Citrus Sinensis ID: 039867

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330--
MTRRCLLSPQHIKFNMSSYNSLYAFRMKLTGLVHFSYEAYRSYLHICFKCDKAPKFYCLCCPSAICGPCLYEAEFAVVKGDKGLCDECLELVLRKEEKKDVDPNQCKNDFSDPSTKEFFFYDYWRIIKKKECLTSEEVIAASNLLKRGENYKFASDSDEYDIGKEKKSSKRKRPKSSKRKRPKRKQSAMKSKFKSSRKEFIGWGSKSLLEFLVSIGKDTTRKLSKQVVAIIIREYCKENNLFHPDKKEICCDAKLQALLGRKSVEKRKLCELLTIHFAENLDCSEEELLCSSENEDDDSVACKRQMHSSSKHKAQNLLAKTPQEQMRKNIML
cccccccccccHHHHcccccccHHHHHHHccccccccccEEEcccccccccccccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccEEEccHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHccccccccHHHHHHHccccccHHHHHHccccccHHHHHHcccc
ccccHcccccEEEEEcccHHHHHHcccccccEEEEcccccccccEEEEcccccccEEEEEccHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHccccccccccEEccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccEEEEcHHHHHHHccccccHHHHHHHHHHHHHHccccccHHcccccccccccccHHcccccccHHcccccccccccHHHHHHHccc
mtrrcllspqhikfnMSSYNSLYAFRMKLTGLVHFSYEAYRSYLHICfkcdkapkfyclccpsaicgpclyeAEFAvvkgdkglcdECLELVLRkeekkdvdpnqckndfsdpstkefffYDYWRIIKKKECLTSEEVIAASNLlkrgenykfasdsdeydigkekksskrkrpksskrkrpkrkqsAMKSKFKSSRKEFIGWGSKSLLEFLVSIGKDTTRKLSKQVVAIIIREYCkennlfhpdkkeicCDAKLQALLGRKSVEKRKLCELLTIHFaenldcseeellcssenedddsvackrqmhssskhKAQNLLAKTPQEQMRKNIML
mtrrcllspqhikFNMSSYNSLYAFRMKLTGLVHFSYEAYRSYLHICFKCDKAPKFYCLCCPSAICGPCLYEAEFAVVKGDKGLCDECLELVLrkeekkdvdpnqckndfsdpstkefFFYDYWRIIKKKECLTSEEVIAAsnllkrgenykfasdsdeydigkekksskrkrpksskrkrpkrkqsamkskfkssrkefigwgsKSLLEFLVSIgkdttrklSKQVVAIIIREYCKENNLFHPDKKEICCDAKLQALLGRKSVEKRKLCELLTIHFAENLDCSEEELLCSSENEDDDSVACKRQMhssskhkaqnllaktpqeqmrkniml
MTRRCLLSPQHIKFNMSSYNSLYAFRMKLTGLVHFSYEAYRSYLHICFKCDKAPKFYCLCCPSAICGPCLYEAEFAVVKGDKGLCDECLELVLRKEEKKDVDPNQCKNDFSDPSTKEFFFYDYWRIIKKKECLTSEEVIAASNLLKRGENYKFASDSDEYDIGKEkksskrkrpksskrkrpkrkQSAMKSKFKSSRKEFIGWGSKSLLEFLVSIGKDTTRKLSKQVVAIIIREYCKENNLFHPDKKEICCDAKLQALLGRKSVEKRKLCELLTIHFAenldcseeellcssenedddsVACKRQMHSSSKHKAQNLLAKTPQEQMRKNIML
*****LLSPQHIKFNMSSYNSLYAFRMKLTGLVHFSYEAYRSYLHICFKCDKAPKFYCLCCPSAICGPCLYEAEFAVVKGDKGLCDECLELVLR*********************KEFFFYDYWRIIKKKECLTSEEVIAASNLLKRG***************************************************FIGWGSKSLLEFLVSIGKDTTRKLSKQVVAIIIREYCKENNLFHPDKKEICCDAKLQALLGRKSVEKRKLCELLTIHFAENLDCSEE*L********************************************
***RC**SPQHIKFNMSSYNSLYAFRMKLTGLVHFSYEAYRSYLHICFKCDKAPKFYCLCCPSAICGPCLYEAEFAVVKGDKGLCDECLELVLRKEEK*****N**KNDFSDPSTKEFFFYDYWRIIKKKECLTSEEVIA*****************************************************************KSLLEFLVSIGK****KLSKQVVAIIIREYCKENNLFHPDKKEICCDAKLQALLGRKSVEKRKLCELLTIHFA*************************************************KNIM*
MTRRCLLSPQHIKFNMSSYNSLYAFRMKLTGLVHFSYEAYRSYLHICFKCDKAPKFYCLCCPSAICGPCLYEAEFAVVKGDKGLCDECLELVLRKEEKKDVDPNQCKNDFSDPSTKEFFFYDYWRIIKKKECLTSEEVIAASNLLKRGENYKFASDSDEYD*************************************EFIGWGSKSLLEFLVSIGKDTTRKLSKQVVAIIIREYCKENNLFHPDKKEICCDAKLQALLGRKSVEKRKLCELLTIHFAENLDCSEEEL***************************NLLAKTPQEQMRKNIML
***RCLLSPQHIKFNMSSYNSLYAFRMKLTGLVHFSYEAYRSYLHICFKCDKAPKFYCLCCPSAICGPCLYEAEFAVVKGDKGLCDECLELVLRKEEKKDVDPNQCKNDFSDPSTKEFFFYDYWRIIKKKECLTSEEVIAASNLLK*******************************************************GWGSKSLLEFLVSIGKDTTRKLSKQVVAIIIREYCKENNLFHPDKKEICCDAKLQALLGRKSVEKRKLCELLTIHFAENL***************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTRRCLLSPQHIKFNMSSYNSLYAFRMKLTGLVHFSYEAYRSYLHICFKCDKAPKFYCLCCPSAICGPCLYEAEFAVVKGDKGLCDECLELVLRKEEKKDVDPNQCKNDFSDPSTKEFFFYDYWRIIKKKECLTSEEVIAASNLLKRGENYKFASDSDEYDIGKEKKSSKRKRPKSSKRKRPKRKQSAMKSKFKSSRKEFIGWGSKSLLEFLVSIGKDTTRKLSKQVVAIIIREYCKENNLFHPDKKEICCDAKLQALLGRKSVEKRKLCELLTIHFAENLDCSEEELLCSSENEDDDSVACKRQMHSSSKHKAQNLLAKTPQEQMRKNIML
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query332 2.2.26 [Sep-21-2011]
Q9SIV5 1773 Zinc finger CCCH domain-c no no 0.689 0.129 0.315 2e-26
Q9SD34 1292 Zinc finger CCCH domain-c no no 0.695 0.178 0.289 3e-21
Q9FT92 553 Uncharacterized protein A no no 0.388 0.233 0.355 5e-15
>sp|Q9SIV5|C3H19_ARATH Zinc finger CCCH domain-containing protein 19 OS=Arabidopsis thaliana GN=NERD PE=1 SV=3 Back     alignment and function desciption
 Score =  119 bits (299), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 76/241 (31%), Positives = 123/241 (51%), Gaps = 12/241 (4%)

Query: 45  HICFKCDKAPKFYCLCCPSAICGPCLYEAEFAVVKGDKGLCDECLE---LVLRKEEKKDV 101
           H+C KC+K   + C  C  ++C  C  +A F  ++G+KGLC+ C+E   L+ RK+++K  
Sbjct: 646 HLCSKCEKTATYLCYTCMFSLCKGCAKDAVFFCIRGNKGLCETCMETVKLIERKQQEK-- 703

Query: 102 DPNQCKNDFSDPSTKEFFFYDYWRIIKKKECLTSEEVIAASNLLKRGENYK----FASDS 157
           +P Q   DF+D ++ E+ F DYW  +K +  L+ EE+  A   LK  E        AS++
Sbjct: 704 EPAQL--DFNDKTSWEYLFKDYWIDLKTQLSLSPEELDQAKRPLKGHETNASKQGTASET 761

Query: 158 DEYDIGKEKKSSKRKRPKSSKRKRPKRKQSAMKSKFKSSRKEFIGWGSKSLLEFLVSIGK 217
           D    G     S  K+ K+  R +    +  + S  K+   E + W SK LL+ +V + +
Sbjct: 762 DYVTDGGSDSDSSPKKRKTRSRSKSGSAEKILSSGDKNLSDETMEWASKELLDLVVHMRR 821

Query: 218 DTTRKLSKQVVAIIIREYCKENNLFHPDKK-EICCDAKLQALLGRKSVEKRKLCELLTIH 276
                L    V  ++  Y K  NL  P +K ++ CD++LQ L G+  V   ++  LL  H
Sbjct: 822 GDRSFLPMLEVQTLLLAYIKRYNLRDPRRKSQVICDSRLQNLFGKSHVGHFEMLNLLDSH 881

Query: 277 F 277
           F
Sbjct: 882 F 882

Arabidopsis thaliana (taxid: 3702)
>sp|Q9SD34|C3H44_ARATH Zinc finger CCCH domain-containing protein 44 OS=Arabidopsis thaliana GN=At3g51120 PE=2 SV=3 Back     alignment and function description
>sp|Q9FT92|Y5843_ARATH Uncharacterized protein At5g08430 OS=Arabidopsis thaliana GN=At5g08430 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query332
297739485 819 unnamed protein product [Vitis vinifera] 0.825 0.334 0.469 2e-59
147820649 1832 hypothetical protein VITISV_042083 [Viti 0.801 0.145 0.467 1e-56
449520998 471 PREDICTED: zinc finger CCCH domain-conta 0.713 0.503 0.458 6e-53
449431880 746 PREDICTED: zinc finger CCCH domain-conta 0.713 0.317 0.458 8e-53
255575932 517 conserved hypothetical protein [Ricinus 0.753 0.483 0.458 3e-52
357460663 814 Zinc finger CCCH domain-containing prote 0.825 0.336 0.428 1e-50
356537823 520 PREDICTED: uncharacterized protein At5g0 0.825 0.526 0.425 3e-48
224116464 603 predicted protein [Populus trichocarpa] 0.807 0.444 0.440 3e-48
357460665 964 Zinc finger CCCH domain-containing prote 0.831 0.286 0.379 1e-46
357460661 862 Zinc finger CCCH domain-containing prote 0.831 0.320 0.393 3e-44
>gi|297739485|emb|CBI29667.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  235 bits (600), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 132/281 (46%), Positives = 177/281 (62%), Gaps = 7/281 (2%)

Query: 36  SYEAYRSYLHICFKCDKAPKFYCLCCPSAICGPCLYEAEFAVVKGDKGLCDECLELVLRK 95
           S E++    H CF C KA KF C  CP A+CG CL  +EFA V+G KG C  CL+L L  
Sbjct: 54  SDESWSCSWHSCFNCQKASKFQCYVCPKAVCGSCLSVSEFAQVRGKKGFCSHCLKLALLI 113

Query: 96  EEKKDVDPNQCKNDFSDPSTKEFFFYDYWRIIKKKECLTSEEVIAASNLLKRGENYKFAS 155
           E++ DVD +  K DF D  T EF F +Y+ IIK KE +T+E V +A  LLK+G+NY  +S
Sbjct: 114 EDEMDVDSDGGKVDFKDRETYEFLFMEYYEIIKDKEGITAENVHSADALLKKGKNYGSSS 173

Query: 156 DSDEYDIGKEKK----SSKRKRPKSSKRKRPKRKQSAMKSKFKSSRKEFIGWGSKSLLEF 211
           DSDE   G E+     S       S   KR  R++S++K K    ++EFIGWGSK L+EF
Sbjct: 174 DSDELYKGHEEDQLELSDCDDMDDSEGHKRVVRRKSSVKGKATPLKREFIGWGSKVLIEF 233

Query: 212 LVSIGKDTTRKLSKQVVAIIIREYCKENNLFHPDKK-EICCDAKLQALLGRKSVEKRKLC 270
           L SIG+DTT+KLS+  V  II  Y  +NNL HP KK ++ CD +L+ +LGRKSV K K+ 
Sbjct: 234 LASIGQDTTQKLSQYDVTSIISRYVNDNNLLHPQKKRKVLCDERLRPVLGRKSVNKNKIY 293

Query: 271 ELLTIHFAENLDCSEEELLCSSENEDDDSV--ACKRQMHSS 309
           +++  H AENL+ SE++    S  + D++V  ACKRQ  S+
Sbjct: 294 DIVEGHLAENLEESEDDEARYSSEDKDETVLMACKRQRKSN 334

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147820649|emb|CAN72097.1| hypothetical protein VITISV_042083 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449520998|ref|XP_004167519.1| PREDICTED: zinc finger CCCH domain-containing protein 19-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449431880|ref|XP_004133728.1| PREDICTED: zinc finger CCCH domain-containing protein 19-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255575932|ref|XP_002528863.1| conserved hypothetical protein [Ricinus communis] gi|223531714|gb|EEF33537.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|357460663|ref|XP_003600613.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] gi|355489661|gb|AES70864.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356537823|ref|XP_003537424.1| PREDICTED: uncharacterized protein At5g08430-like [Glycine max] Back     alignment and taxonomy information
>gi|224116464|ref|XP_002317307.1| predicted protein [Populus trichocarpa] gi|222860372|gb|EEE97919.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357460665|ref|XP_003600614.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] gi|355489662|gb|AES70865.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357460661|ref|XP_003600612.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] gi|355489660|gb|AES70863.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query332
TAIR|locus:2827287 1773 NERD "Needed for RDR2-independ 0.689 0.129 0.298 5.7e-24
TAIR|locus:2080863 1292 AT3G51120 [Arabidopsis thalian 0.698 0.179 0.274 9.5e-21
TAIR|locus:2060949 824 AT2G18090 "AT2G18090" [Arabido 0.298 0.120 0.303 3.4e-19
TAIR|locus:2150828 553 AT5G08430 [Arabidopsis thalian 0.274 0.164 0.391 6.7e-12
TAIR|locus:2154473 570 AT5G23480 [Arabidopsis thalian 0.274 0.159 0.385 1.4e-10
TAIR|locus:2827287 NERD "Needed for RDR2-independent DNA methylation" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 290 (107.1 bits), Expect = 5.7e-24, P = 5.7e-24
 Identities = 72/241 (29%), Positives = 116/241 (48%)

Query:    45 HICFKCDKAPKFYCLCCPSAICGPCLYEAEFAVVKGDKGLCDECLE---LVLRKEEKKDV 101
             H+C KC+K   + C  C  ++C  C  +A F  ++G+KGLC+ C+E   L+ RK+++K+ 
Sbjct:   646 HLCSKCEKTATYLCYTCMFSLCKGCAKDAVFFCIRGNKGLCETCMETVKLIERKQQEKE- 704

Query:   102 DPNQCKNDFSDPSTKEFFFYDYWRIIKKKECLTSEEVIAASNLLKRGENYKF----ASDS 157
              P Q   DF+D ++ E+ F DYW  +K +  L+ EE+  A   LK  E        AS++
Sbjct:   705 -PAQL--DFNDKTSWEYLFKDYWIDLKTQLSLSPEELDQAKRPLKGHETNASKQGTASET 761

Query:   158 DEYDIGKEXXXXXXXXXXXXXXXXXXXXQSAMKSKFKSSRKEFIGWGSKSLLEFLVSIGK 217
             D    G                      +  + S  K+   E + W SK LL+ +V + +
Sbjct:   762 DYVTDGGSDSDSSPKKRKTRSRSKSGSAEKILSSGDKNLSDETMEWASKELLDLVVHMRR 821

Query:   218 DTTRKLSKQVVAIIIREYCKENNLFHPDKK-EICCDAKLQALLGRKSVEKRKLCELLTIH 276
                  L    V  ++  Y K  NL  P +K ++ CD++LQ L G+  V   ++  LL  H
Sbjct:   822 GDRSFLPMLEVQTLLLAYIKRYNLRDPRRKSQVICDSRLQNLFGKSHVGHFEMLNLLDSH 881

Query:   277 F 277
             F
Sbjct:   882 F 882
GO:0005634 "nucleus" evidence=ISM;IEA
GO:0005829 "cytosol" evidence=IDA
GO:0031048 "chromatin silencing by small RNA" evidence=IMP
GO:0042393 "histone binding" evidence=IDA
TAIR|locus:2080863 AT3G51120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060949 AT2G18090 "AT2G18090" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150828 AT5G08430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154473 AT5G23480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00035317001
SubName- Full=Chromosome undetermined scaffold_77, whole genome shotgun sequence; (431 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query332
pfam0220176 pfam02201, SWIB, SWIB/MDM2 domain 9e-06
PRK06319860 PRK06319, PRK06319, DNA topoisomerase I/SWI domain 5e-04
COG5531237 COG5531, COG5531, SWIB-domain-containing proteins 0.004
>gnl|CDD|145386 pfam02201, SWIB, SWIB/MDM2 domain Back     alignment and domain information 
 Score = 43.0 bits (102), Expect = 9e-06
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 6/72 (8%)

Query: 208 LLEFLVSIGKDT-TRKLSKQVVAIIIREYCKENNLFHP-DKKEICCDAKLQALLGRKSVE 265
             +    +G    +R    +VV  +  +Y KE+NL  P +K+ I CD KL+++ G   V 
Sbjct: 8   SPDLAKFLGAGELSRT---EVVKKL-WQYIKEHNLQDPKNKRIILCDEKLKSIFGGDRVG 63

Query: 266 KRKLCELLTIHF 277
             ++ +LL+ HF
Sbjct: 64  FFEMSKLLSSHF 75

This family includes the SWIB domain and the MDM2 domain. The p53-associated protein (MDM2) is an inhibitor of the p53 tumour suppressor gene binding the transactivation domain and down regulating the ability of p53 to activate transcription. This family contains the p53 binding domain of MDM2. Length = 76
>gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated Back     alignment and domain information
>gnl|CDD|227818 COG5531, COG5531, SWIB-domain-containing proteins implicated in chromatin remodeling [Chromatin structure and dynamics] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 332
KOG1946240 consensus RNA polymerase I transcription factor UA 99.98
PF0220176 SWIB: SWIB/MDM2 domain; InterPro: IPR003121 The SW 99.83
smart0015177 SWIB SWI complex, BAF60b domains. 99.82
COG5531237 SWIB-domain-containing proteins implicated in chro 99.67
PRK14724987 DNA topoisomerase III; Provisional 99.65
KOG2570420 consensus SWI/SNF transcription activation complex 99.18
PRK06319860 DNA topoisomerase I/SWI domain fusion protein; Val 99.14
KOG1081463 consensus Transcription factor NSD1 and related SE 96.75
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 96.09
KOG3362156 consensus Predicted BBOX Zn-finger protein [Genera 88.78
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 87.71
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 87.69
KOG0956 900 consensus PHD finger protein AF10 [General functio 86.0
smart0006468 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 85.66
KOG0383 696 consensus Predicted helicase [General function pre 82.86
>KOG1946 consensus RNA polymerase I transcription factor UAF [Transcription] Back     alignment and domain information 
Probab=99.98  E-value=3.6e-33  Score=260.65  Aligned_cols=174  Identities=31%  Similarity=0.407  Sum_probs=126.5

Q ss_pred             CCCCccchhHHHHHHHHhhhcCCChHHHHHhhhhhccCCCCCCCCC-CccccCCCccCcCcCCCCCCcc---CCCchhh-
Q 039867          111 SDPSTKEFFFYDYWRIIKKKECLTSEEVIAASNLLKRGENYKFASD-SDEYDIGKEKKSSKRKRPKSSK---RKRPKRK-  185 (332)
Q Consensus       111 ~D~~t~E~LFK~YW~~iK~ke~Lt~~el~~A~~~~k~~~~~~~~sd-~~~~~~~d~~~~~~~~~~~~~k---~Kk~~~~-  185 (332)
                      +|..+|||+|++||..++++++||.++|++|.++|.+.......+. +..++..++.++.....+...+   ++..++. 
T Consensus         1 ~~~~~~~~~~~~~~l~~~~~~~lt~~~vr~~~~~~~~v~~~~~k~~~~~~~~~~~~~~~~~~~k~~~~k~~~~~~~~~~~   80 (240)
T KOG1946|consen    1 MDSLSWEYLFKDYILSLKDQETLTPDDVRRAMAPRSGVDGTAQKSLLAKAIDESSDEDSALPVKGSKKKKRGSKTRSRKP   80 (240)
T ss_pred             CcchhhhhhhhHHHhcccccccCCHHHHHHHhccccCCCCcchhhhhhhhhhcccccccccccccccccccccccccccC
Confidence            3678999999999999999999999999999999998665433211 1222222222222222221111   1101100 


Q ss_pred             hhhhhcccccCcccccccCcHHHHHHHHHhCCCc-CccCCHHHHHHHHHHHHHHcCCCCCCC-CccccchhhhhhhCCce
Q 039867          186 QSAMKSKFKSSRKEFIGWGSKSLLEFLVSIGKDT-TRKLSKQVVAIIIREYCKENNLFHPDK-KEICCDAKLQALLGRKS  263 (332)
Q Consensus       186 k~~~~~~~k~k~~~~~~w~S~eL~eFL~~iG~d~-t~~lSR~dVvk~lW~YIK~nnLqDP~~-r~IiCDekLk~LFgk~~  263 (332)
                      +....+.....+..-++||+..|..|+.+|+..+ +++|||.+|+++||+|||+||||||.| |.|+||++|+.|||+++
T Consensus        81 ~~~~~~~~~~~~~~~~~~g~~kl~~ls~~L~~~~G~~~lsR~~vvk~iw~YIke~nLqDP~nkr~IlCDekL~~iF~~k~  160 (240)
T KOG1946|consen   81 KSLESSGEKNKKKKKASWGSTKLIPLSPSLARFVGTSELSRTDVVKKIWAYIKEHNLQDPKNKREILCDEKLKSIFGKKR  160 (240)
T ss_pred             cccccccccchhccccCcCcccccccCHHHHhhcccccccHHHHHHHHHHHHHHhccCCccccCeeeeHHHHHHHhccCc
Confidence            0001111111122227799999888888888888 889999999999999999999999999 99999999999999999


Q ss_pred             echHhHHHHHHhcccCCCCch
Q 039867          264 VEKRKLCELLTIHFAENLDCS  284 (332)
Q Consensus       264 V~~~~m~kLL~~H~~~n~e~s  284 (332)
                      |+||+|++||.+||+++.+.+
T Consensus       161 v~~fem~KLL~~H~~~~~d~~  181 (240)
T KOG1946|consen  161 VGMFEMLKLLTKHFLKNQDMV  181 (240)
T ss_pred             cceeeHHHHHHHhccCccccc
Confidence            999999999999999998653

>PF02201 SWIB: SWIB/MDM2 domain; InterPro: IPR003121 The SWI/SNF family of complexes, which are conserved from yeast to humans, are ATP-dependent chromatin-remodelling proteins that facilitate transcription activation [] Back     alignment and domain information
>smart00151 SWIB SWI complex, BAF60b domains Back     alignment and domain information
>COG5531 SWIB-domain-containing proteins implicated in chromatin remodeling [Chromatin structure and dynamics] Back     alignment and domain information
>PRK14724 DNA topoisomerase III; Provisional Back     alignment and domain information
>KOG2570 consensus SWI/SNF transcription activation complex subunit [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PRK06319 DNA topoisomerase I/SWI domain fusion protein; Validated Back     alignment and domain information
>KOG1081 consensus Transcription factor NSD1 and related SET domain proteins [Transcription] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG3362 consensus Predicted BBOX Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query332
1v32_A101 Solution Structure Of The SwibMDM2 DOMAIN OF THE Hy 2e-12
>pdb|1V32|A Chain A, Solution Structure Of The SwibMDM2 DOMAIN OF THE Hypothetical Protein At5g08430 From Arabidopsis Thaliana Length = 101 Back     alignment and structure 
Iteration: 1

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 54/82 (65%), Gaps = 1/82 (1%)
Query: 197 RKEFIGWGSKSLLEFLVSIGKDTTRKLSKQVVAIIIREYCKENNLFHP-DKKEICCDAKL 255
           R EF+GWGS+ L+EFL S+GKDT+  +S+  V+  I +Y  +  L  P +KK++ CD +L
Sbjct: 9   RFEFVGWGSRQLIEFLHSLGKDTSEMISRYDVSDTIAKYISKEGLLDPSNKKKVVCDKRL 68
Query: 256 QALLGRKSVEKRKLCELLTIHF 277
             L G +++ + K+ +LL  H+
Sbjct: 69  VLLFGTRTIFRMKVYDLLEKHY 90
  Database: pdbaa

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query332
1v32_A101 AT5G08430, hypothetical protein RAFL09-47-K03; SWI 6e-24
1v31_A93 Hypothetical protein RAFL11-05-P19; SWI/SNF comple 7e-09
1uhr_A93 SWI/SNF related, matrix associated, actin dependen 6e-08
>1v32_A AT5G08430, hypothetical protein RAFL09-47-K03; SWI/SNF complex subunit, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.42.1.1 Length = 101 Back     alignment and structure
 Score = 93.0 bits (231), Expect = 6e-24
 Identities = 36/94 (38%), Positives = 57/94 (60%), Gaps = 1/94 (1%)

Query: 194 KSSRKEFIGWGSKSLLEFLVSIGKDTTRKLSKQVVAIIIREYCKENNLFHP-DKKEICCD 252
              R EF+GWGS+ L+EFL S+GKDT+  +S+  V+  I +Y  +  L  P +KK++ CD
Sbjct: 6   SGKRFEFVGWGSRQLIEFLHSLGKDTSEMISRYDVSDTIAKYISKEGLLDPSNKKKVVCD 65

Query: 253 AKLQALLGRKSVEKRKLCELLTIHFAENLDCSEE 286
            +L  L G +++ + K+ +LL  H+ EN D    
Sbjct: 66  KRLVLLFGTRTIFRMKVYDLLEKHYKENQDSGPS 99
>1v31_A Hypothetical protein RAFL11-05-P19; SWI/SNF complex subunit, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.42.1.1 Length = 93 Back     alignment and structure
>1uhr_A SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily...; structural genomics, chromatin remodeling; NMR {Mus musculus} SCOP: a.42.1.1 Length = 93 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query332
1v32_A101 AT5G08430, hypothetical protein RAFL09-47-K03; SWI 100.0
1v31_A93 Hypothetical protein RAFL11-05-P19; SWI/SNF comple 99.88
1uhr_A93 SWI/SNF related, matrix associated, actin dependen 99.87
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 99.67
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.36
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.16
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.16
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 97.06
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 96.97
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 96.96
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 96.95
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 96.92
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 96.89
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 96.87
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 96.84
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 96.84
3dac_M130 MDM4 protein; MDMX, MDM4, HDMX, HDM4, MDM-4, MDM-X 96.84
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 96.77
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 96.65
1weu_A91 Inhibitor of growth family, member 4; structural g 96.63
3fea_A100 MDM4 protein; HDMX, HDM4,human MDM4, human MDMX, p 96.61
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 96.52
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 96.44
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 96.43
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 96.34
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 96.28
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 96.21
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 96.16
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 95.92
1z1m_A119 Ubiquitin-protein ligase E3 MDM2; peptide-binding 95.87
1ycq_A107 MDM2, MDM2; anti-oncogene, DNA-binding, transcript 95.87
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 95.66
2z5s_M140 MDM4 protein, zebrafish MDMX; MDMX, MDM4, acetylat 95.63
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 95.57
2yt5_A66 Metal-response element-binding transcription facto 95.56
1x4i_A70 Inhibitor of growth protein 3; structural genomics 95.47
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 95.4
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 95.26
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 95.19
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 95.16
2k16_A75 Transcription initiation factor TFIID subunit 3; p 95.08
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 94.64
2axi_A115 Ubiquitin-protein ligase E3 MDM2; drug design, pro 94.61
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 93.5
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 93.18
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 92.83
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 92.15
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 92.0
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 91.75
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 91.33
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 91.12
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 90.51
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 90.49
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 90.45
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 90.43
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 90.25
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 89.34
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 88.84
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 88.79
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 88.46
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 88.22
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 87.36
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 86.93
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 86.76
1wew_A78 DNA-binding family protein; structural genomics, P 86.71
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 86.45
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 86.15
1we9_A64 PHD finger family protein; structural genomics, PH 85.53
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 85.38
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 84.5
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 84.23
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 83.98
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 83.71
1vfy_A73 Phosphatidylinositol-3-phosphate binding FYVE doma 83.47
3o70_A68 PHD finger protein 13; PHF13, structural genomics 82.05
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 81.86
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 81.53
2yt5_A66 Metal-response element-binding transcription facto 80.95
1wem_A76 Death associated transcription factor 1; structura 80.11
>1v32_A AT5G08430, hypothetical protein RAFL09-47-K03; SWI/SNF complex subunit, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.42.1.1 Back     alignment and structure
Probab=100.00  E-value=2.9e-33  Score=230.11  Aligned_cols=94  Identities=37%  Similarity=0.703  Sum_probs=89.3

Q ss_pred             cccCcccccccCcHHHHHHHHHhCCCcCccCCHHHHHHHHHHHHHHcCCCCCCC-CccccchhhhhhhCCceechHhHHH
Q 039867          193 FKSSRKEFIGWGSKSLLEFLVSIGKDTTRKLSKQVVAIIIREYCKENNLFHPDK-KEICCDAKLQALLGRKSVEKRKLCE  271 (332)
Q Consensus       193 ~k~k~~~~~~w~S~eL~eFL~~iG~d~t~~lSR~dVvk~lW~YIK~nnLqDP~~-r~IiCDekLk~LFgk~~V~~~~m~k  271 (332)
                      ..+|+.+|+||+|++|++||++||.++++++||++|+++||+|||+||||||.+ |.|+||++|++|||+++|+||+|++
T Consensus         5 ~~~~~~~~~~w~S~eLa~fl~~iG~~~~~~~sR~eVvk~lW~YIK~nnLQdp~~Kr~I~cD~kLk~lFg~~~v~~~~m~k   84 (101)
T 1v32_A            5 SSGKRFEFVGWGSRQLIEFLHSLGKDTSEMISRYDVSDTIAKYISKEGLLDPSNKKKVVCDKRLVLLFGTRTIFRMKVYD   84 (101)
T ss_dssp             CCSSCCSSSSSSCHHHHHHHHHHTCCCSSCCCHHHHHHHHHHHHHHHTCBCSSCTTEEECCSHHHHHTCCSEEETTHHHH
T ss_pred             CCCCcceecccCCHHHHHHHHHcCCCCccccCHHHHHHHHHHHHHhhcCcCcccCCeeeccHHHHHHHCCCcccHHHHHH
Confidence            456789999999999999999999998899999999999999999999999999 9999999999999999999999999


Q ss_pred             HHHhcccCCCCchhh
Q 039867          272 LLTIHFAENLDCSEE  286 (332)
Q Consensus       272 LL~~H~~~n~e~s~d  286 (332)
                      +|++||.++.|++++
T Consensus        85 lL~~Hl~~~~e~~~~   99 (101)
T 1v32_A           85 LLEKHYKENQDSGPS   99 (101)
T ss_dssp             HHHHHSCSCCCCCSS
T ss_pred             HHHHHcCcccccCCC
Confidence            999999999877654
>1v31_A Hypothetical protein RAFL11-05-P19; SWI/SNF complex subunit, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.42.1.1 Back     alignment and structure
>1uhr_A SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily...; structural genomics, chromatin remodeling; NMR {Mus musculus} SCOP: a.42.1.1 Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>3dac_M MDM4 protein; MDMX, MDM4, HDMX, HDM4, MDM-4, MDM-X, MDM2, HDM2, nucleus, oncogene, apoptosis, cell cycle, disease mutation; 1.80A {Danio rerio} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3fea_A MDM4 protein; HDMX, HDM4,human MDM4, human MDMX, protein-protein interaction, metal-binding; HET: PM3 6CW; 1.33A {Homo sapiens} SCOP: a.42.1.0 PDB: 3fe7_A* 3u15_A* 2vyr_A 3lbj_E* 3fdo_A 3dab_A 3jzp_A 3jzo_A 3jzq_A 3eqy_A Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1z1m_A Ubiquitin-protein ligase E3 MDM2; peptide-binding groove, psudosymmetry, alpha-beta domains; NMR {Homo sapiens} Back     alignment and structure
>1ycq_A MDM2, MDM2; anti-oncogene, DNA-binding, transcription regulation, nuclear protein, complex (oncogene protein/peptide), phosphorylation, activator; 2.30A {Xenopus laevis} SCOP: a.42.1.1 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2z5s_M MDM4 protein, zebrafish MDMX; MDMX, MDM4, acetylation, activator, anti-oncogene, apoptosis, cell cycle, cytoplasm, disease mutation, DNA- binding; 2.30A {Danio rerio} PDB: 2z5t_M Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2axi_A Ubiquitin-protein ligase E3 MDM2; drug design, protein-protein interactions, ligase, LIGA inhibitor complex; HET: 6CW MPO; 1.40A {Homo sapiens} SCOP: a.42.1.1 PDB: 1ycr_A 2gv2_A* 1t4f_M* 3jzr_A 3g03_A 3tu1_A* 3jzk_A* 1t4e_A* 3lbl_A* 4dij_A* 3lbk_A* 3v3b_A* 3jzs_A 3eqs_A 3iux_A* 3iwy_A* 3lnj_A* 3lnz_A 1rv1_A* 1ttv_A* Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 332
d1v32a_101 a.42.1.1 (A:) Hypothetical protein AT5G08430 (rafl 1e-22
d1uhra_93 a.42.1.1 (A:) SWI/SNF related regulator of chromat 3e-08
d1v31a_93 a.42.1.1 (A:) Hypothetical protein AT5G14170 (rafl 3e-07
>d1v32a_ a.42.1.1 (A:) Hypothetical protein AT5G08430 (rafl09-47-k03) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 101 Back     information, alignment and structure

class: All alpha proteins
fold: SWIB/MDM2 domain
superfamily: SWIB/MDM2 domain
family: SWIB/MDM2 domain
domain: Hypothetical protein AT5G08430 (rafl09-47-k03)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 88.3 bits (219), Expect = 1e-22
 Identities = 36/93 (38%), Positives = 57/93 (61%), Gaps = 1/93 (1%)

Query: 194 KSSRKEFIGWGSKSLLEFLVSIGKDTTRKLSKQVVAIIIREYCKENNLFHP-DKKEICCD 252
              R EF+GWGS+ L+EFL S+GKDT+  +S+  V+  I +Y  +  L  P +KK++ CD
Sbjct: 6   SGKRFEFVGWGSRQLIEFLHSLGKDTSEMISRYDVSDTIAKYISKEGLLDPSNKKKVVCD 65

Query: 253 AKLQALLGRKSVEKRKLCELLTIHFAENLDCSE 285
            +L  L G +++ + K+ +LL  H+ EN D   
Sbjct: 66  KRLVLLFGTRTIFRMKVYDLLEKHYKENQDSGP 98
>d1uhra_ a.42.1.1 (A:) SWI/SNF related regulator of chromatin (BRG1-associated factor 60a) {Mouse (Mus musculus) [TaxId: 10090]} Length = 93 Back     information, alignment and structure
>d1v31a_ a.42.1.1 (A:) Hypothetical protein AT5G14170 (rafl11-05-p19) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 93 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query332
d1v32a_101 Hypothetical protein AT5G08430 (rafl09-47-k03) {Th 99.97
d1v31a_93 Hypothetical protein AT5G14170 (rafl11-05-p19) {Th 99.86
d1uhra_93 SWI/SNF related regulator of chromatin (BRG1-assoc 99.86
d2axia185 MDM2 {Human (Homo sapiens) [TaxId: 9606]} 97.47
d1ttva_107 MDM2 {African clawed frog (Xenopus laevis) [TaxId: 97.39
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 96.51
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 96.3
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 96.3
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 95.97
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 93.71
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 91.9
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 90.16
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 90.0
d1dvpa272 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 87.91
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 87.24
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 85.92
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 83.19
d1vfya_67 vps27p protein {Baker's yeast (Saccharomyces cerev 82.35
>d1v32a_ a.42.1.1 (A:) Hypothetical protein AT5G08430 (rafl09-47-k03) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All alpha proteins
fold: SWIB/MDM2 domain
superfamily: SWIB/MDM2 domain
family: SWIB/MDM2 domain
domain: Hypothetical protein AT5G08430 (rafl09-47-k03)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.97  E-value=4.6e-31  Score=215.17  Aligned_cols=89  Identities=39%  Similarity=0.752  Sum_probs=85.1

Q ss_pred             ccCcccccccCcHHHHHHHHHhCCCcCccCCHHHHHHHHHHHHHHcCCCCCCC-CccccchhhhhhhCCceechHhHHHH
Q 039867          194 KSSRKEFIGWGSKSLLEFLVSIGKDTTRKLSKQVVAIIIREYCKENNLFHPDK-KEICCDAKLQALLGRKSVEKRKLCEL  272 (332)
Q Consensus       194 k~k~~~~~~w~S~eL~eFL~~iG~d~t~~lSR~dVvk~lW~YIK~nnLqDP~~-r~IiCDekLk~LFgk~~V~~~~m~kL  272 (332)
                      +.|..+|+||+|+||++||++||.++++++||++|++.||+|||+||||||.| |.|+||++|+.|||.++|++|+|+++
T Consensus         6 ~~k~~~~~g~~S~eL~~FL~~~g~~~~~~~sR~eVtk~iw~YIK~nnLqdp~nkr~I~~D~~L~~Lfg~~~v~~f~i~k~   85 (101)
T d1v32a_           6 SGKRFEFVGWGSRQLIEFLHSLGKDTSEMISRYDVSDTIAKYISKEGLLDPSNKKKVVCDKRLVLLFGTRTIFRMKVYDL   85 (101)
T ss_dssp             CSSCCSSSSSSCHHHHHHHHHHTCCCSSCCCHHHHHHHHHHHHHHHTCBCSSCTTEEECCSHHHHHTCCSEEETTHHHHH
T ss_pred             CCCcccccCcCCHHHHHHHHhcCCCCcccCCHHHHHHHHHHHHHHhcCCCCccCCEEccCHHHHHHhCCCcccHHHHHHH
Confidence            44567999999999999999999999999999999999999999999999999 99999999999999999999999999


Q ss_pred             HHhcccCCCC
Q 039867          273 LTIHFAENLD  282 (332)
Q Consensus       273 L~~H~~~n~e  282 (332)
                      |.+||.++.+
T Consensus        86 l~~H~~~~~~   95 (101)
T d1v32a_          86 LEKHYKENQD   95 (101)
T ss_dssp             HHHHSCSCCC
T ss_pred             HHHHcCCccc
Confidence            9999999874
>d1v31a_ a.42.1.1 (A:) Hypothetical protein AT5G14170 (rafl11-05-p19) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1uhra_ a.42.1.1 (A:) SWI/SNF related regulator of chromatin (BRG1-associated factor 60a) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2axia1 a.42.1.1 (A:25-109) MDM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ttva_ a.42.1.1 (A:) MDM2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure