDNEGKIPLHLAAGKGRAYTM 341
                   QG  PLHLAA  G+  +V  LL    +     +  G  PLHL A +G     
Sbjct: 236 GSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLG-NKSGLTPLHLVAQEGHVPVA 294
Query: 342 QELIRSCPSSCELVDDRGWNVFHFAAHSGSRRTVEFLLENPSLGNLMNEKNYDGNTPLLE 401
             LI+      +     G+   H A+H G+ + V+FLL++ +    +N K   G +PL +
Sbjct: 295 DVLIKHG-VMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQA---DVNAKTKLGYSPLHQ 350
Query: 402 HAVSG 406
            A  G
Sbjct: 351 AAQQG 355
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query563
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-44
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-43
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-41
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-20
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-17
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-44
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-38
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-14
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-42
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-40
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 9e-37
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-31
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-41
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 8e-39
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-26
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-25
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-08
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-40
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-32
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-32
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-25
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-39
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-34
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-27
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-18
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-17
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-39
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-34
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-22
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-38
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-36
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-34
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-27
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-22
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-14
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-07
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-38
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-37
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-34
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-18
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-15
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-36
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-34
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-29
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-27
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-23
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-16
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-36
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-35
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-26
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-36
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-27
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-19
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 8e-36
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-34
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-11
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-33
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-28
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-27
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-20
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-33
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-31
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-07
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-32
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-31
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-27
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-17
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-16
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-11
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-32
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-29
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-17
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-08
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-30
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-21
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-20
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-07
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-30
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-27
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 8e-25
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-22
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-17
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-29
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-25
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-24
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-21
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-29
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-24
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-20
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-29
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-28
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-23
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-16
2rfa_A232 Transient receptor potential cation channel subfa 9e-29
2rfa_A232 Transient receptor potential cation channel subfa 1e-28
2rfa_A232 Transient receptor potential cation channel subfa 1e-24
2rfa_A232 Transient receptor potential cation channel subfa 6e-19
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-28
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-27
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-24
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-18
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-16
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-15
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-28
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-24
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-24
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-16
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-27
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-23
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-23
2pnn_A273 Transient receptor potential cation channel subfa 3e-27
2pnn_A273 Transient receptor potential cation channel subfa 5e-23
2pnn_A273 Transient receptor potential cation channel subfa 4e-20
2pnn_A273 Transient receptor potential cation channel subfa 5e-11
2pnn_A273 Transient receptor potential cation channel subfa 2e-08
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-26
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-22
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-26
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-18
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-18
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-15
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-25
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-22
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-21
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-17
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-06
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-25
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-23
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-22
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-18
2etb_A256 Transient receptor potential cation channel subfam 6e-25
2etb_A256 Transient receptor potential cation channel subfam 9e-22
2etb_A256 Transient receptor potential cation channel subfam 7e-18
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-24
3jxi_A260 Vanilloid receptor-related osmotically activated p 8e-19
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-16
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-24
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-22
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-21
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-19
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-06
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 6e-24
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 6e-24
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-20
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-17
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-04
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-23
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-20
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-17
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 9e-16
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-14
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-04
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-23
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-23
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-16
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-07
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-21
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-16
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-12
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-11
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-09
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 7e-04
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-20
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-19
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-16
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 5e-08
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-20
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 8e-20
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-19
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-18
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-18
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-15
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-04
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-04
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-19
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-18
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-16
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-16
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-18
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-18
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-17
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-15
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-15
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-05
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-18
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-16
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-16
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-09
1sw6_A327 Regulatory protein SWI6; transcription regulation, 7e-18
1sw6_A327 Regulatory protein SWI6; transcription regulation, 8e-18
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-17
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-05
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-17
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-17
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-17
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-16
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-15
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-15
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-15
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-14
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-13
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-11
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-11
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 6e-09
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-04
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-15
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-13
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-12
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-12
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-04
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 6e-04
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 8e-04
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score =  162 bits (413), Expect = 1e-44
 Identities = 74/291 (25%), Positives = 107/291 (36%), Gaps = 64/291 (21%)

Query: 123 KANAKGETLLHIAARHGHYDIVKVLIAECKKPHQNNPEEGVAAARLMLGTTNEAKDTALH 182
            +N K ET LH+AAR GH ++ K L+      ++                  +   T LH
Sbjct: 42  VSNVKVETPLHMAARAGHTEVAKYLLQ-----NKAKVNA-----------KAKDDQTPLH 85

Query: 183 EAVRYNQVDVVKMLTKEDPNLSYDAN-----EAGETPLYLAAERGYKDVMEDILSTCESP 237
            A R    ++VK+L      L  +AN      AG TPL++AA  G+ + +   L      
Sbjct: 86  CAARIGHTNMVKLL------LENNANPNLATTAGHTPLHIAAREGHVETVL-AL------ 132

Query: 238 VDHGP-------MGRTALHAAAFREYTLQTYYYFFRKDREIIKVLLRSSKGTQTTKPDQQ 290
           ++           G T LH AA                  + ++LL   +        + 
Sbjct: 133 LEKEASQACMTKKGFTPLHVAAKYGKV------------RVAELLL--ERDAHPNAAGKN 178

Query: 291 GWLPLHLAAHLGNYYVVKELLK--ADISAAYKPDNEGKIPLHLAAGKGRAYTMQELIRSC 348
           G  PLH+A H  N  +VK LL       +       G  PLH+AA + +    + L+   
Sbjct: 179 GLTPLHVAVHHNNLDIVKLLLPRGGSPHSP---AWNGYTPLHIAAKQNQVEVARSLL-QY 234

Query: 349 PSSCELVDDRGWNVFHFAAHSGSRRTVEFLLENPSLGNLMNEKNYDGNTPL 399
             S      +G    H AA  G    V  LL         N  N  G TPL
Sbjct: 235 GGSANAESVQGVTPLHLAAQEGHAEMVALLLSK---QANGNLGNKSGLTPL 282
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query563
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.98
2rfa_A232 Transient receptor potential cation channel subfa 99.98
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.98
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.95
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.94
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.94
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.94
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.94
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.94
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.93
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.93
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.93
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.93
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.93
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.93
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.92
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.9
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.89
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.89
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.89
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.88
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.88
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.88
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.86
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.86
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.86
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.86
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.86
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.85
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.85
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.83
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.83
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.83
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.83
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.83
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.82
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.81
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.8
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.8
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.78
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.78
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.78
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.75
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.75
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.74
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.74
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.73
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.73
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.64
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.58
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=1.1e-54  Score=447.26  Aligned_cols=363  Identities=25%  Similarity=0.306  Sum_probs=292.4

Q ss_pred             hhhhchhhHHHHHHHHHcCChhhhhhhhhccc--cccCCCCCceeeeecccCCCCCCCCCCccchhHHHHhhhhccCCCc
Q 039863           22 VREKNIQLMDNLYEAAVEGHVGKFEEHKAVLH--QILTPNENTILHIHITALPNKTMKPNNKANSLWRMISTFKKQSSSD   99 (563)
Q Consensus        22 ~~~~~~~~~~~L~~Aa~~g~~~~v~~Ll~~~~--~~~~~~g~t~Lh~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~   99 (563)
                      ++..+..|.||||.||..|++++|++|++.|+  +..+..|.||||+|+.                          .|  
T Consensus         7 ~~~~~~~g~t~L~~Aa~~g~~~~v~~Ll~~g~~~~~~~~~~~t~L~~A~~--------------------------~g--   58 (437)
T 1n11_A            7 GGGGGESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAAR--------------------------AG--   58 (437)
T ss_dssp             --------CCHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHH--------------------------HT--
T ss_pred             ccccCCCCCCHHHHHHHCCCHHHHHHHHHcCCCCCCCCCCCCCHHHHHHH--------------------------cC--
Confidence            45566677778888888888888888888744  4467778888888888                          66  


Q ss_pred             hhhhhhhhhHHHHHHHhCchhhhcccCCCCcHHHHHHHcCcHHHHHHHHHhcCCCCCCCCchh-----------HHHHHH
Q 039863          100 DREVIRGENFVRVILEMCPILLLKANAKGETLLHIAARHGHYDIVKVLIAECKKPHQNNPEEG-----------VAAARL  168 (563)
Q Consensus       100 ~~~~~~~~~~v~~Ll~~~~~~l~~~~~~g~t~Lh~A~~~g~~~iv~~Ll~~~~~~~~~~~~~~-----------~~~~~~  168 (563)
                            +.+++++|++.+.+ ++.++..|.||||+|+..|+.++|++|++.|+++...+....           .+..+.
T Consensus        59 ------~~~~v~~Ll~~g~~-~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~ga~~~~~~~~g~t~L~~A~~~g~~~~v~~  131 (437)
T 1n11_A           59 ------HTEVAKYLLQNKAK-VNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLA  131 (437)
T ss_dssp             ------CHHHHHHHHHHTCC-SSCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHH
T ss_pred             ------CHHHHHHHHhCCCC-CCCCCCCCCCHHHHHHHCCCHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHcCCHHHHHH
Confidence                  66666666666655 455566666666666666666666666666665543322111           111111


Q ss_pred             Hh------ccCCCCCCcHHHHHHHcCCHHHHHHHHhcCCCCccccCcCCCcHHHHHHHcCCHHHHHHHHhcCCCCCCCCC
Q 039863          169 ML------GTTNEAKDTALHEAVRYNQVDVVKMLTKEDPNLSYDANEAGETPLYLAAERGYKDVMEDILSTCESPVDHGP  242 (563)
Q Consensus       169 ~l------~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~~~~~~~~~~~~g~tpL~~A~~~g~~~~v~~Ll~~~~~~~~~~~  242 (563)
                      ++      ...+..|.||||+|+..|+.+++++|++.+.++. ..+..|.||||+|+..|+.+++++|++.+++++..+.
T Consensus       132 Ll~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~-~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~  210 (437)
T 1n11_A          132 LLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPN-AAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAW  210 (437)
T ss_dssp             HHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTT-CCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCT
T ss_pred             HHhCCCCCcCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCC-CCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCcCC
Confidence            21      2356778899999999999999999999888776 4677888999999999999999999999888888888


Q ss_pred             CCCcHHHHHHhhccccchhhhhhcccHHHHHHHHhccCCCCCccCCCCCCCHHHHHHHcCChHHHHHHHhcCCCCCccCC
Q 039863          243 MGRTALHAAAFREYTLQTYYYFFRKDREIIKVLLRSSKGTQTTKPDQQGWLPLHLAAHLGNYYVVKELLKADISAAYKPD  322 (563)
Q Consensus       243 ~g~t~Lh~A~~~~~~~~~~~~~~~~~~~~~~~Ll~~~~~~~~~~~d~~g~tpLh~A~~~g~~~~v~~Ll~~~~~~~~~~~  322 (563)
                      .|.||||.|+..+            +.+++++|++.  +.+++..+..|.||||+|+..|+.+++++|++.+++. ...+
T Consensus       211 ~g~t~L~~A~~~~------------~~~~~~~Ll~~--g~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~-~~~~  275 (437)
T 1n11_A          211 NGYTPLHIAAKQN------------QVEVARSLLQY--GGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANG-NLGN  275 (437)
T ss_dssp             TCCCHHHHHHHTT------------CHHHHHHHHHT--TCCTTCCCTTCCCHHHHHHHTTCHHHHHHHHTTTCCT-TCCC
T ss_pred             CCCCHHHHHHHcC------------CHHHHHHHHHc--CCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHhcCCCC-CCCC
Confidence            8999999999888            99999999997  8888999999999999999999999999999998887 5568


Q ss_pred             CCCChHHHHHHhcCCHHHHHHHHHhCCCCccccccCCChHHHHHHHcCChHHHHHhhhCCCcccCCCCCCCCCChHHHHH
Q 039863          323 NEGKIPLHLAAGKGRAYTMQELIRSCPSSCELVDDRGWNVFHFAAHSGSRRTVEFLLENPSLGNLMNEKNYDGNTPLLEH  402 (563)
Q Consensus       323 ~~g~tpL~~A~~~g~~~~v~~Ll~~~~~~~~~~d~~g~t~Lh~A~~~~~~~iv~~Ll~~~~~~~~in~~d~~G~TpLh~A  402 (563)
                      ..|.||||+|+..|+.+++++|++++.+. +..|..|+||||+|+.+++.+++++|++.   |+++|.+|..|+||||+|
T Consensus       276 ~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~-~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~---gad~n~~~~~g~t~L~~A  351 (437)
T 1n11_A          276 KSGLTPLHLVAQEGHVPVADVLIKHGVMV-DATTRMGYTPLHVASHYGNIKLVKFLLQH---QADVNAKTKLGYSPLHQA  351 (437)
T ss_dssp             TTCCCHHHHHHHHTCHHHHHHHHHHTCCT-TCCCSSCCCHHHHHHHSSCSHHHHHHHHT---TCCTTCCCTTSCCHHHHH
T ss_pred             CCCCCHHHHHHHcCCHHHHHHHHhCCccC-CCCCCCCCCHHHHHHHcCcHHHHHHHHhc---CCCCCCCCCCCCCHHHHH
Confidence            89999999999999999999999998765 67899999999999999999999999999   889999999999999999


Q ss_pred             HHcCC-chhhhccCcccCccccccCCCCHHHHHHhccc
Q 039863          403 AVSGS-FIKSFVCHPKVDRLAFNHQNNSAEDIIRSKKV  439 (563)
Q Consensus       403 ~~~~~-~~~~~l~~~g~d~~~~n~~g~t~l~~a~~~~~  439 (563)
                      +..++ .++++|+++|+|++.+|..|.||+++|...+.
T Consensus       352 ~~~g~~~iv~~Ll~~ga~~~~~~~~g~t~l~~A~~~g~  389 (437)
T 1n11_A          352 AQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGY  389 (437)
T ss_dssp             HHTTCHHHHHHHHHTTCCSCCCCSSSCCHHHHHHHTTC
T ss_pred             HHCChHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCc
Confidence            99995 46699999999999999999999999987764
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 563
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-29
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-24
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-19
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-26
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-19
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-14
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-20
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-13
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-09
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-09
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-20
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-10
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 8e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-17
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-16
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-08
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.002
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-17
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-16
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-11
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.001
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-17
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-14
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-09
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.001
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-16
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-15
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-06
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.002
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-13
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-07
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 0.002
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-12
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-06
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 8e-11
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-09
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.003
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 3e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.002
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-10
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-09
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.002
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 5e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 8e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.002
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 5e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 9e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 1e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-05
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 5e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.001
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.002
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 9e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.003
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 4e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.002
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 0.001
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 0.003
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  118 bits (296), Expect = 2e-29
 Identities = 77/364 (21%), Positives = 120/364 (32%), Gaps = 57/364 (15%)

Query: 130 TLLHIAARHGHYDIVKVLIAECKKPHQNNPEEGVAAARLMLGTTNEAKDTALHEAVRYNQ 189
           T LH+A+  GH  IVK L+     P+                 +N   +T LH A R   
Sbjct: 2   TPLHVASFMGHLPIVKNLLQRGASPN----------------VSNVKVETPLHMAARAGH 45

Query: 190 VDVVKMLTKEDPNLSYDANEAGETPLYLAAERGYKDVMEDILSTCESPVDHGPMGRTALH 249
            +V K L +    ++    +  +TPL+ AA  G+ ++++ +L    +P      G T LH
Sbjct: 46  TEVAKYLLQNKAKVNA-KAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLH 104

Query: 250 AAAFREYTLQTYYYFFRKDR---------------------EIIKVLLRSSKGTQTTKPD 288
            AA   +         ++                        + ++LL   +        
Sbjct: 105 IAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLL--ERDAHPNAAG 162

Query: 289 QQGWLPLHLAAHLGNYYVVKELLK--ADISAAYKPDNEGKIPLHLAAGKGRAYTMQELIR 346
           + G  PLH+A H  N  +VK LL       +   P   G  PLH+AA + +    + L+ 
Sbjct: 163 KNGLTPLHVAVHHNNLDIVKLLLPRGGSPHS---PAWNGYTPLHIAAKQNQVEVARSLL- 218

Query: 347 SCPSSCELVDDRGWNVFHFAAHSGSRRTVEFLLENPSLGNLMNEKNYDGNTPLLEHAVSG 406
               S      +G    H AA  G    V       S     N  N  G TPL   A  G
Sbjct: 219 QYGGSANAESVQGVTPLHLAAQEGHAEMVAL---LLSKQANGNLGNKSGLTPLHLVAQEG 275

Query: 407 SFIKSFVCHPKVDRLAFNHQNNSAEDIIRSKKVLIWENEESFLGCLARLNPIRCQRHIVN 466
                   H  V  +   H              L   +    +  +  L   +   +   
Sbjct: 276 --------HVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKT 327

Query: 467 GNGE 470
             G 
Sbjct: 328 KLGY 331
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query563
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.98
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.95
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.95
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.95
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.92
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.92
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.92
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.92
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.9
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.9
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.9
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.9
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.89
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.89
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.86
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.85
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.84
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.84
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.8
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.76
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=8.9e-48  Score=389.56  Aligned_cols=356  Identities=25%  Similarity=0.315  Sum_probs=317.9

Q ss_pred             HHHHHHHHHcCChhhhhhhhhccc--cccCCCCCceeeeecccCCCCCCCCCCccchhHHHHhhhhccCCCchhhhhhhh
Q 039863           30 MDNLYEAAVEGHVGKFEEHKAVLH--QILTPNENTILHIHITALPNKTMKPNNKANSLWRMISTFKKQSSSDDREVIRGE  107 (563)
Q Consensus        30 ~~~L~~Aa~~g~~~~v~~Ll~~~~--~~~~~~g~t~Lh~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~  107 (563)
                      +||||.||..|++++|++|++.|.  +..|..|+||||+||.                          +|        +.
T Consensus         1 ~TpL~~Aa~~g~~~~v~~Ll~~g~~in~~d~~g~TpL~~A~~--------------------------~g--------~~   46 (408)
T d1n11a_           1 LTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAAR--------------------------AG--------HT   46 (408)
T ss_dssp             CCHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHH--------------------------HT--------CH
T ss_pred             CChHHHHHHCcCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHH--------------------------cC--------CH
Confidence            479999999999999999999965  5589999999999999                          99        99


Q ss_pred             hHHHHHHHhCchhhhcccCCCCcHHHHHHHcCcHHHHHHHHHhcCCCCCCCCchhHHHH-----------------HHHh
Q 039863          108 NFVRVILEMCPILLLKANAKGETLLHIAARHGHYDIVKVLIAECKKPHQNNPEEGVAAA-----------------RLML  170 (563)
Q Consensus       108 ~~v~~Ll~~~~~~l~~~~~~g~t~Lh~A~~~g~~~iv~~Ll~~~~~~~~~~~~~~~~~~-----------------~~~l  170 (563)
                      +++++|++++.+ ++.++..|.||||+|+..|+.+++++|+..+.+.............                 ....
T Consensus        47 ~iv~~Ll~~gad-i~~~~~~g~t~L~~A~~~g~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  125 (408)
T d1n11a_          47 EVAKYLLQNKAK-VNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQ  125 (408)
T ss_dssp             HHHHHHHHHTCC-SSCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCS
T ss_pred             HHHHHHHHCcCC-CCCCCCCCCCHHHHHHHcCCHHHHHHHHHhhhccccccccccchhhhhhhhcccccccccccccccc
Confidence            999999999987 7889999999999999999999999999988775443322211100                 0123


Q ss_pred             ccCCCCCCcHHHHHHHcCCHHHHHHHHhcCCCCccccCcCCCcHHHHHHHcCCHHHHHHHHhcCCCCCCCCCCCCcHHHH
Q 039863          171 GTTNEAKDTALHEAVRYNQVDVVKMLTKEDPNLSYDANEAGETPLYLAAERGYKDVMEDILSTCESPVDHGPMGRTALHA  250 (563)
Q Consensus       171 ~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~~~~~~~~~~~~g~tpL~~A~~~g~~~~v~~Ll~~~~~~~~~~~~g~t~Lh~  250 (563)
                      ...+..+.++|+.|+..++.+++++|++.+.++. ..+..|.+||++|+..|+.+++++|+.+|++++..+..|.||+|.
T Consensus       126 ~~~~~~~~~~l~~a~~~~~~~~v~~ll~~~~~~~-~~~~~~~~~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~~  204 (408)
T d1n11a_         126 ACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPN-AAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHI  204 (408)
T ss_dssp             CCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTT-CCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHH
T ss_pred             cccccccchHHHHHHHcCCHHHHHHHHHcCCCCC-cCCCcCchHHHHHHHcCCHHHHHHHHhcCCcccccCCCCCCcchh
Confidence            4567889999999999999999999999998887 477889999999999999999999999999999999999999999


Q ss_pred             HHhhccccchhhhhhcccHHHHHHHHhccCCCCCccCCCCCCCHHHHHHHcCChHHHHHHHhcCCCCCccCCCCCChHHH
Q 039863          251 AAFREYTLQTYYYFFRKDREIIKVLLRSSKGTQTTKPDQQGWLPLHLAAHLGNYYVVKELLKADISAAYKPDNEGKIPLH  330 (563)
Q Consensus       251 A~~~~~~~~~~~~~~~~~~~~~~~Ll~~~~~~~~~~~d~~g~tpLh~A~~~g~~~~v~~Ll~~~~~~~~~~~~~g~tpL~  330 (563)
                      ++...            ..++...++..  .......+..+.|||++|+..++.++++.++..+... ...+..|.||++
T Consensus       205 ~~~~~------------~~~~~~~l~~~--~~~~~~~~~~~~t~l~~a~~~~~~~~~~~~~~~~~~~-~~~~~~g~~~l~  269 (408)
T d1n11a_         205 AAKQN------------QVEVARSLLQY--GGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANG-NLGNKSGLTPLH  269 (408)
T ss_dssp             HHHTT------------CHHHHHHHHHT--TCCTTCCCTTCCCHHHHHHHTTCHHHHHHHHTTTCCT-TCCCTTCCCHHH
T ss_pred             hhccc------------hhhhhhhhhhc--cccccccCCCCCCHHHHHHHhCcHhHhhhhhcccccc-ccccCCCCChhh
Confidence            99988            88999999886  7777778889999999999999999999999988776 456889999999


Q ss_pred             HHHhcCCHHHHHHHHHhCCCCccccccCCChHHHHHHHcCChHHHHHhhhCCCcccCCCCCCCCCChHHHHHHHcCC-ch
Q 039863          331 LAAGKGRAYTMQELIRSCPSSCELVDDRGWNVFHFAAHSGSRRTVEFLLENPSLGNLMNEKNYDGNTPLLEHAVSGS-FI  409 (563)
Q Consensus       331 ~A~~~g~~~~v~~Ll~~~~~~~~~~d~~g~t~Lh~A~~~~~~~iv~~Ll~~~~~~~~in~~d~~G~TpLh~A~~~~~-~~  409 (563)
                      .|+..++.+++++|++++.+. +..+..+.||||.++..++.++++++++.   |+++|.+|.+|+||||+|++.|+ .+
T Consensus       270 ~a~~~~~~~i~~~Ll~~g~~~-~~~~~~~~t~L~~~~~~~~~~~~~~ll~~---g~~in~~d~~G~T~Lh~A~~~g~~~i  345 (408)
T d1n11a_         270 LVAQEGHVPVADVLIKHGVMV-DATTRMGYTPLHVASHYGNIKLVKFLLQH---QADVNAKTKLGYSPLHQAAQQGHTDI  345 (408)
T ss_dssp             HHHHHTCHHHHHHHHHHTCCT-TCCCSSCCCHHHHHHHSSCSHHHHHHHHT---TCCTTCCCTTSCCHHHHHHHTTCHHH
T ss_pred             hhhhcCcHHHHHHHHHCCCcc-ccccccccccchhhcccCcceeeeeeccc---cccccccCCCCCCHHHHHHHcCCHHH
Confidence            999999999999999998775 66788999999999999999999999998   89999999999999999999985 46


Q ss_pred             hhhccCcccCccccccCCCCHHHHHHhcccc
Q 039863          410 KSFVCHPKVDRLAFNHQNNSAEDIIRSKKVL  440 (563)
Q Consensus       410 ~~~l~~~g~d~~~~n~~g~t~l~~a~~~~~~  440 (563)
                      +++|+++|+|++++|.+|+||+++|...+..
T Consensus       346 v~~Ll~~GAd~n~~d~~G~t~L~~A~~~~~~  376 (408)
T d1n11a_         346 VTLLLKNGASPNEVSSDGTTPLAIAKRLGYI  376 (408)
T ss_dssp             HHHHHHTTCCSCCCCSSSCCHHHHHHHTTCH
T ss_pred             HHHHHHCCCCCCCCCCCCCCHHHHHHHcCCH
Confidence            7999999999999999999999999987654
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure