Citrus Sinensis ID: 039873


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------71
MPARKPPTSPQAATRCAPFLFKQNRAPPSVEDTLKLLKHSADSKDLKLGKVIHAHLIITTESSRNENVVLTNSLVNLYAKCNQISIARQLFDNMRQRNVVSYSSLMTWYLHNGFLLETLKLFKNMVSGDNLEPNEYIFSIVLSSCSRSGRGAEGRQCHGYVFKSGLVFCKYVRNALVELYTKCLDVEMAKRLLDLLPGYDVFEYNSVLNGLIENECFRGGVEVLGKMVSGSVRWDSVTYVNAFGLSASLKDLKLGLQVHSQMLKSDIEPDVFINSAMISMYGKCGKFSNAKKVFEGLETRNVVLWTAMVAACFQNEYFEEALNLFCGMEYEAIRPNEFTFAVMLNSAAGLSALRHGDLLHAHIEKSGFKEHLIVGNALINMYAKGGNIEAANKVFSDMRYRDIITWNAMICGYSHHGLGREALTLFQNMLAAEERPNHVTFVGVLSACGHLGLVQEGFYYLNHLMKQIGIVPGLEHYTCIVGLLSKAGLLDEAEKFMRSTPVKWDVVAWHTLLNASRVHQNYGFGRRIAEYILHMDPNDVGTYILLSNMYAKEKRWDGVSKIRKLMKVRKVKKEPGSSWTEIRNTTHVFISGDSNHPESSQIYEKVRELSAKIKPLGYVPDVAAVLHDVEDEQKEDYLNHHSEKLAIAYALMETPPTAPILVIKNLRMCDDCHSAVKLISKLTKRDIIVRDTNRFHRFQDGCCSCTDYW
cccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHccccccccccHHHHHHHHHHccccHHHHHHHHHHHHccccccccEEHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHcccccccEEEHHHHHHHHHccccccHHHHHHHHHHHccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHccccccccEEcHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHccccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccHHHHHHHHHHHccccccccEEEEEEccEEEEEEccccccccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccHHHHHHHHHccccccccEEEEcccccccHHHHHHHHHHHHcccEEEEcccccccccccccccccccc
cccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEEEEEEccEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccccccEEEccccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccEEcccHHHHHHHHHHHcccEEEEEccccccccccccEcccccc
mparkpptspqaatrcapflfkqnrappsvEDTLKLLKHsadskdlklgKVIHAHLIITtessrnenVVLTNSLVNLYAKCNQISIARQLFDNMRQRNVVSYSSLMTWYLHNGFLLETLKLFKNmvsgdnlepnEYIFSIVLSscsrsgrgaegrqchgyvfKSGLVFCKYVRNALVELYTKCLDVEMAKRLLdllpgydvfeyNSVLnglienecfrGGVEVLGKMVSGSVRWDSVTYVNAFGLSASLKDLKLGLQVHSQMlksdiepdvfINSAMISMYgkcgkfsnakKVFEGLETRNVVLWTAMVAACFQNEYFEEALNLFCgmeyeairpneFTFAVMLNSAAGLSALRHGDLLHAHIEKSGFKEHLIVGNALINMYAKGGNIEAANKVFSDMRYRDIITWNAMICgyshhglgrEALTLFQNMLaaeerpnhvTFVGVLSacghlglvQEGFYYLNHLMKQIGIVPGLEHYTCIVGLLSKAGLLDEAEKFmrstpvkwDVVAWHTLLNASRVHQNYGFGRRIAEYILhmdpndvgTYILLSNMYAKEKRWDGVSKIRKLMKVRKvkkepgsswteirNTTHVFisgdsnhpessQIYEKVRELSAKikplgyvpdVAAVLHDVEDEQKEDYLNHHSEKLAIAYALmetpptapilviknlrmcddCHSAVKLISKLtkrdiivrdtnrfhrfqdgccsctdyw
mparkpptspqaatrcapflfkqnrappsVEDTLKLLKHSadskdlklgKVIHAHLiittessrnenVVLTNSLVNLYAKCNQISIARQLFDNMRQRNVVSYSSLMTWYLHNGFLLETLKLFKNMVSGDNLEPNEYIFSIVLSSCSRSGRGAEGRQCHGYVFKSGLVFCKYVRNALVELYTKCLDVEMAKRLLDLLPGYDVFEYNSVLNGLIENECFRGGVEVLGKMVSGSVRWDSVTYVNAFGLSASLKDLKLGLQVHSQMLKSDIEPDVFINSAMISMYGKCGKFSNAKKVFEGLETRNVVLWTAMVAACFQNEYFEEALNLFCGMEYEAIRPNEFTFAVMLNSAAGLSALRHGDLLHAHIEKSGFKEHLIVGNALINMYAKGGNIEAANKVFSDMRYRDIITWNAMICGYSHHGLGREALTLFQNMLAAEERPNHVTFVGVLSACGHLGLVQEGFYYLNHLMKQIGIVPGLEHYTCIVGLLSKAGLLDEAEKFMRSTPVKWDVVAWHTLLNASRVHQNYGFGRRIAEYILHMDPNDVGTYILLSNMyakekrwdgvskirklmkvrkvkkepgsswteirntthvfisgdsnhpESSQIYEKVRELSAKIKPLGYVPDVAAVLHDVEDEQKEDYLNHHSEKLAIAYALMETPPTAPILVIKNLRMCDDCHSAVKliskltkrdiivrdtnrfhrfqdgccsctdyw
MPARKPPTSPQAATRCAPFLFKQNRAPPSVEDTLKLLKHSADSKDLKLGKVIHAHLIITTESSRNENVVLTNSLVNLYAKCNQISIARQLFDNMRQRNVVSYSSLMTWYLHNGFLLETLKLFKNMVSGDNLEPNEYIFSIVLSSCSRSGRGAEGRQCHGYVFKSGLVFCKYVRNALVELYTKCLDVEMAKRLLDLLPGYDVFEYNSVLNGLIENECFRGGVEVLGKMVSGSVRWDSVTYVNAFGLSASLKDLKLGLQVHSQMLKSDIEPDVFINSAMISMYGKCGKFSNAKKVFEGLETRNVVLWTAMVAACFQNEYFEEALNLFCGMEYEAIRPNEFTFAVMLNSAAGLSALRHGDLLHAHIEKSGFKEHLIVGNALINMYAKGGNIEAANKVFSDMRYRDIITWNAMICGYSHHGLGREALTLFQNMLAAEERPNHVTFVGVLSACGHLGLVQEGFYYLNHLMKQIGIVPGLEHYTCIVGLLSKAGLLDEAEKFMRSTPVKWDVVAWHTLLNASRVHQNYGFGRRIAEYILHMDPNDVGTYILLSNMYAKEKRWDGVSKIRKLMKVRKVKKEPGSSWTEIRNTTHVFISGDSNHPESSQIYEKVRELSAKIKPLGYVPDVAAVLHDVEDEQKEDYLNHHSEKLAIAYALMETPPTAPILVIKNLRMCDDCHSAVKLISKLTKRDIIVRDTNRFHRFQDGCCSCTDYW
********************************************DLKLGKVIHAHLIITTESSRNENVVLTNSLVNLYAKCNQISIARQLFDNMRQRNVVSYSSLMTWYLHNGFLLETLKLFKNMVSGDNLEPNEYIFSIVLSSCSRSGRGAEGRQCHGYVFKSGLVFCKYVRNALVELYTKCLDVEMAKRLLDLLPGYDVFEYNSVLNGLIENECFRGGVEVLGKMVSGSVRWDSVTYVNAFGLSASLKDLKLGLQVHSQMLKSDIEPDVFINSAMISMYGKCGKFSNAKKVFEGLETRNVVLWTAMVAACFQNEYFEEALNLFCGMEYEAIRPNEFTFAVMLNSAAGLSALRHGDLLHAHIEKSGFKEHLIVGNALINMYAKGGNIEAANKVFSDMRYRDIITWNAMICGYSHHGLGREALTLFQNMLAAEERPNHVTFVGVLSACGHLGLVQEGFYYLNHLMKQIGIVPGLEHYTCIVGLLSKAGLLDEAEKFMRSTPVKWDVVAWHTLLNASRVHQNYGFGRRIAEYILHMDPNDVGTYILLSNMYAKEKRWDGVSKIRKLMKVRKV*******WTEIRNTTHVFI***********IYEKVRELSAKIKPLGYVPDVAAVLHDVEDEQKEDYLNHHSEKLAIAYALMETPPTAPILVIKNLRMCDDCHSAVKLISKLTKRDIIVRDTNRFHRFQDGCCSCTDY*
**ARKPPTSPQAATRCAPFLFKQNRAPPSVEDTLKLLKHSADSKDLKLGKVIHAHLIITTESSRNENVVLTNSLVNLYAKCNQISIARQLFDNMRQRNVVSYSSLMTWYLHNGFLLETLKLFKNMVSGDNLEPNEYIFSIVLSSCSRSGRGAEGRQCHGYVFKSGLVFCKYVRNALVELYTKCLDVEMAKRLLDLLPGYDVFEYNSVLNGLIENECFRGGVEVLGKMVSGSVRWDSVTYVNAFGLSASLKDLKLGLQVHSQMLKSDIEPDVFINSAMISMYGKCGKFSNAKKVFEGLETRNVVLWTAMVAACFQNEYFEEALNLFCGMEYEAIRPNEFTFAVMLNSAAGLSALRHGDLLHAHIEKSGFKEHLIVGNALINMYAKGGNIEAANKVFSDMRYRDIITWNAMICGYSHHGLGREALTLFQNMLAAEERPNHVTFVGVLSACGHLGLVQEGFYYLNHLMKQIGIVPGLEHYTCIVGLLSKAGLLDEAEKFMRSTPVKWDVVAWHTLLNASRVHQNYGFGRRIAEYILHMDPNDVGTYILLSNMYAKEKRWDGVSKIRKLMKVRKVKKEPGSSWTEIRNTTHVFISGDSNHPESSQIYEKVRELSAKIKPLGYVPDVAAVLHDVEDEQKEDYLNHHSEKLAIAYALMETPPTAPILVIKNLRMCDDCHSAVKLISKLTKRDIIVRDTNRFHRFQDGCCSCTDYW
*************TRCAPFLFKQNRAPPSVEDTLKLLKHSADSKDLKLGKVIHAHLIITTESSRNENVVLTNSLVNLYAKCNQISIARQLFDNMRQRNVVSYSSLMTWYLHNGFLLETLKLFKNMVSGDNLEPNEYIFSIVLSSC*********RQCHGYVFKSGLVFCKYVRNALVELYTKCLDVEMAKRLLDLLPGYDVFEYNSVLNGLIENECFRGGVEVLGKMVSGSVRWDSVTYVNAFGLSASLKDLKLGLQVHSQMLKSDIEPDVFINSAMISMYGKCGKFSNAKKVFEGLETRNVVLWTAMVAACFQNEYFEEALNLFCGMEYEAIRPNEFTFAVMLNSAAGLSALRHGDLLHAHIEKSGFKEHLIVGNALINMYAKGGNIEAANKVFSDMRYRDIITWNAMICGYSHHGLGREALTLFQNMLAAEERPNHVTFVGVLSACGHLGLVQEGFYYLNHLMKQIGIVPGLEHYTCIVGLLSKAGLLDEAEKFMRSTPVKWDVVAWHTLLNASRVHQNYGFGRRIAEYILHMDPNDVGTYILLSNMYAKEKRWDGVSKIRKLMK***********WTEIRNTTHVFISGDSNHPESSQIYEKVRELSAKIKPLGYVPDVAAVLHDVEDEQKEDYLNHHSEKLAIAYALMETPPTAPILVIKNLRMCDDCHSAVKLISKLTKRDIIVRDTNRFHRFQDGCCSCTDYW
MPARKPPTSPQAATRCAPFLFKQNRAPPSVEDTLKLLKHSADSKDLKLGKVIHAHLIITTESSRNENVVLTNSLVNLYAKCNQISIARQLFDNMRQRNVVSYSSLMTWYLHNGFLLETLKLFKNMVSGDNLEPNEYIFSIVLSSCSRSGRGAEGRQCHGYVFKSGLVFCKYVRNALVELYTKCLDVEMAKRLLDLLPGYDVFEYNSVLNGLIENECFRGGVEVLGKMVSGSVRWDSVTYVNAFGLSASLKDLKLGLQVHSQMLKSDIEPDVFINSAMISMYGKCGKFSNAKKVFEGLETRNVVLWTAMVAACFQNEYFEEALNLFCGMEYEAIRPNEFTFAVMLNSAAGLSALRHGDLLHAHIEKSGFKEHLIVGNALINMYAKGGNIEAANKVFSDMRYRDIITWNAMICGYSHHGLGREALTLFQNMLAAEERPNHVTFVGVLSACGHLGLVQEGFYYLNHLMKQIGIVPGLEHYTCIVGLLSKAGLLDEAEKFMRSTPVKWDVVAWHTLLNASRVHQNYGFGRRIAEYILHMDPNDVGTYILLSNMYAKEKRWDGVSKIRKLMKVRKVKKEPGSSWTEIRNTTHVFISGDSNHPESSQIYEKVRELSAKIKPLGYVPDVAAVLHDVEDEQKEDYLNHHSEKLAIAYALMETPPTAPILVIKNLRMCDDCHSAVKLISKLTKRDIIVRDTNRFHRFQDGCCSCTDYW
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPARKPPTSPQAATRCAPFLFKQNRAPPSVEDTLKLLKHSADSKDLKLGKVIHAHLIITTESSRNENVVLTNSLVNLYAKCNQISIARQLFDNMRQRNVVSYSSLMTWYLHNGFLLETLKLFKNMVSGDNLEPNEYIFSIVLSSCSRSGRGAEGRQCHGYVFKSGLVFCKYVRNALVELYTKCLDVEMAKRLLDLLPGYDVFEYNSVLNGLIENECFRGGVEVLGKMVSGSVRWDSVTYVNAFGLSASLKDLKLGLQVHSQMLKSDIEPDVFINSAMISMYGKCGKFSNAKKVFEGLETRNVVLWTAMVAACFQNEYFEEALNLFCGMEYEAIRPNEFTFAVMLNSAAGLSALRHGDLLHAHIEKSGFKEHLIVGNALINMYAKGGNIEAANKVFSDMRYRDIITWNAMICGYSHHGLGREALTLFQNMLAAEERPNHVTFVGVLSACGHLGLVQEGFYYLNHLMKQIGIVPGLEHYTCIVGLLSKAGLLDEAEKFMRSTPVKWDVVAWHTLLNASRVHQNYGFGRRIAEYILHMDPNDVGTYILLSNMYAKEKRWDGVSKIRKLMKVRKVKKEPGSSWTEIRNTTHVFISGDSNHPESSQIYEKVRELSAKIKPLGYVPDVAAVLHDVEDEQKEDYLNHHSEKLAIAYALMETPPTAPILVIKNLRMCDDCHSAVKLISKLTKRDIIVRDTNRFHRFQDGCCSCTDYW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query709 2.2.26 [Sep-21-2011]
Q9FK93710 Pentatricopeptide repeat- yes no 0.980 0.978 0.517 0.0
Q9SVP71064 Pentatricopeptide repeat- no no 0.937 0.625 0.380 1e-140
Q9ZUW3868 Pentatricopeptide repeat- no no 0.921 0.752 0.391 1e-140
Q9SHZ8786 Pentatricopeptide repeat- no no 0.898 0.810 0.370 1e-134
Q9SMZ2990 Pentatricopeptide repeat- no no 0.943 0.675 0.361 1e-134
Q9FIB2995 Putative pentatricopeptid no no 0.929 0.662 0.373 1e-133
Q3E6Q1809 Pentatricopeptide repeat- no no 0.954 0.836 0.368 1e-131
Q9SY02781 Pentatricopeptide repeat- no no 0.875 0.795 0.388 1e-129
Q9LTV8694 Pentatricopeptide repeat- no no 0.921 0.940 0.344 1e-127
Q9S7F4825 Putative pentatricopeptid no no 0.908 0.780 0.348 1e-127
>sp|Q9FK93|PP406_ARATH Pentatricopeptide repeat-containing protein At5g39680 OS=Arabidopsis thaliana GN=EMB2744 PE=2 SV=1 Back     alignment and function desciption
 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/695 (51%), Positives = 496/695 (71%)

Query: 15  RCAPFLFKQNRAPPSVEDTLKLLKHSADSKDLKLGKVIHAHLIITTESSRNENVVLTNSL 74
           + A  + K  + P  ++   +LLK  A+S  L++G+ IHAHLI+T +SSR E+    NSL
Sbjct: 16  KLASLVPKSKKTPFPIDRLNELLKVCANSSYLRIGESIHAHLIVTNQSSRAEDAYQINSL 75

Query: 75  VNLYAKCNQISIARQLFDNMRQRNVVSYSSLMTWYLHNGFLLETLKLFKNMVSGDNLEPN 134
           +NLY KC +   AR+LFD M +RNVVS+ ++M  Y ++GF  E LKLFK+M       PN
Sbjct: 76  INLYVKCRETVRARKLFDLMPERNVVSWCAMMKGYQNSGFDFEVLKLFKSMFFSGESRPN 135

Query: 135 EYIFSIVLSSCSRSGRGAEGRQCHGYVFKSGLVFCKYVRNALVELYTKCLDVEMAKRLLD 194
           E++ ++V  SCS SGR  EG+Q HG   K GL+  ++VRN LV +Y+ C     A R+LD
Sbjct: 136 EFVATVVFKSCSNSGRIEEGKQFHGCFLKYGLISHEFVRNTLVYMYSLCSGNGEAIRVLD 195

Query: 195 LLPGYDVFEYNSVLNGLIENECFRGGVEVLGKMVSGSVRWDSVTYVNAFGLSASLKDLKL 254
            LP  D+  ++S L+G +E   F+ G++VL K  +    W+++TY+++  L ++L+DL L
Sbjct: 196 DLPYCDLSVFSSALSGYLECGAFKEGLDVLRKTANEDFVWNNLTYLSSLRLFSNLRDLNL 255

Query: 255 GLQVHSQMLKSDIEPDVFINSAMISMYGKCGKFSNAKKVFEGLETRNVVLWTAMVAACFQ 314
            LQVHS+M++     +V    A+I+MYGKCGK   A++VF+    +N+ L T ++ A FQ
Sbjct: 256 ALQVHSRMVRFGFNAEVEACGALINMYGKCGKVLYAQRVFDDTHAQNIFLNTTIMDAYFQ 315

Query: 315 NEYFEEALNLFCGMEYEAIRPNEFTFAVMLNSAAGLSALRHGDLLHAHIEKSGFKEHLIV 374
           ++ FEEALNLF  M+ + + PNE+TFA++LNS A LS L+ GDLLH  + KSG++ H++V
Sbjct: 316 DKSFEEALNLFSKMDTKEVPPNEYTFAILLNSIAELSLLKQGDLLHGLVLKSGYRNHVMV 375

Query: 375 GNALINMYAKGGNIEAANKVFSDMRYRDIITWNAMICGYSHHGLGREALTLFQNMLAAEE 434
           GNAL+NMYAK G+IE A K FS M +RDI+TWN MI G SHHGLGREAL  F  M+   E
Sbjct: 376 GNALVNMYAKSGSIEDARKAFSGMTFRDIVTWNTMISGCSHHGLGREALEAFDRMIFTGE 435

Query: 435 RPNHVTFVGVLSACGHLGLVQEGFYYLNHLMKQIGIVPGLEHYTCIVGLLSKAGLLDEAE 494
            PN +TF+GVL AC H+G V++G +Y N LMK+  + P ++HYTCIVGLLSKAG+  +AE
Sbjct: 436 IPNRITFIGVLQACSHIGFVEQGLHYFNQLMKKFDVQPDIQHYTCIVGLLSKAGMFKDAE 495

Query: 495 KFMRSTPVKWDVVAWHTLLNASRVHQNYGFGRRIAEYILHMDPNDVGTYILLSNMYAKEK 554
            FMR+ P++WDVVAW TLLNA  V +NY  G+++AEY +   PND G Y+LLSN++AK +
Sbjct: 496 DFMRTAPIEWDVVAWRTLLNACYVRRNYRLGKKVAEYAIEKYPNDSGVYVLLSNIHAKSR 555

Query: 555 RWDGVSKIRKLMKVRKVKKEPGSSWTEIRNTTHVFISGDSNHPESSQIYEKVRELSAKIK 614
            W+GV+K+R LM  R VKKEPG SW  IRN THVF++ D+ HPE + IY KV+E+ +KIK
Sbjct: 556 EWEGVAKVRSLMNNRGVKKEPGVSWIGIRNQTHVFLAEDNQHPEITLIYAKVKEVMSKIK 615

Query: 615 PLGYVPDVAAVLHDVEDEQKEDYLNHHSEKLAIAYALMETPPTAPILVIKNLRMCDDCHS 674
           PLGY PDVA   HDV++EQ+ED L++HSEKLA+AY L++TP  +P+ V KN+R+CDDCHS
Sbjct: 616 PLGYSPDVAGAFHDVDEEQREDNLSYHSEKLAVAYGLIKTPEKSPLYVTKNVRICDDCHS 675

Query: 675 AVKLISKLTKRDIIVRDTNRFHRFQDGCCSCTDYW 709
           A+KLISK++KR I++RD+NRFH F DG CSC DYW
Sbjct: 676 AIKLISKISKRYIVIRDSNRFHHFLDGQCSCCDYW 710





Arabidopsis thaliana (taxid: 3702)
>sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protein At4g13650 OS=Arabidopsis thaliana GN=PCMP-H42 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZUW3|PP172_ARATH Pentatricopeptide repeat-containing protein At2g27610 OS=Arabidopsis thaliana GN=PCMP-H60 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHZ8|PP168_ARATH Pentatricopeptide repeat-containing protein At2g22070 OS=Arabidopsis thaliana GN=PCMP-H41 PE=3 SV=1 Back     alignment and function description
>sp|Q9SMZ2|PP347_ARATH Pentatricopeptide repeat-containing protein At4g33170 OS=Arabidopsis thaliana GN=PCMP-H53 PE=3 SV=1 Back     alignment and function description
>sp|Q9FIB2|PP373_ARATH Putative pentatricopeptide repeat-containing protein At5g09950 OS=Arabidopsis thaliana GN=PCMP-H35 PE=3 SV=1 Back     alignment and function description
>sp|Q3E6Q1|PPR32_ARATH Pentatricopeptide repeat-containing protein At1g11290 OS=Arabidopsis thaliana GN=PCMP-H40 PE=2 SV=1 Back     alignment and function description
>sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protein At4g02750 OS=Arabidopsis thaliana GN=PCMP-H24 PE=3 SV=1 Back     alignment and function description
>sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protein At3g12770 OS=Arabidopsis thaliana GN=PCMP-H43 PE=2 SV=1 Back     alignment and function description
>sp|Q9S7F4|PP206_ARATH Putative pentatricopeptide repeat-containing protein At2g01510 OS=Arabidopsis thaliana GN=PCMP-H36 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query709
224141409707 predicted protein [Populus trichocarpa] 0.978 0.981 0.659 0.0
225442928703 PREDICTED: pentatricopeptide repeat-cont 0.990 0.998 0.652 0.0
356550971703 PREDICTED: pentatricopeptide repeat-cont 0.963 0.971 0.618 0.0
356529924694 PREDICTED: pentatricopeptide repeat-cont 0.967 0.988 0.625 0.0
449445401697 PREDICTED: pentatricopeptide repeat-cont 0.976 0.992 0.607 0.0
357501931700 Pentatricopeptide repeat protein [Medica 0.942 0.954 0.606 0.0
297801640710 EMB2744 [Arabidopsis lyrata subsp. lyrat 0.952 0.950 0.530 0.0
15242443710 pentatricopeptide repeat-containing prot 0.980 0.978 0.517 0.0
413946615682 putative pentatricopeptide repeat family 0.926 0.963 0.493 0.0
357128440682 PREDICTED: pentatricopeptide repeat-cont 0.926 0.963 0.505 0.0
>gi|224141409|ref|XP_002324065.1| predicted protein [Populus trichocarpa] gi|222867067|gb|EEF04198.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  966 bits (2498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/696 (65%), Positives = 558/696 (80%), Gaps = 2/696 (0%)

Query: 15  RCAPFLFKQNRAPPSVE-DTLKLLKHSADSKDLKLGKVIHAHLIITTESSRNENVVLTNS 73
           R APFL + N   PS   D +KLLK SAD+K+LK+GK IH+HLI+T+ ++ N +++  NS
Sbjct: 13  RHAPFLLRPNAVSPSSPLDLIKLLKLSADTKNLKVGKTIHSHLIVTSRATEN-SIIEVNS 71

Query: 74  LVNLYAKCNQISIARQLFDNMRQRNVVSYSSLMTWYLHNGFLLETLKLFKNMVSGDNLEP 133
           L+N YAK NQ+SIA  LFD M +RNVVS+S+LMT YL NGF L+ ++L K+M+S  N+ P
Sbjct: 72  LINFYAKVNQVSIAHNLFDRMPERNVVSWSALMTGYLLNGFSLKVIRLLKDMISEGNVSP 131

Query: 134 NEYIFSIVLSSCSRSGRGAEGRQCHGYVFKSGLVFCKYVRNALVELYTKCLDVEMAKRLL 193
           NEYI +I +SSC   GR  EGRQCHG + K+G  F  YVRNALV +Y+KC  V+ A  + 
Sbjct: 132 NEYILAIAISSCCDRGRVEEGRQCHGLLLKTGFSFHNYVRNALVSMYSKCSIVQDAMGVW 191

Query: 194 DLLPGYDVFEYNSVLNGLIENECFRGGVEVLGKMVSGSVRWDSVTYVNAFGLSASLKDLK 253
           + +P  D+  YNS+L+ L+EN   R G+EVL  MVS SV+WD VT+VNAF L ASLKDL+
Sbjct: 192 NEVPVNDIVAYNSILSSLVENGYLREGLEVLRSMVSESVKWDKVTFVNAFSLCASLKDLR 251

Query: 254 LGLQVHSQMLKSDIEPDVFINSAMISMYGKCGKFSNAKKVFEGLETRNVVLWTAMVAACF 313
           LGL VH +ML SD+E D +++SA+I+MYGKCGK   A+ VF+GL++RNVVLWTA++A+CF
Sbjct: 252 LGLHVHGKMLTSDVECDAYVSSAIINMYGKCGKSLMARGVFDGLQSRNVVLWTAVMASCF 311

Query: 314 QNEYFEEALNLFCGMEYEAIRPNEFTFAVMLNSAAGLSALRHGDLLHAHIEKSGFKEHLI 373
           QN  FEEALNLF  ME E ++ NEFT+AV+LN+ AGLSA R+G LLH H EKSGFK H++
Sbjct: 312 QNGCFEEALNLFSKMEQENVKSNEFTYAVLLNACAGLSARRNGSLLHGHSEKSGFKHHVM 371

Query: 374 VGNALINMYAKGGNIEAANKVFSDMRYRDIITWNAMICGYSHHGLGREALTLFQNMLAAE 433
           VGNALINMYAK G+IEAA KVFSDM +RDIITWNAMICG+SHHGLG++AL +FQ+MLAAE
Sbjct: 372 VGNALINMYAKSGDIEAAKKVFSDMMHRDIITWNAMICGFSHHGLGKKALLVFQDMLAAE 431

Query: 434 ERPNHVTFVGVLSACGHLGLVQEGFYYLNHLMKQIGIVPGLEHYTCIVGLLSKAGLLDEA 493
           E PN+VTF GVLSACGHLGLVQEGFYYL+HLMKQ G+ PGLEHYTCIV LLSK G L+EA
Sbjct: 432 EHPNYVTFTGVLSACGHLGLVQEGFYYLHHLMKQFGVQPGLEHYTCIVSLLSKTGQLNEA 491

Query: 494 EKFMRSTPVKWDVVAWHTLLNASRVHQNYGFGRRIAEYILHMDPNDVGTYILLSNMYAKE 553
             FMR+ PVKWDVVAW TLLNA  VHQNYG GR +AE++L MDPNDVGTY LLSN+YAKE
Sbjct: 492 RNFMRTAPVKWDVVAWRTLLNACHVHQNYGLGRWVAEFVLEMDPNDVGTYTLLSNIYAKE 551

Query: 554 KRWDGVSKIRKLMKVRKVKKEPGSSWTEIRNTTHVFISGDSNHPESSQIYEKVRELSAKI 613
           KRWDGV K+RKLM+ +K+KKEPG SW EI N TH+F S D+ HP+  Q Y+KV+EL A I
Sbjct: 552 KRWDGVVKVRKLMRDKKIKKEPGVSWIEIGNVTHIFTSEDNKHPDYGQTYQKVKELLAMI 611

Query: 614 KPLGYVPDVAAVLHDVEDEQKEDYLNHHSEKLAIAYALMETPPTAPILVIKNLRMCDDCH 673
           KPLGY PD+ AVLHDVEDEQKE YL++HSEKLAIAY L++ P  A ILVIKNLR+CDDCH
Sbjct: 612 KPLGYTPDIGAVLHDVEDEQKEYYLSYHSEKLAIAYGLLKLPSEASILVIKNLRICDDCH 671

Query: 674 SAVKLISKLTKRDIIVRDTNRFHRFQDGCCSCTDYW 709
           SAV+LISK+T R I+VRD NRFH F+DG CSC DYW
Sbjct: 672 SAVRLISKVTNRVIVVRDANRFHHFRDGRCSCLDYW 707




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225442928|ref|XP_002265258.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356550971|ref|XP_003543853.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680-like [Glycine max] Back     alignment and taxonomy information
>gi|356529924|ref|XP_003533536.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680-like [Glycine max] Back     alignment and taxonomy information
>gi|449445401|ref|XP_004140461.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357501931|ref|XP_003621254.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355496269|gb|AES77472.1| Pentatricopeptide repeat protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297801640|ref|XP_002868704.1| EMB2744 [Arabidopsis lyrata subsp. lyrata] gi|297314540|gb|EFH44963.1| EMB2744 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15242443|ref|NP_198784.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75171206|sp|Q9FK93.1|PP406_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g39680; AltName: Full=Protein EMBRYO DEFECTIVE 2744 gi|9758344|dbj|BAB08900.1| selenium-binding protein-like [Arabidopsis thaliana] gi|332007080|gb|AED94463.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|413946615|gb|AFW79264.1| putative pentatricopeptide repeat family protein [Zea mays] Back     alignment and taxonomy information
>gi|357128440|ref|XP_003565881.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query709
TAIR|locus:2164880710 EMB2744 "EMBRYO DEFECTIVE 2744 0.980 0.978 0.517 3.2e-200
TAIR|locus:21194401064 AT4G13650 [Arabidopsis thalian 0.937 0.625 0.382 9.3e-130
TAIR|locus:2038603868 AT2G27610 "AT2G27610" [Arabido 0.923 0.754 0.393 1.1e-128
TAIR|locus:2178188995 MEF7 "AT5G09950" [Arabidopsis 0.937 0.668 0.378 1.8e-126
TAIR|locus:2125899990 AT4G33170 [Arabidopsis thalian 0.947 0.678 0.363 6.3e-124
TAIR|locus:2202074809 CRR22 "CHLORORESPIRATORY REDUC 0.954 0.836 0.368 3.6e-121
TAIR|locus:2082886850 EMB2261 "embryo defective 2261 0.942 0.785 0.356 4.7e-119
TAIR|locus:2096414882 AT3G03580 [Arabidopsis thalian 0.928 0.746 0.358 4.9e-117
TAIR|locus:2140235781 AT4G02750 [Arabidopsis thalian 0.891 0.809 0.375 6.2e-117
TAIR|locus:2078653825 AT3G02010 [Arabidopsis thalian 0.925 0.795 0.344 1.2e-115
TAIR|locus:2164880 EMB2744 "EMBRYO DEFECTIVE 2744" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1938 (687.3 bits), Expect = 3.2e-200, P = 3.2e-200
 Identities = 360/695 (51%), Positives = 496/695 (71%)

Query:    15 RCAPFLFKQNRAPPSVEDTLKLLKHSADSKDLKLGKVIHAHLIITTESSRNENVVLTNSL 74
             + A  + K  + P  ++   +LLK  A+S  L++G+ IHAHLI+T +SSR E+    NSL
Sbjct:    16 KLASLVPKSKKTPFPIDRLNELLKVCANSSYLRIGESIHAHLIVTNQSSRAEDAYQINSL 75

Query:    75 VNLYAKCNQISIARQLFDNMRQRNVVSYSSLMTWYLHNGFLLETLKLFKNMVSGDNLEPN 134
             +NLY KC +   AR+LFD M +RNVVS+ ++M  Y ++GF  E LKLFK+M       PN
Sbjct:    76 INLYVKCRETVRARKLFDLMPERNVVSWCAMMKGYQNSGFDFEVLKLFKSMFFSGESRPN 135

Query:   135 EYIFSIVLSSCSRSGRGAEGRQCHGYVFKSGLVFCKYVRNALVELYTKCLDVEMAKRLLD 194
             E++ ++V  SCS SGR  EG+Q HG   K GL+  ++VRN LV +Y+ C     A R+LD
Sbjct:   136 EFVATVVFKSCSNSGRIEEGKQFHGCFLKYGLISHEFVRNTLVYMYSLCSGNGEAIRVLD 195

Query:   195 LLPGYDVFEYNSVLNGLIENECFRGGVEVLGKMVSGSVRWDSVTYVNAFGLSASLKDLKL 254
              LP  D+  ++S L+G +E   F+ G++VL K  +    W+++TY+++  L ++L+DL L
Sbjct:   196 DLPYCDLSVFSSALSGYLECGAFKEGLDVLRKTANEDFVWNNLTYLSSLRLFSNLRDLNL 255

Query:   255 GLQVHSQMLKSDIEPDVFINSAMISMYGKCGKFSNAKKVFEGLETRNVVLWTAMVAACFQ 314
              LQVHS+M++     +V    A+I+MYGKCGK   A++VF+    +N+ L T ++ A FQ
Sbjct:   256 ALQVHSRMVRFGFNAEVEACGALINMYGKCGKVLYAQRVFDDTHAQNIFLNTTIMDAYFQ 315

Query:   315 NEYFEEALNLFCGMEYEAIRPNEFTFAVMLNSAAGLSALRHGDLLHAHIEKSGFKEHLIV 374
             ++ FEEALNLF  M+ + + PNE+TFA++LNS A LS L+ GDLLH  + KSG++ H++V
Sbjct:   316 DKSFEEALNLFSKMDTKEVPPNEYTFAILLNSIAELSLLKQGDLLHGLVLKSGYRNHVMV 375

Query:   375 GNALINMYAKGGNIEAANKVFSDMRYRDIITWNAMICGYSHHGLGREALTLFQNMLAAEE 434
             GNAL+NMYAK G+IE A K FS M +RDI+TWN MI G SHHGLGREAL  F  M+   E
Sbjct:   376 GNALVNMYAKSGSIEDARKAFSGMTFRDIVTWNTMISGCSHHGLGREALEAFDRMIFTGE 435

Query:   435 RPNHVTFVGVLSACGHLGLVQEGFYYLNHLMKQIGIVPGLEHYTCIVGLLSKAGLLDEAE 494
              PN +TF+GVL AC H+G V++G +Y N LMK+  + P ++HYTCIVGLLSKAG+  +AE
Sbjct:   436 IPNRITFIGVLQACSHIGFVEQGLHYFNQLMKKFDVQPDIQHYTCIVGLLSKAGMFKDAE 495

Query:   495 KFMRSTPVKWDVVAWHTLLNASRVHQNYGFGRRIAEYILHMDPNDVGTYILLSNMYAKEK 554
              FMR+ P++WDVVAW TLLNA  V +NY  G+++AEY +   PND G Y+LLSN++AK +
Sbjct:   496 DFMRTAPIEWDVVAWRTLLNACYVRRNYRLGKKVAEYAIEKYPNDSGVYVLLSNIHAKSR 555

Query:   555 RWDGVSKIRKLMKVRKVKKEPGSSWTEIRNTTHVFISGDSNHPESSQIYEKVRELSAKIK 614
              W+GV+K+R LM  R VKKEPG SW  IRN THVF++ D+ HPE + IY KV+E+ +KIK
Sbjct:   556 EWEGVAKVRSLMNNRGVKKEPGVSWIGIRNQTHVFLAEDNQHPEITLIYAKVKEVMSKIK 615

Query:   615 PLGYVPDVAAVLHDVEDEQKEDYLNHHSEKLAIAYALMETPPTAPILVIKNLRMCDDCHS 674
             PLGY PDVA   HDV++EQ+ED L++HSEKLA+AY L++TP  +P+ V KN+R+CDDCHS
Sbjct:   616 PLGYSPDVAGAFHDVDEEQREDNLSYHSEKLAVAYGLIKTPEKSPLYVTKNVRICDDCHS 675

Query:   675 AVKLISKLTKRDIIVRDTNRFHRFQDGCCSCTDYW 709
             A+KLISK++KR I++RD+NRFH F DG CSC DYW
Sbjct:   676 AIKLISKISKRYIVIRDSNRFHHFLDGQCSCCDYW 710




GO:0005739 "mitochondrion" evidence=ISM
GO:0009793 "embryo development ending in seed dormancy" evidence=NAS
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
TAIR|locus:2119440 AT4G13650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038603 AT2G27610 "AT2G27610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178188 MEF7 "AT5G09950" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125899 AT4G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202074 CRR22 "CHLORORESPIRATORY REDUCTION22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082886 EMB2261 "embryo defective 2261" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096414 AT3G03580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140235 AT4G02750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078653 AT3G02010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FK93PP406_ARATHNo assigned EC number0.51790.98020.9788yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.XVII.1149.1
hypothetical protein (679 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query709
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-153
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-152
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-66
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-49
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-44
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-38
pfam14432116 pfam14432, DYW_deaminase, DYW family of nucleic ac 4e-28
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-18
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-11
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 6e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-04
pfam0153531 pfam01535, PPR, PPR repeat 3e-04
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  466 bits (1201), Expect = e-153
 Identities = 225/664 (33%), Positives = 369/664 (55%), Gaps = 9/664 (1%)

Query: 45  DLKLGKVIHAHLIITTESSRNENVVLTNSLVNLYAKCNQISIARQLFDNMRQRNVVSYSS 104
           DL  G+ +HAH++         +V + N+L+ +Y KC  +  AR +FD M +R+ +S+++
Sbjct: 202 DLARGREVHAHVV---RFGFELDVDVVNALITMYVKCGDVVSARLVFDRMPRRDCISWNA 258

Query: 105 LMTWYLHNGFLLETLKLFKNMVSGDNLEPNEYIFSIVLSSCSRSGRGAEGRQCHGYVFKS 164
           +++ Y  NG  LE L+LF  M    +++P+    + V+S+C   G    GR+ HGYV K+
Sbjct: 259 MISGYFENGECLEGLELFFTMR-ELSVDPDLMTITSVISACELLGDERLGREMHGYVVKT 317

Query: 165 GLVFCKYVRNALVELYTKCLDVEMAKRLLDLLPGYDVFEYNSVLNGLIENECFRGGVEVL 224
           G      V N+L+++Y        A+++   +   D   + ++++G  +N      +E  
Sbjct: 318 GFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMISGYEKNGLPDKALETY 377

Query: 225 GKMVSGSVRWDSVTYVNAFGLSASLKDLKLGLQVHSQMLKSDIEPDVFINSAMISMYGKC 284
             M   +V  D +T  +     A L DL +G+++H    +  +   V + +A+I MY KC
Sbjct: 378 ALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKC 437

Query: 285 GKFSNAKKVFEGLETRNVVLWTAMVAA-CFQNEYFEEALNLFCGMEYEAIRPNEFTFAVM 343
                A +VF  +  ++V+ WT+++A     N  FE AL  F  M    ++PN  T    
Sbjct: 438 KCIDKALEVFHNIPEKDVISWTSIIAGLRLNNRCFE-ALIFFRQMLLT-LKPNSVTLIAA 495

Query: 344 LNSAAGLSALRHGDLLHAHIEKSGFKEHLIVGNALINMYAKGGNIEAANKVFSDMRYRDI 403
           L++ A + AL  G  +HAH+ ++G      + NAL+++Y + G +  A   F+    +D+
Sbjct: 496 LSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQFNSHE-KDV 554

Query: 404 ITWNAMICGYSHHGLGREALTLFQNMLAAEERPNHVTFVGVLSACGHLGLVQEGFYYLNH 463
           ++WN ++ GY  HG G  A+ LF  M+ +   P+ VTF+ +L AC   G+V +G  Y + 
Sbjct: 555 VSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHS 614

Query: 464 LMKQIGIVPGLEHYTCIVGLLSKAGLLDEAEKFMRSTPVKWDVVAWHTLLNASRVHQNYG 523
           + ++  I P L+HY C+V LL +AG L EA  F+   P+  D   W  LLNA R+H++  
Sbjct: 615 MEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAVWGALLNACRIHRHVE 674

Query: 524 FGRRIAEYILHMDPNDVGTYILLSNMYAKEKRWDGVSKIRKLMKVRKVKKEPGSSWTEIR 583
            G   A++I  +DPN VG YILL N+YA   +WD V+++RK M+   +  +PG SW E++
Sbjct: 675 LGELAAQHIFELDPNSVGYYILLCNLYADAGKWDEVARVRKTMRENGLTVDPGCSWVEVK 734

Query: 584 NTTHVFISGDSNHPESSQIYEKVRELSAKIKPLGYVPDVAAVLHDVEDEQKEDYLNHHSE 643
              H F++ D +HP+  +I   +     K+K  G     ++ + ++E   K+D    HSE
Sbjct: 735 GKVHAFLTDDESHPQIKEINTVLEGFYEKMKASGLAGSESSSMDEIE-VSKDDIFCGHSE 793

Query: 644 KLAIAYALMETPPTAPILVIKNLRMCDDCHSAVKLISKLTKRDIIVRDTNRFHRFQDGCC 703
           +LAIA+ L+ T P  PI V KNL MC++CH+ VK ISK+ +R+I VRDT +FH F+DG C
Sbjct: 794 RLAIAFGLINTVPGMPIWVTKNLYMCENCHNTVKFISKIVRREISVRDTEQFHHFKDGEC 853

Query: 704 SCTD 707
           SC D
Sbjct: 854 SCGD 857


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|222749 pfam14432, DYW_deaminase, DYW family of nucleic acid deaminases Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 709
PLN03077857 Protein ECB2; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PF14432116 DYW_deaminase: DYW family of nucleic acid deaminas 99.98
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.93
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.93
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.89
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.89
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.86
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.85
PRK11788389 tetratricopeptide repeat protein; Provisional 99.83
PRK11788389 tetratricopeptide repeat protein; Provisional 99.83
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.82
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.78
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.78
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.78
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.77
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.76
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.75
PRK14574 822 hmsH outer membrane protein; Provisional 99.74
PRK14574 822 hmsH outer membrane protein; Provisional 99.71
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.71
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.67
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.65
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.59
KOG2003840 consensus TPR repeat-containing protein [General f 99.57
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.54
KOG2076895 consensus RNA polymerase III transcription factor 99.54
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.52
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.48
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.42
KOG2076 895 consensus RNA polymerase III transcription factor 99.41
KOG1915677 consensus Cell cycle control protein (crooked neck 99.4
KOG0547606 consensus Translocase of outer mitochondrial membr 99.38
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.38
KOG1126638 consensus DNA-binding cell division cycle control 99.37
KOG2003840 consensus TPR repeat-containing protein [General f 99.36
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.36
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.36
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.35
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.34
KOG1126638 consensus DNA-binding cell division cycle control 99.34
KOG1915677 consensus Cell cycle control protein (crooked neck 99.33
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.31
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.31
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.3
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.3
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.29
PF1304150 PPR_2: PPR repeat family 99.28
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.24
PF1304150 PPR_2: PPR repeat family 99.23
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.22
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.19
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.18
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.18
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.16
KOG2376652 consensus Signal recognition particle, subunit Srp 99.15
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.13
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.11
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.06
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.03
PRK12370553 invasion protein regulator; Provisional 99.03
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.02
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.01
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.97
PRK11189296 lipoprotein NlpI; Provisional 98.93
PRK12370553 invasion protein regulator; Provisional 98.92
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.91
KOG0547606 consensus Translocase of outer mitochondrial membr 98.9
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.9
KOG1129478 consensus TPR repeat-containing protein [General f 98.89
KOG2376652 consensus Signal recognition particle, subunit Srp 98.88
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.86
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.86
PRK11189296 lipoprotein NlpI; Provisional 98.84
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.81
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 98.79
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 98.78
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.77
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.77
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.74
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.72
KOG1129478 consensus TPR repeat-containing protein [General f 98.72
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.71
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.6
KOG1125579 consensus TPR repeat-containing protein [General f 98.58
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.57
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.57
PRK04841903 transcriptional regulator MalT; Provisional 98.55
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.55
PF1285434 PPR_1: PPR repeat 98.53
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.53
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.49
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.47
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.47
PRK04841903 transcriptional regulator MalT; Provisional 98.46
PF1285434 PPR_1: PPR repeat 98.45
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.45
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.43
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.41
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.38
KOG1128777 consensus Uncharacterized conserved protein, conta 98.35
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.34
KOG1125579 consensus TPR repeat-containing protein [General f 98.32
PRK10370198 formate-dependent nitrite reductase complex subuni 98.31
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.3
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.3
PLN02789320 farnesyltranstransferase 98.29
PRK15359144 type III secretion system chaperone protein SscB; 98.27
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.27
KOG1128777 consensus Uncharacterized conserved protein, conta 98.25
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.23
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.18
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.17
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.17
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.13
PRK15359144 type III secretion system chaperone protein SscB; 98.11
PRK10370198 formate-dependent nitrite reductase complex subuni 98.1
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.09
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.07
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.97
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.96
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.94
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.92
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.92
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.9
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.84
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.82
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.82
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.8
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.8
PLN02789320 farnesyltranstransferase 97.79
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.79
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.74
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.72
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.71
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.65
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.61
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.56
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.56
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.55
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.5
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.47
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.47
COG3898531 Uncharacterized membrane-bound protein [Function u 97.36
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.36
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.36
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.32
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.32
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.32
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.3
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.3
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.27
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.26
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.24
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.17
KOG0553304 consensus TPR repeat-containing protein [General f 97.16
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.14
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.13
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.1
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.1
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.02
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.0
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.97
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.95
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.95
KOG0553304 consensus TPR repeat-containing protein [General f 96.94
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.93
KOG20411189 consensus WD40 repeat protein [General function pr 96.92
PF1337173 TPR_9: Tetratricopeptide repeat 96.91
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.9
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.89
PRK15331165 chaperone protein SicA; Provisional 96.88
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 96.86
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.85
PF1343134 TPR_17: Tetratricopeptide repeat 96.82
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.81
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 96.79
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 96.77
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.72
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.67
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.66
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 96.64
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.6
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.6
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.6
PF12688120 TPR_5: Tetratrico peptide repeat 96.6
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.55
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.53
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.51
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.51
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.48
COG4700251 Uncharacterized protein conserved in bacteria cont 96.43
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.42
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.3
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 96.27
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.23
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.23
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.22
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.21
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.16
KOG20411189 consensus WD40 repeat protein [General function pr 96.11
PF12688120 TPR_5: Tetratrico peptide repeat 96.1
PF1342844 TPR_14: Tetratricopeptide repeat 95.95
KOG2796366 consensus Uncharacterized conserved protein [Funct 95.93
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 95.88
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.84
PRK10803263 tol-pal system protein YbgF; Provisional 95.84
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 95.7
PRK10803263 tol-pal system protein YbgF; Provisional 95.65
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.64
COG4700251 Uncharacterized protein conserved in bacteria cont 95.59
PF1337173 TPR_9: Tetratricopeptide repeat 95.55
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.34
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.16
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 94.88
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 94.85
KOG1941 518 consensus Acetylcholine receptor-associated protei 94.76
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 94.5
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.47
smart00299140 CLH Clathrin heavy chain repeat homology. 94.34
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 94.32
COG4235287 Cytochrome c biogenesis factor [Posttranslational 94.32
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 94.26
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 94.21
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 94.05
PF03704146 BTAD: Bacterial transcriptional activator domain; 93.93
COG3898531 Uncharacterized membrane-bound protein [Function u 93.89
smart00299140 CLH Clathrin heavy chain repeat homology. 93.88
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 93.86
KOG4555175 consensus TPR repeat-containing protein [Function 93.49
COG0457291 NrfG FOG: TPR repeat [General function prediction 93.46
KOG3941406 consensus Intermediate in Toll signal transduction 93.46
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.21
PF13281374 DUF4071: Domain of unknown function (DUF4071) 93.2
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 93.13
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 93.01
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.97
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 92.92
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 92.89
PRK11906458 transcriptional regulator; Provisional 92.84
KOG3941406 consensus Intermediate in Toll signal transduction 92.69
COG1729262 Uncharacterized protein conserved in bacteria [Fun 92.49
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 92.42
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 92.23
PRK11906458 transcriptional regulator; Provisional 92.22
COG3118304 Thioredoxin domain-containing protein [Posttransla 91.59
KOG2610491 consensus Uncharacterized conserved protein [Funct 91.35
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 91.15
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 90.88
COG1729262 Uncharacterized protein conserved in bacteria [Fun 90.04
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 90.03
PRK15331165 chaperone protein SicA; Provisional 89.9
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 89.39
PF13512142 TPR_18: Tetratricopeptide repeat 88.94
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 88.94
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 88.91
COG4105254 ComL DNA uptake lipoprotein [General function pred 88.88
KOG1585308 consensus Protein required for fusion of vesicles 88.83
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 88.46
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 88.37
PRK09687280 putative lyase; Provisional 87.87
KOG2610491 consensus Uncharacterized conserved protein [Funct 87.63
PF13512142 TPR_18: Tetratricopeptide repeat 87.53
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 87.41
COG3947361 Response regulator containing CheY-like receiver a 87.4
COG3629280 DnrI DNA-binding transcriptional activator of the 87.09
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 87.04
PF1342844 TPR_14: Tetratricopeptide repeat 86.88
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 86.86
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 86.76
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 86.6
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 86.43
KOG4555175 consensus TPR repeat-containing protein [Function 86.33
KOG4234271 consensus TPR repeat-containing protein [General f 86.28
COG3118304 Thioredoxin domain-containing protein [Posttransla 86.19
COG0457291 NrfG FOG: TPR repeat [General function prediction 85.82
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 85.82
KOG1258577 consensus mRNA processing protein [RNA processing 85.52
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 85.51
PF13170297 DUF4003: Protein of unknown function (DUF4003) 85.26
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 85.1
KOG1941518 consensus Acetylcholine receptor-associated protei 85.03
PF13170297 DUF4003: Protein of unknown function (DUF4003) 84.68
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 84.67
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 84.64
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 84.17
KOG4570418 consensus Uncharacterized conserved protein [Funct 83.55
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 83.45
COG3629280 DnrI DNA-binding transcriptional activator of the 82.97
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 82.25
COG4649221 Uncharacterized protein conserved in bacteria [Fun 82.24
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 82.14
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 82.04
KOG4570418 consensus Uncharacterized conserved protein [Funct 81.74
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 81.45
KOG4648 536 consensus Uncharacterized conserved protein, conta 81.05
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 80.72
KOG4648 536 consensus Uncharacterized conserved protein, conta 80.38
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.5e-135  Score=1173.15  Aligned_cols=691  Identities=33%  Similarity=0.600  Sum_probs=678.1

Q ss_pred             ChhHHhhhchHHhhhCCCCCCcchHHHHHHHhcCCCCchhHHHHHHHHHHhcCCCCCCchhHHHHHHHHHHccCChHHHH
Q 039873            9 SPQAATRCAPFLFKQNRAPPSVEDTLKLLKHSADSKDLKLGKVIHAHLIITTESSRNENVVLTNSLVNLYAKCNQISIAR   88 (709)
Q Consensus         9 ~p~~a~~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~~~~ll~~~~~~g~~~~A~   88 (709)
                      .+..|+..|.. |...|+.||..||+.++++|++.+++..+.++|..+.+.|+.   +|+.++|+||.+|+++|++++|+
T Consensus       167 ~~~~A~~~f~~-M~~~g~~Pd~~t~~~ll~~~~~~~~~~~~~~~~~~~~~~g~~---~~~~~~n~Li~~y~k~g~~~~A~  242 (857)
T PLN03077        167 YFDEALCLYHR-MLWAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFE---LDVDVVNALITMYVKCGDVVSAR  242 (857)
T ss_pred             CHHHHHHHHHH-HHHcCCCCChhHHHHHHHHhCCccchhhHHHHHHHHHHcCCC---cccchHhHHHHHHhcCCCHHHHH
Confidence            45677888865 445699999999999999999999999999999999999999   99999999999999999999999


Q ss_pred             HHHhcCCCCCcchHHHHHHHHHhCCChhHHHHHHHHhhhCCCCCCChhhHHHHHHHHhcCCCchHHHHHHHHHHHhCCCC
Q 039873           89 QLFDNMRQRNVVSYSSLMTWYLHNGFLLETLKLFKNMVSGDNLEPNEYIFSIVLSSCSRSGRGAEGRQCHGYVFKSGLVF  168 (709)
Q Consensus        89 ~~f~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~  168 (709)
                      ++|++|++||+++||+||.+|++.|++++|+++|++|. ..|+.||..||+.++.+|++.|+++.|+++|..+++.|+.|
T Consensus       243 ~lf~~m~~~d~~s~n~li~~~~~~g~~~eAl~lf~~M~-~~g~~Pd~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~  321 (857)
T PLN03077        243 LVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMR-ELSVDPDLMTITSVISACELLGDERLGREMHGYVVKTGFAV  321 (857)
T ss_pred             HHHhcCCCCCcchhHHHHHHHHhCCCHHHHHHHHHHHH-HcCCCCChhHHHHHHHHHHhcCChHHHHHHHHHHHHhCCcc
Confidence            99999999999999999999999999999999999999 89999999999999999999999999999999999999999


Q ss_pred             chhHHHHHHHHHHhcCChHHHHHHHhhCCCCCcccHHHHHHHHHhCCCccHHHHHHHHHHhCCCCCChhhHHHHHHHHhc
Q 039873          169 CKYVRNALVELYTKCLDVEMAKRLLDLLPGYDVFEYNSVLNGLIENECFRGGVEVLGKMVSGSVRWDSVTYVNAFGLSAS  248 (709)
Q Consensus       169 ~~~~~~~li~~y~~~g~~~~A~~~f~~~~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~~~~~  248 (709)
                      |..+||+||++|+++|++++|.++|++|..+|+++||+||.+|++.|++++|+++|++|.+.|+.||..||++++.+|++
T Consensus       322 d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~~s~n~li~~~~~~g~~~~A~~lf~~M~~~g~~Pd~~t~~~ll~a~~~  401 (857)
T PLN03077        322 DVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIASVLSACAC  401 (857)
T ss_pred             chHHHHHHHHHHHhcCCHHHHHHHHhhCCCCCeeeHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCCCceeHHHHHHHHhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcHHHHHHHHHHHHcCCCCchHHHHHHHHHHHhcCChHHHHHHHHhccCCCHhhHHHHHHHHHHcCCHhHHHHHHHHH
Q 039873          249 LKDLKLGLQVHSQMLKSDIEPDVFINSAMISMYGKCGKFSNAKKVFEGLETRNVVLWTAMVAACFQNEYFEEALNLFCGM  328 (709)
Q Consensus       249 ~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~y~~~g~~~~A~~~~~~m~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m  328 (709)
                      .|+++.|.++|+.+.+.|+.++..++|+||++|+++|++++|.++|++|.++|+++||+||.+|+++|+.++|+++|++|
T Consensus       402 ~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~vs~~~mi~~~~~~g~~~eA~~lf~~m  481 (857)
T PLN03077        402 LGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAGLRLNNRCFEALIFFRQM  481 (857)
T ss_pred             cchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHCCCHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhCCCCCCccchHHHHHHHhccCChhHHHHHHHHHHHhCCCCChhHHhHHHhHHHhcCCHHHHHHHHhhcCCCChhhHHH
Q 039873          329 EYEAIRPNEFTFAVMLNSAAGLSALRHGDLLHAHIEKSGFKEHLIVGNALINMYAKGGNIEAANKVFSDMRYRDIITWNA  408 (709)
Q Consensus       329 ~~~g~~pd~~t~~~ll~~~~~~~~~~~a~~i~~~~~~~g~~~~~~~~~~li~~y~~~g~~~~A~~~f~~~~~~~~~~~~~  408 (709)
                      .. ++.||..||+++|.+|++.|+++.++++|..+.+.|+.+|..++|+||++|+|+|++++|.++|+.+ .+|+++||+
T Consensus       482 ~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~~~~~~~naLi~~y~k~G~~~~A~~~f~~~-~~d~~s~n~  559 (857)
T PLN03077        482 LL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQFNSH-EKDVVSWNI  559 (857)
T ss_pred             Hh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCCCccceechHHHHHHHHcCCHHHHHHHHHhc-CCChhhHHH
Confidence            85 6999999999999999999999999999999999999999999999999999999999999999999 999999999


Q ss_pred             HHHHHHHcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHhccccHHHHHHHHHHHHHhhCCCCChHHHHHHHHHHHhcC
Q 039873          409 MICGYSHHGLGREALTLFQNMLAAEERPNHVTFVGVLSACGHLGLVQEGFYYLNHLMKQIGIVPGLEHYTCIVGLLSKAG  488 (709)
Q Consensus       409 li~~~~~~g~~~~A~~~~~~m~~~g~~pd~~t~~~ll~a~~~~g~~~~a~~~~~~~~~~~~~~p~~~~~~~li~~~~~~g  488 (709)
                      ||.+|+++|+.++|+++|++|.+.|+.||.+||+.+|.+|++.|++++|.++|+.|.+++|+.|+..+|++|+++|+++|
T Consensus       560 lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~lv~~l~r~G  639 (857)
T PLN03077        560 LLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAG  639 (857)
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHhhcChHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHhCC
Confidence            99999999999999999999999999999999999999999999999999999999877899999999999999999999


Q ss_pred             CHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCchHHHHHHHHHHhcCCCCchhHHHHHHHhhhcCCchhHHHHHHHHHh
Q 039873          489 LLDEAEKFMRSTPVKWDVVAWHTLLNASRVHQNYGFGRRIAEYILHMDPNDVGTYILLSNMYAKEKRWDGVSKIRKLMKV  568 (709)
Q Consensus       489 ~~~~A~~~~~~~~~~pd~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~  568 (709)
                      ++++|.+++++|+++||..+|++|+.+|+.+|+.+.|+.+.+++++++|+++..|+.|+++|+..|+|++|.++++.|++
T Consensus       640 ~~~eA~~~~~~m~~~pd~~~~~aLl~ac~~~~~~e~~e~~a~~l~~l~p~~~~~y~ll~n~ya~~g~~~~a~~vr~~M~~  719 (857)
T PLN03077        640 KLTEAYNFINKMPITPDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWDEVARVRKTMRE  719 (857)
T ss_pred             CHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHhhCCCCcchHHHHHHHHHHCCChHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCccCCceeEEEECCEEEEEEeCCCCCcCcHHHHHHHHHHHHHHhhCCcccCCccccccCchhhhhhhhcccCHHHHHH
Q 039873          569 RKVKKEPGSSWTEIRNTTHVFISGDSNHPESSQIYEKVRELSAKIKPLGYVPDVAAVLHDVEDEQKEDYLNHHSEKLAIA  648 (709)
Q Consensus       569 ~~~~~~~~~s~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~pd~~~~~~~~~~~~~~~~~~~~~~~la~~  648 (709)
                      +|++|+||+|||++++++|.|.+||.+||+.++||..++++..+|++.||.||+..++ ++++++|+..+++||||||+|
T Consensus       720 ~g~~k~~g~s~ie~~~~~~~f~~~d~~h~~~~~i~~~l~~l~~~~~~~g~~~~~~~~~-~~~~~~k~~~~~~hse~la~a  798 (857)
T PLN03077        720 NGLTVDPGCSWVEVKGKVHAFLTDDESHPQIKEINTVLEGFYEKMKASGLAGSESSSM-DEIEVSKDDIFCGHSERLAIA  798 (857)
T ss_pred             cCCCCCCCccEEEECCEEEEEecCCCCCcchHHHHHHHHHHHHHHHhCCcCCCcchhc-cccHHHHHHHHHhccHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999877 558889999999999999999


Q ss_pred             hccccCCCCCcEEEEeccccccchhHHHHHHhhhcCceEEEecCCcccccccccccCCC
Q 039873          649 YALMETPPTAPILVIKNLRMCDDCHSAVKLISKLTKRDIIVRDTNRFHRFQDGCCSCTD  707 (709)
Q Consensus       649 ~~~~~~~~~~~~~~~~~l~~~~~~h~~~~~~s~~~~~~i~~~d~~~~h~f~~g~csc~~  707 (709)
                      ||||+|+||.||||+||||||+|||+++||||++++|||||||.+|||||++|+|||+|
T Consensus       799 ~~l~~~~~~~~i~i~knlr~c~dch~~~k~~s~~~~r~i~~rd~~rfh~f~~g~csc~d  857 (857)
T PLN03077        799 FGLINTVPGMPIWVTKNLYMCENCHNTVKFISKIVRREISVRDTEQFHHFKDGECSCGD  857 (857)
T ss_pred             HhhhcCCCCCeEEEeCCCEeCccHHHHHHHHHHHhCeEEEEecCCcceeCCCCcccCCC
Confidence            99999999999999999999999999999999999999999999999999999999998



>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF14432 DYW_deaminase: DYW family of nucleic acid deaminases Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query709
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-11
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-06
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 3e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 66.0 bits (159), Expect = 3e-11
 Identities = 36/291 (12%), Positives = 85/291 (29%), Gaps = 11/291 (3%)

Query: 332 AIRPNEFTFAVMLNSAAGLSALRHGDLLHAHIEKSGFKEHLIVGNALINMYAKGGNIEAA 391
              P E   A +L  A G  +L           ++          A          +  A
Sbjct: 87  PESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLA 146

Query: 392 NKVFSDMRYR-------DIITWNAMICGYSHHGLGREALTLFQNMLAAEERPNHVTFVGV 444
           + +      +        +  +NA++ G++  G  +E + +   +  A   P+ +++   
Sbjct: 147 HHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAA 206

Query: 445 LSACGHLGLVQEGFYYLNHLMKQIGIVPGLEHYTCIVGLLSKAGLLDEAEKFMRSTPVKW 504
           L   G               M Q G+         ++    +A +L    K   +  +  
Sbjct: 207 LQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPP 266

Query: 505 DVVAWHTLLNASRVHQNYGFGRRIAEYILHMDPNDVGTYILLSNMYAKEKRWDGVSKIRK 564
            +      +N S++ ++         Y     P      +    ++ +      V  + K
Sbjct: 267 QL---PPPVNTSKLLRDVYAKDGRVSYPKLHLPLKTLQCLFEKQLHMELASRVCVVSVEK 323

Query: 565 LMKVRKVKKEPGSSWTEIRNTTHVFISGDSNHPESSQIYEKVRELSAKIKP 615
                K  K    +   +R+     +         +++  +V E    + P
Sbjct: 324 PTLPSKEVKHARKTLKTLRDQWEKALCRALRE-TKNRLEREVYEGRFSLYP 373


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query709
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.95
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.95
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.95
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.94
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.9
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.9
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.89
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.86
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.86
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.82
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.79
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.79
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.79
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.78
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.77
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.76
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.75
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.74
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.73
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.72
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.72
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.71
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.7
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.7
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.69
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.68
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.67
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.66
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.66
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.66
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.64
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.62
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.61
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.59
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.53
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.52
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.5
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.5
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.47
3u4t_A272 TPR repeat-containing protein; structural genomics 99.46
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.42
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.41
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.4
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.4
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.4
3u4t_A272 TPR repeat-containing protein; structural genomics 99.39
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.39
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.39
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.39
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.39
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.38
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.36
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.35
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.35
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.33
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.33
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.32
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.32
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.31
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.3
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.28
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.27
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.27
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.27
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.22
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.22
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.21
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.2
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.19
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.17
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.15
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.14
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.14
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.11
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.09
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.07
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.07
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.06
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.05
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.02
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.98
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.95
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.94
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.9
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.85
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.85
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.83
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.8
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.79
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.77
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.76
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.72
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.71
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.7
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.7
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.69
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.65
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.64
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.61
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.59
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.58
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.57
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.56
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.56
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.54
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.53
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.49
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.48
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.48
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.46
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.46
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.46
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.46
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.43
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.43
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.43
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.41
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.4
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.4
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.4
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.4
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.35
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.35
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.35
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.32
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.32
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.31
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.3
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.27
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.22
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.22
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.21
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.21
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.2
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.2
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.19
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.18
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.17
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.15
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.15
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.14
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.12
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.11
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.07
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.07
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.06
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.06
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.05
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.03
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.01
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.99
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.99
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.99
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.97
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.94
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.94
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.93
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.93
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.93
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.92
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.92
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.92
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.91
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.91
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.88
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 97.88
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.86
3k9i_A117 BH0479 protein; putative protein binding protein, 97.84
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.82
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.8
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.79
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.79
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.77
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.75
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.74
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.73
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.72
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.71
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.7
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.7
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.68
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.65
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.65
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.64
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.61
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.61
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.58
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.58
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.56
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.55
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.54
3k9i_A117 BH0479 protein; putative protein binding protein, 97.52
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.44
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.41
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.38
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.35
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.34
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.22
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.13
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.12
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.07
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.97
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.92
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.89
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.84
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.75
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 96.73
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.71
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.7
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.69
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.67
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.6
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.57
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.44
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.44
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.28
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.07
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.76
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.7
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 95.51
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.15
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.89
1pc2_A152 Mitochondria fission protein; unknown function; NM 94.52
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.26
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 94.18
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.91
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 92.41
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 91.83
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 91.34
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 91.1
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 90.72
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 90.65
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 89.02
2p58_C116 Putative type III secretion protein YSCG; type III 88.78
2uwj_G115 Type III export protein PSCG; virulence, chaperone 88.63
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 87.76
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 86.8
2qx5_A661 Nucleoporin NIC96; mRNA transport, nuclear pore co 86.04
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 85.5
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 85.47
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 84.76
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 84.58
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 82.67
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 82.37
2p58_C116 Putative type III secretion protein YSCG; type III 82.05
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 81.44
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 81.1
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 81.07
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 80.21
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 80.09
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=3e-42  Score=386.53  Aligned_cols=482  Identities=11%  Similarity=-0.023  Sum_probs=403.0

Q ss_pred             HHHHccCChHHHHHHHhcCCCCCcchHHHHHHHHHhCCChhHHHHHHHHhhhCCCCCCChhhHHHHHHHHhcCCCchHHH
Q 039873           76 NLYAKCNQISIARQLFDNMRQRNVVSYSSLMTWYLHNGFLLETLKLFKNMVSGDNLEPNEYIFSIVLSSCSRSGRGAEGR  155 (709)
Q Consensus        76 ~~~~~~g~~~~A~~~f~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~g~~p~~~t~~~ll~~~~~~~~~~~a~  155 (709)
                      ..+.+.|.+..++..|+.++.+++..|+.++..|.+.|++++|+.+|++|.   +..|+..++..+..+|...|+++.|.
T Consensus        61 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~---~~~p~~~~~~~l~~~~~~~g~~~~A~  137 (597)
T 2xpi_A           61 NNTSTDGSFLKERNAQNTDSLSREDYLRLWRHDALMQQQYKCAAFVGEKVL---DITGNPNDAFWLAQVYCCTGDYARAK  137 (597)
T ss_dssp             ---------------------CHHHHHHHHHHHHHHTTCHHHHHHHHHHHH---HHHCCHHHHHHHHHHHHHTTCHHHHH
T ss_pred             ccccccCccCCCCCccccchHHHHHHHHHHHHHHHHccCchHHHHHHHHHH---hhCCCchHHHHHHHHHHHcCcHHHHH
Confidence            345678889999999999999999999999999999999999999999997   25688899999999999999999999


Q ss_pred             HHHHHHHHhCCCCchhHHHHHHHHHHhcCChHHHHHHHhhCCCC-------------------CcccHHHHHHHHHhCCC
Q 039873          156 QCHGYVFKSGLVFCKYVRNALVELYTKCLDVEMAKRLLDLLPGY-------------------DVFEYNSVLNGLIENEC  216 (709)
Q Consensus       156 ~~~~~~~~~g~~~~~~~~~~li~~y~~~g~~~~A~~~f~~~~~~-------------------~~~~~~~li~~~~~~g~  216 (709)
                      .++..+...  .++..+++.++.+|.++|++++|.++|+++...                   ++.+|+.++.+|.+.|+
T Consensus       138 ~~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~  215 (597)
T 2xpi_A          138 CLLTKEDLY--NRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSN  215 (597)
T ss_dssp             HHHHHTCGG--GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTC
T ss_pred             HHHHHHhcc--ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCC
Confidence            999987654  678899999999999999999999999954433                   47899999999999999


Q ss_pred             ccHHHHHHHHHHhCCCCCCh-hhHHHHHHHHhcCCCcHH--HHHH-HHHHHHcCCCCchHHHHHHHHHHHhcCChHHHHH
Q 039873          217 FRGGVEVLGKMVSGSVRWDS-VTYVNAFGLSASLKDLKL--GLQV-HSQMLKSDIEPDVFINSAMISMYGKCGKFSNAKK  292 (709)
Q Consensus       217 ~~~A~~l~~~m~~~g~~p~~-~t~~~ll~~~~~~~~~~~--a~~~-~~~~~~~g~~~~~~~~~~li~~y~~~g~~~~A~~  292 (709)
                      +++|+++|++|.+.+  |+. ..+..+...+...+..+.  +..+ +..+...+......+++.++.+|.+.|++++|.+
T Consensus       216 ~~~A~~~~~~~~~~~--p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~  293 (597)
T 2xpi_A          216 FDRAKECYKEALMVD--AKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAED  293 (597)
T ss_dssp             HHHHHHHHHHHHHHC--TTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhC--chhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHH
Confidence            999999999998853  443 344444443333322221  1111 4445555555566778888999999999999999


Q ss_pred             HHHhccC--CCHhhHHHHHHHHHHcCCHhHHHHHHHHHHhCCCCCCccchHHHHHHHhccCChhHHHHHHHHHHHhCCCC
Q 039873          293 VFEGLET--RNVVLWTAMVAACFQNEYFEEALNLFCGMEYEAIRPNEFTFAVMLNSAAGLSALRHGDLLHAHIEKSGFKE  370 (709)
Q Consensus       293 ~~~~m~~--~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~pd~~t~~~ll~~~~~~~~~~~a~~i~~~~~~~g~~~  370 (709)
                      +|+++.+  ++..+|+.++.+|.+.|++++|+++|++|.+.+ +.+..++..++.++...|+.++|.+++..+.+.. +.
T Consensus       294 ~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~  371 (597)
T 2xpi_A          294 YLSSINGLEKSSDLLLCKADTLFVRSRFIDVLAITTKILEID-PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PE  371 (597)
T ss_dssp             HHHTSTTGGGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TT
T ss_pred             HHHHhhcCCchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-cc
Confidence            9999987  799999999999999999999999999999765 3477889999999999999999999999999765 66


Q ss_pred             ChhHHhHHHhHHHhcCCHHHHHHHHhhcC---CCChhhHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHH
Q 039873          371 HLIVGNALINMYAKGGNIEAANKVFSDMR---YRDIITWNAMICGYSHHGLGREALTLFQNMLAAEERPNHVTFVGVLSA  447 (709)
Q Consensus       371 ~~~~~~~li~~y~~~g~~~~A~~~f~~~~---~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~pd~~t~~~ll~a  447 (709)
                      +..+++.++.+|.++|++++|.++|+++.   ..+..+|+.++.+|.+.|++++|+++|++|.+.+ +.+..++..++.+
T Consensus       372 ~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~  450 (597)
T 2xpi_A          372 KAVTWLAVGIYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLFLGMQ  450 (597)
T ss_dssp             SHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHHHH
T ss_pred             cHHHHHHHHHHHHHhccHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHHHH
Confidence            78899999999999999999999999875   3568899999999999999999999999999853 4578899999999


Q ss_pred             HhccccHHHHHHHHHHHHHhhCCCCChHHHHHHHHHHHhcCCHHHHHHHHHhC-------CCCCC--HHHHHHHHHHHHh
Q 039873          448 CGHLGLVQEGFYYLNHLMKQIGIVPGLEHYTCIVGLLSKAGLLDEAEKFMRST-------PVKWD--VVAWHTLLNASRV  518 (709)
Q Consensus       448 ~~~~g~~~~a~~~~~~~~~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~~-------~~~pd--~~~~~~ll~~~~~  518 (709)
                      |.+.|++++|.++|+.+.+.  .+.+..+|+.++.+|.+.|++++|.++|+++       +..|+  ..+|..++.+|.+
T Consensus       451 ~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~  528 (597)
T 2xpi_A          451 HMQLGNILLANEYLQSSYAL--FQYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRK  528 (597)
T ss_dssp             HHHHTCHHHHHHHHHHHHHH--CCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHH
T ss_pred             HHHcCCHHHHHHHHHHHHHh--CCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHH
Confidence            99999999999999999764  2346789999999999999999999998865       55787  7899999999999


Q ss_pred             cCCchHHHHHHHHHHhcCCCCchhHHHHHHHhhhcCCchhHHHHHHHHHhC
Q 039873          519 HQNYGFGRRIAEYILHMDPNDVGTYILLSNMYAKEKRWDGVSKIRKLMKVR  569 (709)
Q Consensus       519 ~g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~~  569 (709)
                      .|++++|++.++++++.+|+++.+|..++.+|.+.|++++|.+.++++.+.
T Consensus       529 ~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~  579 (597)
T 2xpi_A          529 LKMYDAAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGLAITHLHESLAI  579 (597)
T ss_dssp             TTCHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH
T ss_pred             hcCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhc
Confidence            999999999999999999999999999999999999999999999999874



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qx5_A Nucleoporin NIC96; mRNA transport, nuclear pore complex, nucleus, protein transport, translocation, transport, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2rfo_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query709
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.88
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.86
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.5
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.4
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.96
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.84
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.84
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.83
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.83
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.78
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.77
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.71
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.68
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.49
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.36
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.34
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.26
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.21
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.21
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.2
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.18
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.15
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.07
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.06
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.06
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.99
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.96
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.94
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.84
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.82
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.79
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.78
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.74
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.69
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.66
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.65
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.65
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.64
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.58
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.51
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.51
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.49
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.4
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.24
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.21
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.0
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.99
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.97
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.85
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.8
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 96.53
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.49
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.31
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.99
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 95.81
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 91.63
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 91.53
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 90.84
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 90.38
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 89.19
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 84.24
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 83.81
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.88  E-value=1.9e-19  Score=186.23  Aligned_cols=344  Identities=10%  Similarity=0.051  Sum_probs=228.1

Q ss_pred             cHHHHHHHHHhCCCccHHHHHHHHHHhCCCCCChhhHHHHHHHHhcCCCcHHHHHHHHHHHHcCCCCchHHHHHHHHHHH
Q 039873          203 EYNSVLNGLIENECFRGGVEVLGKMVSGSVRWDSVTYVNAFGLSASLKDLKLGLQVHSQMLKSDIEPDVFINSAMISMYG  282 (709)
Q Consensus       203 ~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~~~~~~~~~li~~y~  282 (709)
                      .|..+...|.+.|++++|+..|++..+... -+..++..+...+...|++++|...+....+.. +.+..........+.
T Consensus        35 ~~~~la~~~~~~~~~~~A~~~~~~al~~~p-~~~~a~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~~~~~~~  112 (388)
T d1w3ba_          35 VLLLLSSIHFQCRRLDRSAHFSTLAIKQNP-LLAEAYSNLGNVYKERGQLQEAIEHYRHALRLK-PDFIDGYINLAAALV  112 (388)
T ss_dssp             HHHHHHHHHHHTTCHHHHHHHHHHHHHHCT-TCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHcCCHHHHHHHHHHHHHhCC-CCHHHHHHHHHHhhhhccccccccccccccccc-ccccccccccccccc
Confidence            344444444444444444444444443211 122344444444444455555554444444433 222222222233333


Q ss_pred             hcCChHHHHHHHHhcc---CCCHhhHHHHHHHHHHcCCHhHHHHHHHHHHhCCCCCC-ccchHHHHHHHhccCChhHHHH
Q 039873          283 KCGKFSNAKKVFEGLE---TRNVVLWTAMVAACFQNEYFEEALNLFCGMEYEAIRPN-EFTFAVMLNSAAGLSALRHGDL  358 (709)
Q Consensus       283 ~~g~~~~A~~~~~~m~---~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~pd-~~t~~~ll~~~~~~~~~~~a~~  358 (709)
                      ..+....+........   ......+..........+....+...+.+....  .|+ ...+..+...+...+..+.|..
T Consensus       113 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~l~~~~~~~~~~~~A~~  190 (388)
T d1w3ba_         113 AAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIET--QPNFAVAWSNLGCVFNAQGEIWLAIH  190 (388)
T ss_dssp             HHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHH--CTTCHHHHHHHHHHHHTTTCHHHHHH
T ss_pred             ccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhcc--CcchhHHHHhhcccccccCcHHHHHH
Confidence            3333333322222211   123333444444555555666666665555443  232 3344445555666677777777


Q ss_pred             HHHHHHHhCCCCChhHHhHHHhHHHhcCCHHHHHHHHhhcC---CCChhhHHHHHHHHHHcCChHHHHHHHHHHHHCCCC
Q 039873          359 LHAHIEKSGFKEHLIVGNALINMYAKGGNIEAANKVFSDMR---YRDIITWNAMICGYSHHGLGREALTLFQNMLAAEER  435 (709)
Q Consensus       359 i~~~~~~~g~~~~~~~~~~li~~y~~~g~~~~A~~~f~~~~---~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~  435 (709)
                      .+..+++.. +.+...+..+...|...|++++|...|++..   ..+...|..+...|.+.|++++|++.|++..+  +.
T Consensus       191 ~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~--~~  267 (388)
T d1w3ba_         191 HFEKAVTLD-PNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIE--LQ  267 (388)
T ss_dssp             HHHHHHHHC-TTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--TC
T ss_pred             HHHHHHHhC-cccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHH--hC
Confidence            776666654 4456677778888888899999988888765   34667788888999999999999999999988  45


Q ss_pred             CC-HHHHHHHHHHHhccccHHHHHHHHHHHHHhhCCCCChHHHHHHHHHHHhcCCHHHHHHHHHh-CCCCCC-HHHHHHH
Q 039873          436 PN-HVTFVGVLSACGHLGLVQEGFYYLNHLMKQIGIVPGLEHYTCIVGLLSKAGLLDEAEKFMRS-TPVKWD-VVAWHTL  512 (709)
Q Consensus       436 pd-~~t~~~ll~a~~~~g~~~~a~~~~~~~~~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~-~~~~pd-~~~~~~l  512 (709)
                      |+ ..++..+...+...|++++|.+.++.....  .+.+...+..+...|.+.|++++|.+.+++ +.+.|+ ..+|..+
T Consensus       268 p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~--~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l  345 (388)
T d1w3ba_         268 PHFPDAYCNLANALKEKGSVAEAEDCYNTALRL--CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNL  345 (388)
T ss_dssp             SSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHH--CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhcc--CCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHH
Confidence            65 568888889999999999999999988663  345667888999999999999999999985 455666 7788889


Q ss_pred             HHHHHhcCCchHHHHHHHHHHhcCCCCchhHHHHHHHhhhcCC
Q 039873          513 LNASRVHQNYGFGRRIAEYILHMDPNDVGTYILLSNMYAKEKR  555 (709)
Q Consensus       513 l~~~~~~g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~  555 (709)
                      ...+...|++++|+..++++++++|+++.+|..|+.+|.+.|+
T Consensus       346 a~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         346 ASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCC
Confidence            9999999999999999999999999999999999999988875



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure