Citrus Sinensis ID: 039925

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------55
ETDHLALLAIKSLLHDRRGVTSSWSNSIDLCQWRGVTCTHQHQRINKCLTPHVGNFGYLRFINLVDNNFRGEIPEKVGRLFRLEYLLLANNHFSGKIPANLSHCSNLLTKLFICETHLSGQLLDFIGNPSAIQVMIFKENSLEGKFPNTLSNLRSLFYDNINRNEFSGLIPSFIFNISLKWNFLPENSFTGNLPLEIGVTLPKGRNYYILLLAQKLYWSDVSTTATIIAMGGNQISGTITLGIKKLIFVNLYALTMVKNKLSGPIPHHIASSLGNLTLLTYLALDNNKLQGNLPSSLGYYQNLMELSVSRNKLSASLPPLNSQHNHSFSCPGFEFSVIKLEFQIPGNKKLCGGLDELHLLSCHSKESKRQTIKLLTMAISMILSLFILSPSTVTNEFSSSNMIGQGSFGSVYKGILGEKWTAGYSEGTDFKGIDFKAVVFDYMQNRSLEDWPYQSNNKLKPSSLSMIRKLSTTIDVASAIEYLRVKMALPEKVMEIVESSLLLEIEDCLVSVLTIGILCSVESPSERMEKPYIVSKLSHARENVACNRV
ccHHHHHHHHHHcccccccccccccccccccccEEEEEccccccEEEEccccccccccccEEEccccEEEEEccccccccccccccccccccccccccHHHHHccccccEEEEccccccccccccccccccccEEEccccEEcccccHHccccccccEEEcccccccccccHHHHccccccEEccccccccccccHHHHcccccccccEEEccccccccccccccccEEcccccccccccHHHHccccccccEEEcccccccccccccccccccccccccEEccccccccccccHHHHccccccEEEccccccccccccccccccccccccEEEEEcccEEEEcccccccccccccccccccccccccccEEEEEHHHHHHHHHHHHHcccccccccccccEEEcccccEEEEEEEccccEEEEEEccccccccHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccEEEcccccEEEEccEEccccccccccccccccccEEEccccHHHHHccc
ccHHHHHHHHHHHcccccccccccccccccccEEEEEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHccHHHHHHHEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccEEEEEcccccccccccHHHccHHHHHHEHHccccccccccHHHcccccEEEcccccccccccHHHccccccccEEEEcccccccccccHHccHHHccccccEEEEcccccccccccHHHcccccccEEEEccccccccccccHHcccccccccEEEcccccccccccccHcHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHcEEEcccccEEEEEEcccccEEEEEEEccccccccEEEEEEccccccHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHccccccEEEEccccccEEEccccccEEHHHHcHHHHcccccccccccEEEEcEcEccHHHccccc
ETDHLALLAIKSLlhdrrgvtsswSNSIDlcqwrgvtcthqhqrinkcltphvgnfgylRFINLVdnnfrgeipekVGRLFRLEYLLLANnhfsgkipanlshCSNLLTKLFICETHlsgqlldfignpSAIQVMIFKenslegkfpntlSNLRSLFYdninrnefsgliPSFIFNISlkwnflpensftgnlpleigvtlpkgRNYYILLLAQKLYWSDVSTTATIIAMggnqisgtITLGIKKLIFVNLYALTMVKnklsgpiphhiasslgnLTLLTYLALdnnklqgnlpsslgYYQNLMELSVSRnklsaslpplnsqhnhsfscpgfefSVIKLefqipgnkklcggldelhllschskeSKRQTIKLLTMAISMILSLFilspstvtnefsssnmigqgsfgsvykgilgekwtagysegtdfkgidFKAVVFDYMQnrsledwpyqsnnklkpssLSMIRKLSTTIDVASAIEYLRVKMALPEKVMEIVESSLLLEIEDCLVSVLTIGILcsvespsermekpyIVSKLSHARENVACNRV
ETDHLALLAIKsllhdrrgvtSSWSNSIDLCQWRGVTCTHQHQRINKCLTPHVGNFGYLRFINLVDNNFRGEIPEKVGRLFRLEYLLLANNHFSGKIPANLSHCSNLLTKLFICETHLSGQLLDFIGNPSAIQVMIFKENSLEGKFPNTLSNLRSLFYDNINRNEFSGLIPSFIFNISLKWNFLPENSFTGNLPLEIGVTLPKGRNYYILLLAQKLYWSDVSTTATIIAMGGNQISGTITLGIKKLIFVNLYALTMVKNKLSGPIPHHIASSLGNLTLLTYLALDNNKLQGNLPSSLGYYQNLMELSVSRNKLSASLPPLNSQHNHSFSCPGFEFSVIKLEFQIPGNKKLCGGLDELHLLSCHSKESKRQTIKLLTMAISMILSLFILSPSTVTNEFSSSNMIGQGSFGSVYKGILGEKWTAGYSEGTDFKGIDFKAVVFDYMQNRsledwpyqsnnklkpsSLSMIRKLSTTIDVASAIEYLRVKMALPEKVMEIVESSLLLEIEDCLVSVLTIGILcsvespsermeKPYIvsklsharenvacnrv
ETDHLALLAIKSLLHDRRGVTSSWSNSIDLCQWRGVTCTHQHQRINKCLTPHVGNFGYLRFINLVDNNFRGEIPEKVGRLFRLEYLLLANNHFSGKIPANLSHCSNLLTKLFICETHLSGQLLDFIGNPSAIQVMIFKENSLEGKFPNTLSNLRSLFYDNINRNEFSGLIPSFIFNISLKWNFLPENSFTGNLPLEIGVTLPKGRNYYILLLAQKLYWSDVSTTATIIAMGGNQISGTITLGIKKLIFVNLYALTMVKNKLSGPIPHHIASSlgnltlltylaldnnKLQGNLPSSLGYYQNLMELSVSRNKLSASLPPLNSQHNHSFSCPGFEFSVIKLEFQIPGNKKLCGGLDELHLLSCHSKESKRQTIKLLTMAISMILSLFILSPSTVTNEFSSSNMIGQGSFGSVYKGILGEKWTAGYSEGTDFKGIDFKAVVFDYMQNRSLEDWPYQSNNKLKPSSLSMIRKLSTTIDVASAIEYLRVKMALPEKVMeivessllleieDCLVSVLTIGILCSVESPSERMEKPYIVSKLSHARENVACNRV
****LALLAIKSLLHDRRGVTSSWSNSIDLCQWRGVTCTHQHQRINKCLTPHVGNFGYLRFINLVDNNFRGEIPEKVGRLFRLEYLLLANNHFSGKIPANLSHCSNLLTKLFICETHLSGQLLDFIGNPSAIQVMIFKENSLEGKFPNTLSNLRSLFYDNINRNEFSGLIPSFIFNISLKWNFLPENSFTGNLPLEIGVTLPKGRNYYILLLAQKLYWSDVSTTATIIAMGGNQISGTITLGIKKLIFVNLYALTMVKNKLSGPIPHHIASSLGNLTLLTYLALDNNKLQGNLPSSLGYYQNLMELS*******************SFSCPGFEFSVIKLEFQIPGNKKLCGGLDELHLLSCHSKESKRQTIKLLTMAISMILSLFILSPSTVTNEFSSSNMIGQGSFGSVYKGILGEKWTAGYSEGTDFKGIDFKAVVFDYMQNRSLEDWPYQ*********LSMIRKLSTTIDVASAIEYLRVKMALPEKVMEIVESSLLLEIEDCLVSVLTIGILCSV****************************
ETDHLALLAIKSLLHDRRGVTSSWSNSIDLCQWRGVTCTHQHQRINKCLTPHVGNFGYLRFINLVDNNFRGEIPEKVGRLFRLEYLLLANNHFSGKIPANLSHCSNLLTKLFICETHLSGQLLDFIGNPSAIQVMIFKENSLEGKFPNTLSNLRSLFYDNINRNEFSGLIPSFIFNISLKWNFLPENSFTGNLPLEIGVTLPKGRNYYILLLAQKLYWSDVSTTATIIAMGGNQISGTITLGIKKLIFVNLYALTMVKNKLSGPIPHHIASSLGNLTLLTYLALDNNKLQGNLPSSLGYYQNLMELSVSRNKLSASLPPLNSQHNHSFSCPGFEFSVIKLEFQIPGNKKLCGGLDE*******************TMAISMILSLFILSPSTVTNEFSSSNMIGQGSFGSVYKGILGEKWTAGYSEGTDFKGIDFKAVVFDYMQNRSLEDWPYQSNNKLKPSSLSMIRKLSTTIDVASAIEYLRVKMALPEKVMEIVESSLLLEIEDCLVSVLTIGIL******************LSHARENVACN**
ETDHLALLAIKSLLHDRRGVTSSWSNSIDLCQWRGVTCTHQHQRINKCLTPHVGNFGYLRFINLVDNNFRGEIPEKVGRLFRLEYLLLANNHFSGKIPANLSHCSNLLTKLFICETHLSGQLLDFIGNPSAIQVMIFKENSLEGKFPNTLSNLRSLFYDNINRNEFSGLIPSFIFNISLKWNFLPENSFTGNLPLEIGVTLPKGRNYYILLLAQKLYWSDVSTTATIIAMGGNQISGTITLGIKKLIFVNLYALTMVKNKLSGPIPHHIASSLGNLTLLTYLALDNNKLQGNLPSSLGYYQNLMELSVSRNKLSASLPPLNSQHNHSFSCPGFEFSVIKLEFQIPGNKKLCGGLDELHLLSCHSKESKRQTIKLLTMAISMILSLFILSPSTVTNEFSSSNMIGQGSFGSVYKGILGEKWTAGYSEGTDFKGIDFKAVVFDYMQNRSLEDWPYQSNNKLKPSSLSMIRKLSTTIDVASAIEYLRVKMALPEKVMEIVESSLLLEIEDCLVSVLTIGILCSVESPSERMEKPYIVSKLSHARENVACNRV
*T*HLALLAIKSLLHDRRGVTSSWSNSIDLCQWRGVTCTHQHQRINKCLTPHVGNFGYLRFINLVDNNFRGEIPEKVGRLFRLEYLLLANNHFSGKIPANLSHCSNLLTKLFICETHLSGQLLDFIGNPSAIQVMIFKENSLEGKFPNTLSNLRSLFYDNINRNEFSGLIPSFIFNISLKWNFLPENSFTGNLPLEIGVTLPKGRNYYILLLAQKLYWSDVSTTATIIAMGGNQISGTITLGIKKLIFVNLYALTMVKNKLSGPIPHHIASSLGNLTLLTYLALDNNKLQGNLPSSLGYYQNLMELSVSRNKLSASLPPLNSQHNHSFSCPGFEFSVIKLEFQIPGNKKLCGGLDELHLLSCHSKESKRQTIKLLTMAISMILSLFILSPSTVTNEFSSSNMIGQGSFGSVYKGILGEKWTAGYSEGTDFKGIDFKAVVFDYMQNRSLEDWPYQSNNKLKPSSLSMIRKLSTTIDVASAIEYLRVKMALPEKVMEIVESSLLLEIEDCLVSVLTIGILCSVESPSERMEKPYIVSKLSHARENVACNR*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ETDHLALLAIKSLLHDRRGVTSSWSNSIDLCQWRGVTCTHQHQRINKCLTPHVGNFGYLRFINLVDNNFRGEIPEKVGRLFRLEYLLLANNHFSGKIPANLSHCSNLLTKLFICETHLSGQLLDFIGNPSAIQVMIFKENSLEGKFPNTLSNLRSLFYDNINRNEFSGLIPSFIFNISLKWNFLPENSFTGNLPLEIGVTLPKGRNYYILLLAQKLYWSDVSTTATIIAMGGNQISGTITLGIKKLIFVNLYALTMVKNKLSGPIPHHIASSLGNLTLLTYLALDNNKLQGNLPSSLGYYQNLMELSVSRNKLSASLPPLNSQHNHSFSCPGFEFSVIKLEFQIPGNKKLCGGLDELHLLSCHSKESKRQTIKLLTMAISMILSLFILSPSTVTNEFSSSNMIGQGSFGSVYKGILGEKWTAGYSEGTDFKGIDFKAVVFDYMQNRSLEDWPYQSNNKLKPSSLSMIRKLSTTIDVASAIEYLRVKMALPEKVMEIVESSLLLEIEDCLVSVLTIGILCSVESPSERMEKPYIVSKLSHARENVACNRV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query549 2.2.26 [Sep-21-2011]
C0LGT6 1031 LRR receptor-like serine/ yes no 0.566 0.301 0.318 3e-36
C0LGP4 1010 Probable LRR receptor-lik no no 0.573 0.311 0.304 3e-35
Q9SD62 1025 Putative receptor-like pr no no 0.568 0.304 0.313 4e-34
Q9SHI2 1101 Leucine-rich repeat recep no no 0.555 0.277 0.300 4e-28
Q9FL28 1173 LRR receptor-like serine/ no no 0.533 0.249 0.304 1e-26
O49318 1124 Probable leucine-rich rep no no 0.480 0.234 0.309 3e-26
Q42371 976 LRR receptor-like serine/ no no 0.551 0.310 0.290 8e-26
C0LGW6 966 LRR receptor-like serine/ no no 0.540 0.307 0.286 8e-26
Q9LVP0 1102 Probable leucine-rich rep no no 0.515 0.256 0.306 5e-25
Q9SSL9 1123 Leucine-rich repeat recep no no 0.526 0.257 0.302 7e-25
>sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 Back     alignment and function desciption
 Score =  153 bits (387), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 124/389 (31%), Positives = 189/389 (48%), Gaps = 78/389 (20%)

Query: 1   ETDHLALLAIKSLL--HDRRGVTSSWSNSIDLCQWRGVTCTHQHQRI----------NKC 48
           ETD  ALL  KS +  +++R V +SW++S   C W GVTC  + +R+             
Sbjct: 29  ETDMQALLEFKSQVSENNKREVLASWNHSSPFCNWIGVTCGRRRERVISLNLGGFKLTGV 88

Query: 49  LTPHVGNFGYLRFINLVDNNFRGEIPEKVGRLFRLEYLLLANNHFSGKIPANLSHCSNL- 107
           ++P +GN  +LR +NL DN+F   IP+KVGRLFRL+YL ++ N   G+IP++LS+CS L 
Sbjct: 89  ISPSIGNLSFLRLLNLADNSFGSTIPQKVGRLFRLQYLNMSYNLLEGRIPSSLSNCSRLS 148

Query: 108 -------------------LTKLFICE---THLSGQLLDFIGNPSAIQVMIFKENSLEGK 145
                              L+KL I +    +L+G     +GN +++Q + F  N + G+
Sbjct: 149 TVDLSSNHLGHGVPSELGSLSKLAILDLSKNNLTGNFPASLGNLTSLQKLDFAYNQMRGE 208

Query: 146 FPNTLSNLRSLFYDNINRNEFSGLIPSFIFNI-SLKWNFLPENSFTGNLPLEIG------ 198
            P+ ++ L  + +  I  N FSG  P  ++NI SL+   L +NSF+GNL  + G      
Sbjct: 209 IPDEVARLTQMVFFQIALNSFSGGFPPALYNISSLESLSLADNSFSGNLRADFGYLLPNL 268

Query: 199 VTLPKGRNYYILLLAQKLYWSDVSTTATIIAMGGNQISGTITLGIKKLI----------- 247
             L  G N +   + + L  +++S+      +  N +SG+I L   KL            
Sbjct: 269 RRLLLGTNQFTGAIPKTL--ANISSLER-FDISSNYLSGSIPLSFGKLRNLWWLGIRNNS 325

Query: 248 ----------FVNLYA-------LTMVKNKLSGPIPHHIASSLGNL-TLLTYLALDNNKL 289
                     F+   A       L +  N+L G +P  IA    NL T LT L L  N +
Sbjct: 326 LGNNSSSGLEFIGAVANCTQLEYLDVGYNRLGGELPASIA----NLSTTLTSLFLGQNLI 381

Query: 290 QGNLPSSLGYYQNLMELSVSRNKLSASLP 318
            G +P  +G   +L ELS+  N LS  LP
Sbjct: 382 SGTIPHDIGNLVSLQELSLETNMLSGELP 410
Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of elongation factor Tu (EF-Tu), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs). Reduces transformation by Rhizobium radiobacter probably by inducing plant defense during the interaction. Binding to the effector AvrPto1 from P.syringae blocks the downstream plant immune response.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function description
>sp|Q9SD62|Y3471_ARATH Putative receptor-like protein kinase At3g47110 OS=Arabidopsis thaliana GN=At3g47110 PE=3 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description
>sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9SSL9|PEPR1_ARATH Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query549
255576770 851 serine-threonine protein kinase, plant-t 0.890 0.574 0.270 2e-49
297736631 978 unnamed protein product [Vitis vinifera] 0.908 0.510 0.298 5e-46
242043336 713 hypothetical protein SORBIDRAFT_02g00628 0.919 0.708 0.273 6e-46
218199011 812 hypothetical protein OsI_24717 [Oryza sa 0.868 0.587 0.281 1e-44
224113119 1065 predicted protein [Populus trichocarpa] 0.573 0.295 0.326 3e-44
255571869 721 serine-threonine protein kinase, plant-t 0.575 0.438 0.346 6e-44
359482058 1040 PREDICTED: probable LRR receptor-like se 0.575 0.303 0.354 7e-44
147853780 1904 hypothetical protein VITISV_030954 [Viti 0.575 0.165 0.354 9e-44
297831962 968 predicted protein [Arabidopsis lyrata su 0.566 0.321 0.333 1e-42
255571732 923 serine-threonine protein kinase, plant-t 0.867 0.515 0.254 1e-42
>gi|255576770|ref|XP_002529272.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223531261|gb|EEF33104.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  203 bits (516), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 180/666 (27%), Positives = 295/666 (44%), Gaps = 177/666 (26%)

Query: 1   ETDHLALLAIKS-LLHDRRGVTSSWSNSIDLCQWRGVTCTHQHQRIN----------KCL 49
           +TDHL+LL  K+ + HD +    SW++S+  C W GV C+ +H+R+             L
Sbjct: 38  KTDHLSLLDFKAKIRHDPQYSLKSWNDSVHFCNWDGVICSSKHRRVTVLDLQSKGLVGSL 97

Query: 50  TPHVGNFGYLRFINLVDNNFRGEIPEKVGRLFRLEYLLLANNHFSGKIPANLSHCSNL-- 107
           +PHVGN  +LR + L +N  +GEIP+++G LFRL+ L L NN F G+IP+NLSHCSNL  
Sbjct: 98  SPHVGNLSFLRQLILQNNTLQGEIPQEIGHLFRLQVLRLENNSFEGEIPSNLSHCSNLFF 157

Query: 108 ---------------------LTKLFICETHLSGQLLDFIGNPSAIQVMIFKENSLEGKF 146
                                L +L I   + SG +   +GN S+++V     N L+G  
Sbjct: 158 LRLGYNKLVGKIPVELSTLSNLIRLSIIGNYFSGGIPPSLGNLSSLEVFAADGNLLDGTI 217

Query: 147 PNTLSNLRSLFYDNINRNEFSGLIPSFIFNI-SLKWNFLPENSFTGNLPLEIGVTLPKGR 205
           P +   L+ L Y  ++ N+ SG  P+ I+N+ S+ +  + +N   G++P  IG+ LP   
Sbjct: 218 PESFGKLKYLAYIGLHGNKLSGTFPASIYNLSSIIFLLVSDNLLHGSIPSNIGLQLPH-- 275

Query: 206 NYYILLLAQKLYWSDV-----------STTATIIAMGGNQISGTITL----GIKKLIFVN 250
                 L +   W +            ++    + +G N  +G +      G++ L  + 
Sbjct: 276 ------LQELEMWGNHFSGSIPVSLSNASELVYVDLGTNNFTGKVLSAHFGGLRHLSHLA 329

Query: 251 LYA-------------------------LTMVKNKLSGPIPHHIA--------------- 270
           LY                          L +  N+L G  P+ +A               
Sbjct: 330 LYQNSLGSNKDDDLDFITSLLNSTSFVFLDLSTNQLEGAFPNSVANLSSPLQWLSLGQNR 389

Query: 271 ------SSLGNLTLLTYLALDNNKLQGNLPSSLGYYQNLMELSVSRNKLSASLPPLNSQH 324
                 S L  L  L+ L++  N++ G++PS +G  QNL  +    N+L+  +P  +S  
Sbjct: 390 IHGRLPSWLSGLVSLSRLSIQFNQITGSIPSDMGKLQNLYSMFFDHNRLTGIIP--SSIG 447

Query: 325 NHSF-------------SCPGFEFSVIKLEFQIPGNKKLCGGL-DELHLLS----CHSKE 366
           N SF             + P    +  +L F       L G + D+L  L     C  + 
Sbjct: 448 NLSFLNLLHLNDNNLHGTIPSSLGNCHELVFIDLSQNNLNGSISDQLFALPTFFYCWFQH 507

Query: 367 SKRQTIKLLTMAISMILSLFILSPSTVTNEFSSSNMIGQGSFGSVYKGILGEKWTA---- 422
            K + +   T+ +  +  +   S    TN FS+ ++IG GSFGSVYK IL E   A    
Sbjct: 508 PKTEVVS-DTLVLKSLEEVSYKSILKATNGFSAESLIGAGSFGSVYKVILDEDGPALAIK 566

Query: 423 -------GYSE-------------------------GTDFKGIDFKAVVFDYMQNRSLED 450
                  G S+                           DF+G DFKA+V++YM N +LE+
Sbjct: 567 VLNLQHRGASKSFMAECEALKSIRHRNLVKIITSCTSIDFQGNDFKALVYEYMPNGNLEN 626

Query: 451 W----------PYQSNNKLKPSSLSMIRKLSTTIDVASAIEYLRVKMALPEKVMEIVESS 500
           W          P+++N      SLS+++++   ID+ +A++YL  +   P    ++  S+
Sbjct: 627 WLHLGSGIGVAPFETN------SLSLLQRIDIAIDIGNALDYLHHQCERPIIHCDLKPSN 680

Query: 501 LLLEIE 506
           +LL+I+
Sbjct: 681 VLLDID 686

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297736631|emb|CBI25502.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|242043336|ref|XP_002459539.1| hypothetical protein SORBIDRAFT_02g006280 [Sorghum bicolor] gi|241922916|gb|EER96060.1| hypothetical protein SORBIDRAFT_02g006280 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|218199011|gb|EEC81438.1| hypothetical protein OsI_24717 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|224113119|ref|XP_002316397.1| predicted protein [Populus trichocarpa] gi|222865437|gb|EEF02568.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255571869|ref|XP_002526877.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223533776|gb|EEF35508.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359482058|ref|XP_002274540.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147853780|emb|CAN83822.1| hypothetical protein VITISV_030954 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297831962|ref|XP_002883863.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297329703|gb|EFH60122.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255571732|ref|XP_002526809.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223533813|gb|EEF35544.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query549
TAIR|locus:2075661 1025 AT3G47110 [Arabidopsis thalian 0.566 0.303 0.345 3.5e-46
TAIR|locus:2075631 1009 AT3G47090 [Arabidopsis thalian 0.571 0.311 0.291 8.2e-43
TAIR|locus:2149922 1031 EFR "EF-TU receptor" [Arabidop 0.479 0.255 0.312 6.3e-40
TAIR|locus:2079142 1010 AT3G47570 [Arabidopsis thalian 0.568 0.308 0.305 7.3e-38
UNIPROTKB|Q40640 1025 Xa21 "Receptor kinase-like pro 0.615 0.329 0.294 6.4e-35
TAIR|locus:2079157 1011 AT3G47580 [Arabidopsis thalian 0.571 0.310 0.291 1.6e-34
UNIPROTKB|O24435 813 O24435 "Receptor kinase-like p 0.637 0.430 0.292 6.5e-29
TAIR|locus:2020417 1101 AT1G17230 [Arabidopsis thalian 0.546 0.272 0.309 1e-26
TAIR|locus:2180617 1005 AT5G25930 [Arabidopsis thalian 0.593 0.324 0.259 6.8e-25
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.619 0.289 0.275 7.4e-25
TAIR|locus:2075661 AT3G47110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 351 (128.6 bits), Expect = 3.5e-46, Sum P(4) = 3.5e-46
 Identities = 117/339 (34%), Positives = 158/339 (46%)

Query:     1 ETDHLALLAIKSLLHDR-RGVTSSWSNSIDLCQWRGVTCTHQHQRINKC------LT--- 50
             ETD  ALL  KS + +  R V  SW++S+ LC W GV C  +H+R+         LT   
Sbjct:    38 ETDKQALLEFKSQVSETSRVVLGSWNDSLPLCSWTGVKCGLKHRRVTGVDLGGLKLTGVV 97

Query:    51 -PHVGNFGYLRFINLVDNNFRGEIPEKVGRLFRLEYLLLANNHFSGKIPANLSHCSNLLT 109
              P VGN  +LR +NL DN F G IP +VG LFRL+YL ++NN F G IP  LS+CS+L T
Sbjct:    98 SPFVGNLSFLRSLNLADNFFHGAIPSEVGNLFRLQYLNMSNNLFGGVIPVVLSNCSSLST 157

Query:   110 KLFICETHLS-GQLLDFIGNPSAIQVMIFKENSLEGKFPNTLSNLRSLFYDNINRNEFSG 168
              L +   HL  G  L+F G+ S + ++    N+L GKFP +L NL SL   +   N+  G
Sbjct:   158 -LDLSSNHLEQGVPLEF-GSLSKLVLLSLGRNNLTGKFPASLGNLTSLQMLDFIYNQIEG 215

Query:   169 LIPSFIFNISLKWNF-LPENSFTGNLP-----LEIGVTLPKGRNYYILLLAQKLYWSDVS 222
              IP  I  +     F +  N F G  P     L   + L    N +   L     +  + 
Sbjct:   216 EIPGDIARLKQMIFFRIALNKFNGVFPPPIYNLSSLIFLSITGNSFSGTLRPD--FGSLL 273

Query:   223 TTATIIAMGGNQISGTITLGIKKLIFVNLYALTMVKNKLSGPIPHHIASSXXXXXXXXXX 282
                 I+ MG N  +GTI   +  +   +L  L +  N L+G IP                
Sbjct:   274 PNLQILYMGINSFTGTIPETLSNIS--SLRQLDIPSNHLTGKIPLSFGRLQNLLLLGLNN 331

Query:   283 XXXXXKLQGNLPSSLGYYQN---LMELSVSRNKLSASLP 318
                     G+L   LG   N   L  L+V  NKL   LP
Sbjct:   332 NSLGNYSSGDL-DFLGALTNCSQLQYLNVGFNKLGGQLP 369
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
TAIR|locus:2075631 AT3G47090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149922 EFR "EF-TU receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079142 AT3G47570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40640 Xa21 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2079157 AT3G47580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O24435 O24435 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2020417 AT1G17230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180617 AT5G25930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
Sb02g006280.1
hypothetical protein (713 aa)
(Sorghum bicolor)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query549
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-33
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-24
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-18
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 8e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-04
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  134 bits (340), Expect = 3e-33
 Identities = 104/328 (31%), Positives = 155/328 (47%), Gaps = 66/328 (20%)

Query: 7   LLAIKSLLHDRRGVTSSWSNSIDLCQWRGVTCTHQH---------QRINKCLTPHVGNFG 57
           LL+ KS ++D     S+W++S D+C W+G+TC +           + I+  ++  +    
Sbjct: 34  LLSFKSSINDPLKYLSNWNSSADVCLWQGITCNNSSRVVSIDLSGKNISGKISSAIFRLP 93

Query: 58  YLRFINLVDNNFRGEIPEKVGRL-FRLEYLLLANNHFSGKIPANLSHCSNLLTKLFICET 116
           Y++ INL +N   G IP+ +      L YL L+NN+F+G IP         L  L +   
Sbjct: 94  YIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPN---LETLDLSNN 150

Query: 117 HLSGQLLDFIGNPSAIQVMIFKENSLEGKFPNTLSNLRSLFYDNINRNEFSGLIPSFIFN 176
            LSG++ + IG+ S+++V+    N L GK PN+L+NL SL +  +  N+  G IP  +  
Sbjct: 151 MLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQ 210

Query: 177 I-SLKWNFLPENSFTGNLPLEIGVTLPKGRNYYILLLAQKLYWSDVSTTATIIAMGGNQI 235
           + SLKW +L  N+ +G +P EIG                                     
Sbjct: 211 MKSLKWIYLGYNNLSGEIPYEIG------------------------------------- 233

Query: 236 SGTITLGIKKLIFVNLYALTMVKNKLSGPIPHHIASSLGNLTLLTYLALDNNKLQGNLPS 295
                     L  +N   L +V N L+GPIP    SSLGNL  L YL L  NKL G +P 
Sbjct: 234 ---------GLTSLN--HLDLVYNNLTGPIP----SSLGNLKNLQYLFLYQNKLSGPIPP 278

Query: 296 SLGYYQNLMELSVSRNKLSASLPPLNSQ 323
           S+   Q L+ L +S N LS  +P L  Q
Sbjct: 279 SIFSLQKLISLDLSDNSLSGEIPELVIQ 306

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 549
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.95
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.91
KOG1187361 consensus Serine/threonine protein kinase [Signal 99.87
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.85
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.84
KOG4237498 consensus Extracellular matrix protein slit, conta 99.82
PLN032101153 Resistant to P. syringae 6; Provisional 99.82
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.81
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.81
KOG0197468 consensus Tyrosine kinases [Signal transduction me 99.79
PLN032101153 Resistant to P. syringae 6; Provisional 99.78
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.76
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.76
KOG1026774 consensus Nerve growth factor receptor TRKA and re 99.75
KOG0192362 consensus Tyrosine kinase specific for activated ( 99.74
KOG0617264 consensus Ras suppressor protein (contains leucine 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.71
KOG4237498 consensus Extracellular matrix protein slit, conta 99.69
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.69
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.69
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 99.68
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.67
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 99.67
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.66
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 99.63
PLN03150623 hypothetical protein; Provisional 99.62
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 99.59
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.55
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.54
KOG4721 904 consensus Serine/threonine protein kinase, contain 99.52
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 99.51
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.48
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.47
KOG0581 364 consensus Mitogen-activated protein kinase kinase 99.47
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.46
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.45
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.43
PHA02988283 hypothetical protein; Provisional 99.43
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 99.42
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.42
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.41
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.41
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.41
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.41
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.4
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.4
KOG2052 513 consensus Activin A type IB receptor, serine/threo 99.4
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.39
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.39
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.39
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.38
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.38
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.37
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.37
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.37
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.37
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.37
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.37
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.37
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.36
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.36
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.36
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.36
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.36
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.36
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.36
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.35
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.35
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.35
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.34
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.34
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.34
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.34
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.34
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.34
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.33
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.33
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.33
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.33
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.33
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.33
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.33
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.32
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.32
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.32
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.32
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.31
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.31
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.31
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.31
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.31
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.31
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.31
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.31
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.31
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.3
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.3
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.29
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.29
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.29
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.29
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.29
KOG3653 534 consensus Transforming growth factor beta/activin 99.29
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.29
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.29
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.29
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.28
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.28
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.28
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.28
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.28
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.27
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 99.27
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.27
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.27
KOG0200609 consensus Fibroblast/platelet-derived growth facto 99.27
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.27
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.27
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.27
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.26
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.26
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.26
PLN03150623 hypothetical protein; Provisional 99.26
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.26
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.26
cd05110 303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.25
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.25
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.25
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.25
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.25
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.24
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.24
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.23
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.23
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.22
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.22
cd06615 308 PKc_MEK Catalytic domain of the dual-specificity P 99.21
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.2
KOG0595 429 consensus Serine/threonine-protein kinase involved 99.2
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.2
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.2
KOG0575 592 consensus Polo-like serine/threonine protein kinas 99.19
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.19
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 99.19
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 99.19
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.18
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.18
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.18
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.18
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.17
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.17
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.17
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.16
KOG1989 738 consensus ARK protein kinase family [Signal transd 99.15
cd05631 285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.15
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.15
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.14
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.14
KOG0201 467 consensus Serine/threonine protein kinase [Signal 99.14
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.13
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.13
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.13
cd05605 285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.13
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.12
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.12
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.12
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.11
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.11
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.11
PLN00034 353 mitogen-activated protein kinase kinase; Provision 99.11
cd06622 286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.11
PTZ00283 496 serine/threonine protein kinase; Provisional 99.11
cd05592 316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.1
PTZ00267 478 NIMA-related protein kinase; Provisional 99.1
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.1
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.1
cd05619 316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.1
cd05570 318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.1
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.1
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.09
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.09
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.09
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.09
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.09
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.09
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.09
cd05612 291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.08
cd05587 324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.08
cd07846 286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.08
cd07861 285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.08
cd05630 285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.08
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.08
cd05616 323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.08
cd05632 285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.08
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.08
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.08
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.07
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.07
KOG0198 313 consensus MEKK and related serine/threonine protei 99.07
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.07
cd05585 312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.07
cd05591 321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.07
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.07
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.07
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 99.07
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.06
PTZ00263 329 protein kinase A catalytic subunit; Provisional 99.06
cd05582 318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.06
cd08227 327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.06
cd05595 323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.06
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.05
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.05
KOG0615 475 consensus Serine/threonine protein kinase Chk2 and 99.05
cd05608 280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.05
cd05618 329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.05
cd05620 316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.05
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 99.05
cd07841 298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.05
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.04
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.04
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.04
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.04
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.04
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.04
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.04
KOG0661 538 consensus MAPK related serine/threonine protein ki 99.04
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.04
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.03
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.03
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.03
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 99.03
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.03
cd05589 324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.02
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.02
cd07848 287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.02
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.02
cd05609 305 STKc_MAST Catalytic domain of the Protein Serine/T 99.02
cd05615 323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.02
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.02
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.01
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.01
cd05583 288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.01
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.01
cd07847 286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.01
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.0
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.0
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.0
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.0
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 98.99
KOG0591 375 consensus NIMA (never in mitosis)-related G2-speci 98.99
cd07830 283 STKc_MAK_like Catalytic domain of Male germ cell-A 98.99
cd07836 284 STKc_Pho85 Catalytic domain of the Serine/Threonin 98.99
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 98.99
PHA03209 357 serine/threonine kinase US3; Provisional 98.99
cd06619 279 PKc_MKK5 Catalytic domain of the dual-specificity 98.98
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 98.98
cd05617 327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 98.98
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 98.98
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.98
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 98.98
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 98.97
cd07860 284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 98.97
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 98.97
KOG0589 426 consensus Serine/threonine protein kinase [General 98.96
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 98.96
KOG0578550 consensus p21-activated serine/threonine protein k 98.95
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 98.95
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 98.95
cd05584 323 STKc_p70S6K Catalytic domain of the Protein Serine 98.94
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 98.94
cd05586 330 STKc_Sck1_like Catalytic domain of Suppressor of l 98.94
cd07843 293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 98.93
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 98.93
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 98.93
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 98.93
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 98.93
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 98.92
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 98.92
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 98.92
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 98.92
cd05602 325 STKc_SGK1 Catalytic domain of the Protein Serine/T 98.92
PTZ00266 1021 NIMA-related protein kinase; Provisional 98.92
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 98.92
cd07833 288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 98.92
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 98.92
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.91
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 98.91
cd07832 286 STKc_CCRK Catalytic domain of the Serine/Threonine 98.91
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 98.91
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 98.91
KOG0582 516 consensus Ste20-like serine/threonine protein kina 98.9
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 98.9
cd07864 302 STKc_CDK12 Catalytic domain of the Serine/Threonin 98.9
cd07835 283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 98.9
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 98.9
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 98.9
cd05574 316 STKc_phototropin_like Catalytic domain of Phototro 98.89
cd07837 295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 98.89
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.89
cd05580 290 STKc_PKA Catalytic domain of the Protein Serine/Th 98.88
KOG0694 694 consensus Serine/threonine protein kinase [Signal 98.88
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 98.88
PHA03211 461 serine/threonine kinase US3; Provisional 98.88
cd07840 287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 98.87
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.87
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 98.87
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 98.87
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 98.87
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 98.86
cd06634 308 STKc_TAO2 Catalytic domain of the Protein Serine/T 98.86
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 98.86
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 98.86
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 98.85
PTZ00036 440 glycogen synthase kinase; Provisional 98.85
cd07870 291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 98.85
KOG0598 357 consensus Ribosomal protein S6 kinase and related 98.84
cd07844 291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 98.84
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 98.84
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 98.84
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 98.83
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 98.83
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 98.83
cd07839 284 STKc_CDK5 Catalytic domain of the Serine/Threonine 98.82
cd05118 283 STKc_CMGC Catalytic domain of CMGC family Serine/T 98.82
KOG0616 355 consensus cAMP-dependent protein kinase catalytic 98.82
cd08226 328 PK_STRAD_beta Pseudokinase domain of STE20-related 98.82
KOG0659 318 consensus Cdk activating kinase (CAK)/RNA polymera 98.81
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 98.81
KOG0584 632 consensus Serine/threonine protein kinase [General 98.81
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.81
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.81
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 98.8
PLN00009 294 cyclin-dependent kinase A; Provisional 98.8
KOG0577 948 consensus Serine/threonine protein kinase [Signal 98.8
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.79
PHA03212 391 serine/threonine kinase US3; Provisional 98.79
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.77
cd05613 290 STKc_MSK1_N N-terminal catalytic domain of the Pro 98.76
cd07829 282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 98.76
cd07865 310 STKc_CDK9 Catalytic domain of the Serine/Threonine 98.76
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 98.76
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 98.75
KOG0610 459 consensus Putative serine/threonine protein kinase 98.74
KOG0611 668 consensus Predicted serine/threonine protein kinas 98.74
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 98.73
PTZ00284 467 protein kinase; Provisional 98.73
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.72
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 98.72
PHA03207 392 serine/threonine kinase US3; Provisional 98.72
PHA02882294 putative serine/threonine kinase; Provisional 98.71
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 98.7
KOG0605 550 consensus NDR and related serine/threonine kinases 98.7
cd08216 314 PK_STRAD Pseudokinase domain of STE20-related kina 98.7
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 98.69
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 98.69
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 98.69
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 98.69
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 98.69
cd07867 317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 98.68
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 98.67
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 98.67
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 98.67
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 98.66
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 98.66
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 98.65
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 98.65
KOG0583 370 consensus Serine/threonine protein kinase [Signal 98.65
PTZ00024 335 cyclin-dependent protein kinase; Provisional 98.65
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 98.64
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 98.64
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 98.62
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 98.62
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 98.62
cd07834 330 STKc_MAPK Catalytic domain of the Serine/Threonine 98.62
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 98.61
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 98.61
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 98.61
KOG0593 396 consensus Predicted protein kinase KKIAMRE [Genera 98.6
cd07868 317 STKc_CDK8 Catalytic domain of the Serine/Threonine 98.59
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 98.59
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 98.58
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 98.57
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 98.57
KOG0032 382 consensus Ca2+/calmodulin-dependent protein kinase 98.56
KOG0604 400 consensus MAP kinase-activated protein kinase 2 [S 98.56
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 98.55
cd07866 311 STKc_BUR1 Catalytic domain of the Serine/Threonine 98.55
KOG0658 364 consensus Glycogen synthase kinase-3 [Carbohydrate 98.53
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 98.53
cd07842 316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 98.53
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 98.52
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 98.51
KOG0663 419 consensus Protein kinase PITSLRE and related kinas 98.5
KOG0599 411 consensus Phosphorylase kinase gamma subunit [Carb 98.49
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 98.48
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 98.47
cd07857 332 STKc_MPK1 Catalytic domain of the Serine/Threonine 98.47
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 98.42
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 98.41
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 98.4
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 98.4
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 98.39
KOG0596 677 consensus Dual specificity; serine/threonine and t 98.39
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 98.39
PLN03224 507 probable serine/threonine protein kinase; Provisio 98.34
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 98.34
PHA03210 501 serine/threonine kinase US3; Provisional 98.34
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.32
KOG0576 829 consensus Mitogen-activated protein kinase kinase 98.29
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.28
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 98.28
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.26
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.26
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.22
KOG4717 864 consensus Serine/threonine protein kinase [Signal 98.21
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 98.19
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.18
KOG0586 596 consensus Serine/threonine protein kinase [General 98.17
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.17
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.16
KOG0033 355 consensus Ca2+/calmodulin-dependent protein kinase 98.14
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 98.13
KOG0671 415 consensus LAMMER dual specificity kinases [Signal 98.12
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.11
KOG0690 516 consensus Serine/threonine protein kinase [Signal 98.03
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.02
KOG0696 683 consensus Serine/threonine protein kinase [Signal 98.02
KOG0594 323 consensus Protein kinase PCTAIRE and related kinas 97.98
PRK15386426 type III secretion protein GogB; Provisional 97.95
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 97.88
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.85
KOG1151 775 consensus Tousled-like protein kinase [Signal tran 97.84
PRK09605535 bifunctional UGMP family protein/serine/threonine 97.82
KOG1345 378 consensus Serine/threonine kinase [Signal transduc 97.82
KOG0660 359 consensus Mitogen-activated protein kinase [Signal 97.79
PRK14879211 serine/threonine protein kinase; Provisional 97.78
KOG1027 903 consensus Serine/threonine protein kinase and endo 97.78
KOG0607 463 consensus MAP kinase-interacting kinase and relate 97.75
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.75
PRK15386426 type III secretion protein GogB; Provisional 97.71
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 97.66
PRK09188 365 serine/threonine protein kinase; Provisional 97.65
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 97.65
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 97.64
KOG0695 593 consensus Serine/threonine protein kinase [Signal 97.63
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.59
KOG0669 376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 97.55
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.52
KOG0666 438 consensus Cyclin C-dependent kinase CDK8 [Transcri 97.51
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 97.45
KOG0664 449 consensus Nemo-like MAPK-related serine/threonine 97.39
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.31
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 97.29
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.26
KOG0662 292 consensus Cyclin-dependent kinase CDK5 [Intracellu 97.24
KOG0608 1034 consensus Warts/lats-like serine threonine kinases 97.24
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 97.23
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.16
smart00090237 RIO RIO-like kinase. 97.12
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.04
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.02
PLN00181 793 protein SPA1-RELATED; Provisional 96.99
KOG1152772 consensus Signal transduction serine/threonine kin 96.96
KOG0983 391 consensus Mitogen-activated protein kinase (MAPK) 96.82
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.78
PRK10345210 hypothetical protein; Provisional 96.74
KOG1290 590 consensus Serine/threonine protein kinase [Signal 96.7
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 96.56
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.5
KOG1006 361 consensus Mitogen-activated protein kinase (MAPK) 96.46
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.19
KOG1167 418 consensus Serine/threonine protein kinase of the C 95.95
KOG0614 732 consensus cGMP-dependent protein kinase [Signal tr 95.95
KOG1164 322 consensus Casein kinase (serine/threonine/tyrosine 95.94
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 95.93
KOG0668 338 consensus Casein kinase II, alpha subunit [Signal 95.86
KOG1266 458 consensus Protein kinase [Signal transduction mech 95.83
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 95.82
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 95.78
KOG1163 341 consensus Casein kinase (serine/threonine/tyrosine 95.76
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 95.59
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.5
KOG0473326 consensus Leucine-rich repeat protein [Function un 95.4
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.31
KOG4158 598 consensus BRPK/PTEN-induced protein kinase [Signal 95.28
PRK12274218 serine/threonine protein kinase; Provisional 95.28
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 95.04
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 94.87
KOG4308478 consensus LRR-containing protein [Function unknown 94.73
KOG4308478 consensus LRR-containing protein [Function unknown 94.42
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 94.41
KOG0473326 consensus Leucine-rich repeat protein [Function un 94.22
TIGR01982 437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 94.08
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.98
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=6.3e-58  Score=522.53  Aligned_cols=200  Identities=25%  Similarity=0.386  Sum_probs=128.5

Q ss_pred             ccccCCccccCeeeccCccccccCCccccCCCCCCEEEccCCcccccCCCC----------CCCCCC-CcccCCcc-ccc
Q 039925          270 ASSLGNLTLLTYLALDNNKLQGNLPSSLGYYQNLMELSVSRNKLSASLPPL----------NSQHNH-SFSCPGFE-FSV  337 (549)
Q Consensus       270 ~~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~----------~ls~N~-~~~ip~~~-~~~  337 (549)
                      |..+..+++|++|+|++|.+++.+|..+..+++|+.|+|++|++++.+|..          ++++|+ .+.+|... +..
T Consensus       516 p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~  595 (968)
T PLN00113        516 PDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLA  595 (968)
T ss_pred             ChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcc
Confidence            455566666666666666666666666666667777777777776666654          666666 34566543 222


Q ss_pred             ccceeeecCCCCCCCCccccCcccCCCCCCCccc-eeehhHHHHHHHHHh-----hc-C---------------cc----
Q 039925          338 IKLEFQIPGNKKLCGGLDELHLLSCHSKESKRQT-IKLLTMAISMILSLF-----IL-S---------------PS----  391 (549)
Q Consensus       338 l~l~~~~~gn~~~c~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~-----~~-~---------------~~----  391 (549)
                      +.- ..+.||+.+|+..+....++|....+.... +.+++++++++++++     ++ .               .|    
T Consensus       596 ~~~-~~~~~n~~lc~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  674 (968)
T PLN00113        596 INA-SAVAGNIDLCGGDTTSGLPPCKRVRKTPSWWFYITCTLGAFLVLALVAFGFVFIRGRNNLELKRVENEDGTWELQF  674 (968)
T ss_pred             cCh-hhhcCCccccCCccccCCCCCccccccceeeeehhHHHHHHHHHHHHHHHHHHHHhhhcccccccccccccccccc
Confidence            221 467899999987544445567543222221 222211111111111     11 0               01    


Q ss_pred             ------------cccccCcCCCccccCceecEEEEEeC-CCce-------------------------------eEEEec
Q 039925          392 ------------TVTNEFSSSNMIGQGSFGSVYKGILG-EKWT-------------------------------AGYSEG  427 (549)
Q Consensus       392 ------------~~~~~~~~~~~lG~G~~g~Vy~~~~~-~~~~-------------------------------~g~~~~  427 (549)
                                  .....|...++||+|+||.||+|+.. ++..                               +|+|..
T Consensus       675 ~~~~~~~~~~~~~~~~~~~~~~~ig~G~~g~Vy~~~~~~~~~~vavK~~~~~~~~~~~~~~~l~~l~HpnIv~~~~~~~~  754 (968)
T PLN00113        675 FDSKVSKSITINDILSSLKEENVISRGKKGASYKGKSIKNGMQFVVKEINDVNSIPSSEIADMGKLQHPNIVKLIGLCRS  754 (968)
T ss_pred             cccccchhhhHHHHHhhCCcccEEccCCCeeEEEEEECCCCcEEEEEEccCCccccHHHHHHHhhCCCCCcceEEEEEEc
Confidence                        01234566788999999999999974 3322                               677776


Q ss_pred             cccCCCceEEEEEeecCCCCcccccccCCCCCCCCCCchhhhHHHHHHHHHHHHHhh
Q 039925          428 TDFKGIDFKAVVFDYMQNRSLEDWPYQSNNKLKPSSLSMIRKLSTTIDVASAIEYLR  484 (549)
Q Consensus       428 ~~~~~~~~~~lv~ey~~~GsL~~~l~~~~~~~~~~~l~~~~~~~ia~~va~gl~yLH  484 (549)
                           .+..++|||||++|+|.++++         .++|.++.+|+.|+|+||+|||
T Consensus       755 -----~~~~~lv~Ey~~~g~L~~~l~---------~l~~~~~~~i~~~ia~~L~yLH  797 (968)
T PLN00113        755 -----EKGAYLIHEYIEGKNLSEVLR---------NLSWERRRKIAIGIAKALRFLH  797 (968)
T ss_pred             -----CCCCEEEEeCCCCCcHHHHHh---------cCCHHHHHHHHHHHHHHHHHhc
Confidence                 678899999999999999996         2789999999999999999999

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query549
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-15
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-15
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-10
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 77/293 (26%), Positives = 128/293 (43%), Gaps = 32/293 (10%)
Query: 53  VGNFGYLRFINLVDNNFRGEIPEKVGRLFRLEYLLLANNHFSGKIPANLSHCSNLLTKLF 112
           +G+   LR + L  N   GEIP+++  +  LE L+L  N  +G+IP+ LS+C+N L  + 
Sbjct: 435 LGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTN-LNWIS 493
Query: 113 ICETHLSGQLLDFIGNPSAIQVMIFKENSLEGKFPNTLSNLRSLFYDNINRNEFSGLIPS 172
           +    L+G++  +IG    + ++    NS  G  P  L + RSL + ++N N F+G IP+
Sbjct: 494 LSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPA 553
Query: 173 FIFNISLK--WNFLPENSF--------------TGNLPLEIGV---TLPKGRNYYILLLA 213
            +F  S K   NF+    +               GNL    G+    L +        + 
Sbjct: 554 AMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNIT 613
Query: 214 QKLYWSDVSTT------ATIIAMGGNQISGTITLGIKKLIFVNLYALTMVKNKLSGPIPH 267
            ++Y    S T         + M  N +SG I   I  + +  L+ L +  N +SG IP 
Sbjct: 614 SRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPY--LFILNLGHNDISGSIPD 671
Query: 268 HIASSXXXXXXXXXXXXXXXKLQGNLPSSLGYYQNLMELSVSRNKLSASLPPL 320
            +                  KL G +P ++     L E+ +S N LS  +P +
Sbjct: 672 EVGD----LRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEM 720
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query549
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-54
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-44
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-43
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-39
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-24
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-22
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-19
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-20
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-17
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-15
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-17
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-15
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-10
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-08
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-06
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 3e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-07
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-07
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 1e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-04
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 9e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-05
3soc_A 322 Activin receptor type-2A; structural genomics cons 6e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 7e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  184 bits (470), Expect = 3e-54
 Identities = 86/381 (22%), Positives = 127/381 (33%), Gaps = 92/381 (24%)

Query: 1   ETDHLALLAIKSLLHDRRGVTSSWSNSIDLCQ--WRGVTCTHQHQRIN------------ 46
             D  ALL IK  L +     SSW  + D C   W GV C    Q               
Sbjct: 5   PQDKQALLQIKKDLGNP-TTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLP 63

Query: 47  --KCLTPHVGNFGYLRFINLVD-NNFRGEIPEKVGRLFRLEYLLLANNHFSGKIPANLSH 103
               +   + N  YL F+ +   NN  G IP  + +L +L YL + + + SG IP  LS 
Sbjct: 64  KPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQ 123

Query: 104 CSNLLTKLFICETHLSGQLLDFIGNPSAIQVMIFKENSLEGKFPNTLSNLRSLFYDNINR 163
              L                           + F  N+L G  P ++S+L +L     + 
Sbjct: 124 IKTL-------------------------VTLDFSYNALSGTLPPSISSLPNLVGITFDG 158

Query: 164 NEFSGLIPSFIFNISLKWNFLP--ENSFTGNLPLEIGVTLPKGRNYYILLLAQKLYWSDV 221
           N  SG IP    + S  +  +    N  TG +P                           
Sbjct: 159 NRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFA----------------------- 195

Query: 222 STTATIIAMGGNQISGTITLGIKKLIFVNLYALTMVKNKLSGPIPHHIASSLGNLTLLTY 281
           +     + +  N + G  ++        N   + + KN L+  +       +G    L  
Sbjct: 196 NLNLAFVDLSRNMLEGDASVLFGSD--KNTQKIHLAKNSLAFDLG-----KVGLSKNLNG 248

Query: 282 LALDNNKLQGNLPSSLGYYQNLMELSVSRNKLSASLPPLNSQHNHSFSCPGFEFSVIKLE 341
           L L NN++ G LP  L   + L  L+VS N L   +P   +      S            
Sbjct: 249 LDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSA----------- 297

Query: 342 FQIPGNKKLCGGLDELHLLSC 362
                NK LCG      L +C
Sbjct: 298 --YANNKCLCGS----PLPAC 312
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query549
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.98
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.98
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.98
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.98
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.97
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.93
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.91
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.86
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.83
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 99.83
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.83
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
4aoj_A329 High affinity nerve growth factor receptor; transf 99.82
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.82
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.79
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.76
4ase_A353 Vascular endothelial growth factor receptor 2; tra 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.73
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.73
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.71
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.67
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.67
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.66
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.66
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.65
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.64
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.63
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.63
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.6
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.57
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 99.57
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.57
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.56
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.55
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 99.55
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.54
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 99.54
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.53
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.52
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.52
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 99.52
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.51
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.51
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.51
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 99.51
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.5
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.5
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.49
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.49
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 99.49
3soc_A 322 Activin receptor type-2A; structural genomics cons 99.48
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.48
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.48
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.48
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.47
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.47
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.47
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.47
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.47
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.47
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.46
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 99.46
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.46
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.46
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.45
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.45
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.45
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.45
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 99.45
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.45
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.45
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.45
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 99.45
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.45
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.44
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.44
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.44
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.43
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.43
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.42
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 99.42
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.42
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 99.41
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.41
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.41
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.41
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.41
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.41
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.4
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.4
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.4
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.4
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.4
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.4
3q4u_A 301 Activin receptor type-1; structural genomics conso 99.39
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.39
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.39
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.39
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.39
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.39
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.39
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 99.39
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.39
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.38
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.38
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.38
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.38
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.37
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.37
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.37
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.37
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.37
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.36
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.35
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 99.35
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 99.35
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.35
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 99.35
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.34
3uqc_A286 Probable conserved transmembrane protein; structur 99.34
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.34
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.33
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.33
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.33
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.33
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 99.33
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 99.33
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.33
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.33
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.32
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.32
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.31
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 99.31
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 99.31
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.3
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.3
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.3
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 99.3
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.29
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.28
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.28
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.28
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.28
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 99.28
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.27
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 99.27
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.27
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.27
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.27
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.27
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 99.27
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 99.27
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.26
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 99.26
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.26
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.26
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.26
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.26
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.26
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.25
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.25
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.25
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 99.25
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.25
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 99.24
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.24
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 99.24
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.24
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 99.24
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.23
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 99.23
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.23
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 99.23
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.23
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 99.23
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 99.23
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.23
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 99.23
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 99.22
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.22
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 99.22
3bhy_A283 Death-associated protein kinase 3; death associate 99.22
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.21
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 99.21
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 99.21
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.21
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.2
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 99.2
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.2
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.2
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.2
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 99.19
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.19
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.19
3niz_A 311 Rhodanese family protein; structural genomics, str 99.19
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.19
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 99.19
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 99.19
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.19
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 99.19
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 99.19
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.19
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 99.19
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 99.18
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 99.18
3ork_A 311 Serine/threonine protein kinase; structural genomi 99.18
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.18
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.18
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.18
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.18
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 99.17
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 99.17
3an0_A 340 Dual specificity mitogen-activated protein kinase; 99.17
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 99.17
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 99.17
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 99.17
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 99.17
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.16
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 99.16
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 99.16
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 99.16
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 99.16
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.16
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.15
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 99.15
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.15
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 99.14
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.14
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.14
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.14
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.13
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.13
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.13
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 99.13
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 99.13
3o0g_A 292 Cell division protein kinase 5; kinase activator c 99.13
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.12
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.12
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 99.12
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 99.11
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 99.11
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.1
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 99.09
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.09
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 99.09
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.08
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 99.08
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.07
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 99.07
3aln_A 327 Dual specificity mitogen-activated protein kinase; 99.06
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 99.06
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 99.05
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 99.05
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.03
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.03
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.02
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 99.02
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.01
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 99.0
2dyl_A 318 Dual specificity mitogen-activated protein kinase 99.0
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 99.0
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 98.98
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 98.96
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 98.96
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 98.96
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 98.96
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.95
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 98.95
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 98.94
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 98.94
3rp9_A 458 Mitogen-activated protein kinase; structural genom 98.94
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 98.94
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 98.93
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 98.93
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 98.92
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 98.91
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 98.91
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 98.9
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 98.89
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.88
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 98.87
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 98.8
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 98.79
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.75
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.75
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.71
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.68
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.59
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 98.51
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.45
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.37
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 98.36
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.28
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 98.11
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.96
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.9
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 97.82
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 97.48
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.45
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.38
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 97.23
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 96.79
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.68
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.08
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 91.53
3dxp_A 359 Putative acyl-COA dehydrogenase; protein kinase-li 88.67
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 85.7
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=100.00  E-value=6.9e-42  Score=339.25  Aligned_cols=296  Identities=28%  Similarity=0.434  Sum_probs=264.1

Q ss_pred             hhHHHHHHHHhhcCCCCCCCCCCCCCCCCCC--CCcceeCCCCCceEeecCccccCCCCCCEEEccCCccee--cCCccc
Q 039925            2 TDHLALLAIKSLLHDRRGVTSSWSNSIDLCQ--WRGVTCTHQHQRINKCLTPHVGNFGYLRFINLVDNNFRG--EIPEKV   77 (549)
Q Consensus         2 ~~~~~l~~~~~~~~~~~~~~~~w~~~~~~c~--w~gv~c~~~~~~v~g~lp~~~~~l~~L~~L~L~~n~l~~--~~p~~~   77 (549)
                      +|++||++||+++.+|. .+++|+.+.+||.  |.||.|+...            ...+++.|+|++|.+++  .+|..|
T Consensus         6 ~~~~aL~~~k~~~~~~~-~l~~W~~~~~~C~~~w~gv~C~~~~------------~~~~l~~L~L~~~~l~~~~~~~~~l   72 (313)
T 1ogq_A            6 QDKQALLQIKKDLGNPT-TLSSWLPTTDCCNRTWLGVLCDTDT------------QTYRVNNLDLSGLNLPKPYPIPSSL   72 (313)
T ss_dssp             HHHHHHHHHHHHTTCCG-GGTTCCTTSCTTTTCSTTEEECCSS------------SCCCEEEEEEECCCCSSCEECCGGG
T ss_pred             HHHHHHHHHHHhcCCcc-cccCCCCCCCCCcCCCcceEeCCCC------------CCceEEEEECCCCCccCCcccChhH
Confidence            68899999999998876 8899988889998  9999997531            12367899999999998  899999


Q ss_pred             cCCCCCCEeeccc-ccccccCCcccccccCccceeeecccccccccccccCCCCCCCEEEeecceeeeeCCccccCCCCC
Q 039925           78 GRLFRLEYLLLAN-NHFSGKIPANLSHCSNLLTKLFICETHLSGQLLDFIGNPSAIQVMIFKENSLEGKFPNTLSNLRSL  156 (549)
Q Consensus        78 ~~l~~L~~L~Ls~-n~l~~~~p~~l~~l~~L~~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L  156 (549)
                      .++++|++|+|++ |.+.+.+|..|..+++| ++|++++|.+++.+|..|.++++|++|++++|.+++.+|..+..+++|
T Consensus        73 ~~l~~L~~L~L~~~n~l~~~~p~~l~~l~~L-~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L  151 (313)
T 1ogq_A           73 ANLPYLNFLYIGGINNLVGPIPPAIAKLTQL-HYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNL  151 (313)
T ss_dssp             GGCTTCSEEEEEEETTEESCCCGGGGGCTTC-SEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTC
T ss_pred             hCCCCCCeeeCCCCCcccccCChhHhcCCCC-CEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCC
Confidence            9999999999995 99999999999999999 999999999999999999999999999999999999999999999999


Q ss_pred             CEEecccCcceecccccccccc--cceeeCCCCcCcccCchhhhhcCCCCcEeeecccccccccccCcccccEEEccccc
Q 039925          157 FYDNINRNEFSGLIPSFIFNIS--LKWNFLPENSFTGNLPLEIGVTLPKGRNYYILLLAQKLYWSDVSTTATIIAMGGNQ  234 (549)
Q Consensus       157 ~~L~L~~n~l~~~~p~~~~~l~--L~~L~l~~n~l~~~~p~~~~~~l~~L~~L~l~~~~~~l~~l~~~~~L~~L~l~~n~  234 (549)
                      ++|++++|++++.+|..+..+.  |++|++++|.+++.+|..+. .+                      .|+.|++++|.
T Consensus       152 ~~L~L~~N~l~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~~~~~-~l----------------------~L~~L~Ls~N~  208 (313)
T 1ogq_A          152 VGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFA-NL----------------------NLAFVDLSRNM  208 (313)
T ss_dssp             CEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGG-GC----------------------CCSEEECCSSE
T ss_pred             CeEECcCCcccCcCCHHHhhhhhcCcEEECcCCeeeccCChHHh-CC----------------------cccEEECcCCc
Confidence            9999999999999999999885  99999999999988888776 21                      38899999999


Q ss_pred             cccccChhhhhccccCccEEEcCCCcccccCCCcCccccCCccccCeeeccCccccccCCccccCCCCCCEEEccCCccc
Q 039925          235 ISGTITLGIKKLIFVNLYALTMVKNKLSGPIPHHIASSLGNLTLLTYLALDNNKLQGNLPSSLGYYQNLMELSVSRNKLS  314 (549)
Q Consensus       235 l~~~~~~~~~~l~~~~L~~L~L~~n~l~~~~p~~l~~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~  314 (549)
                      +++..|..+..+  ++|+.|++++|.+++.+     ..+..+++|++|+|++|++++.+|..+..+++|+.|+|++|+++
T Consensus       209 l~~~~~~~~~~l--~~L~~L~L~~N~l~~~~-----~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~  281 (313)
T 1ogq_A          209 LEGDASVLFGSD--KNTQKIHLAKNSLAFDL-----GKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLC  281 (313)
T ss_dssp             EEECCGGGCCTT--SCCSEEECCSSEECCBG-----GGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEE
T ss_pred             ccCcCCHHHhcC--CCCCEEECCCCceeeec-----CcccccCCCCEEECcCCcccCcCChHHhcCcCCCEEECcCCccc
Confidence            999999999999  99999999999998655     23788999999999999999999999999999999999999999


Q ss_pred             ccCCCCCCCCCCCcccCCcccccccceeeecCCCCCCCCc
Q 039925          315 ASLPPLNSQHNHSFSCPGFEFSVIKLEFQIPGNKKLCGGL  354 (549)
Q Consensus       315 ~~~p~~~ls~N~~~~ip~~~~~~l~l~~~~~gn~~~c~~~  354 (549)
                      |.+|..       +.     +..+.. +.+.+|+.+|+.+
T Consensus       282 ~~ip~~-------~~-----l~~L~~-l~l~~N~~lc~~p  308 (313)
T 1ogq_A          282 GEIPQG-------GN-----LQRFDV-SAYANNKCLCGSP  308 (313)
T ss_dssp             EECCCS-------TT-----GGGSCG-GGTCSSSEEESTT
T ss_pred             ccCCCC-------cc-----ccccCh-HHhcCCCCccCCC
Confidence            988863       01     223332 6789999999864
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 549
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-20
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-06
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 0.001
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 0.003
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 89.0 bits (219), Expect = 4e-20
 Identities = 69/324 (21%), Positives = 105/324 (32%), Gaps = 26/324 (8%)

Query: 1   ETDHLALLAIKSLLHDRRGVTSSWSNSIDLCQ--WRGVTCTHQHQRINKCLTPHVGNFGY 58
             D  ALL IK  L +     SSW  + D C   W GV C                    
Sbjct: 5   PQDKQALLQIKKDLGNP-TTLSSWLPTTDCCNRTWLGVLCDTD------------TQTYR 51

Query: 59  LRFINLVDNNFRG--EIPEKVGRLFRLEYLLLANNHFSGKIPANLSHCSNLLTKLFICET 116
           +  ++L   N      IP  +  L  L +L +   +               L  L+I  T
Sbjct: 52  VNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHT 111

Query: 117 HLSGQLLDFIGNPSAIQVMIFKENSLEGKFPNTLSNLRSLFYDNINRNEFSGLIPSFIFN 176
           ++SG + DF+     +  + F  N+L G  P ++S+L +L     + N  SG IP    +
Sbjct: 112 NVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGS 171

Query: 177 I--SLKWNFLPENSFTGNLPLEIGVTLPKGRNYYILLLAQKLYWSDVSTTATIIAMGGNQ 234
                    +  N  TG +P           +    +L         S   T        
Sbjct: 172 FSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKN 231

Query: 235 ISGTITLGIKKLIFVNLYALTMVKNKLSGPIPHHIASSLGNLTLLTYLALDNNKLQGNLP 294
                   +     +N   L    N++ G +P      L  L  L  L +  N L G +P
Sbjct: 232 SLAFDLGKVGLSKNLNGLDLRN--NRIYGTLP----QGLTQLKFLHSLNVSFNNLCGEIP 285

Query: 295 SSLGYYQNLMELSVSRNKLSASLP 318
              G  Q     + + NK     P
Sbjct: 286 -QGGNLQRFDVSAYANNKCLCGSP 308
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query549
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.87
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.85
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.79
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.77
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.77
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.76
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.76
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.75
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.75
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.74
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.73
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.73
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.73
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.72
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.71
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.71
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.7
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.7
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.68
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.68
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.67
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.67
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.65
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.62
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.6
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.6
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.58
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.55
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 99.54
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.54
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.53
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.53
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.52
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.52
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.52
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.51
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.51
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.51
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 99.49
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.49
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 99.49
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 99.48
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.48
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.47
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.46
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.46
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 99.46
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.41
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.37
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.36
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.36
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.35
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.35
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.34
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.33
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.32
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.31
d1ua2a_ 299 Cell division protein kinase 7, CDK7 {Human (Homo 99.31
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.3
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.27
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.27
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.26
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.26
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.25
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.24
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.23
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.22
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.19
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.19
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.19
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.12
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 99.09
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 98.67
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.33
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.31
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.79
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 97.77
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.69
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.25
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.09
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=3.7e-41  Score=332.02  Aligned_cols=297  Identities=28%  Similarity=0.438  Sum_probs=261.2

Q ss_pred             ChhHHHHHHHHhhcCCCCCCCCCCCCCCCCC--CCCcceeCCCCCceEeecCccccCCCCCCEEEccCCccee--cCCcc
Q 039925            1 ETDHLALLAIKSLLHDRRGVTSSWSNSIDLC--QWRGVTCTHQHQRINKCLTPHVGNFGYLRFINLVDNNFRG--EIPEK   76 (549)
Q Consensus         1 ~~~~~~l~~~~~~~~~~~~~~~~w~~~~~~c--~w~gv~c~~~~~~v~g~lp~~~~~l~~L~~L~L~~n~l~~--~~p~~   76 (549)
                      ++|++||++||+++.+|. .+++|+.++|||  .|.||.|+....            -.+++.|+|++|.+++  .+|++
T Consensus         5 ~~e~~aLl~~k~~~~~~~-~l~sW~~~~d~C~~~w~gv~C~~~~~------------~~~v~~L~L~~~~l~g~~~lp~~   71 (313)
T d1ogqa_           5 PQDKQALLQIKKDLGNPT-TLSSWLPTTDCCNRTWLGVLCDTDTQ------------TYRVNNLDLSGLNLPKPYPIPSS   71 (313)
T ss_dssp             HHHHHHHHHHHHHTTCCG-GGTTCCTTSCTTTTCSTTEEECCSSS------------CCCEEEEEEECCCCSSCEECCGG
T ss_pred             HHHHHHHHHHHHHCCCCC-cCCCCCCCCCCCCCcCCCeEEeCCCC------------cEEEEEEECCCCCCCCCCCCChH
Confidence            369999999999998875 799999899999  499999975321            1246689999999987  58999


Q ss_pred             ccCCCCCCEeeccc-ccccccCCcccccccCccceeeecccccccccccccCCCCCCCEEEeecceeeeeCCccccCCCC
Q 039925           77 VGRLFRLEYLLLAN-NHFSGKIPANLSHCSNLLTKLFICETHLSGQLLDFIGNPSAIQVMIFKENSLEGKFPNTLSNLRS  155 (549)
Q Consensus        77 ~~~l~~L~~L~Ls~-n~l~~~~p~~l~~l~~L~~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~  155 (549)
                      ++++++|++|+|++ |+++|.+|..|+++++| ++|+|++|++.+..+..+..+.+|+++++++|.+.+.+|..+.++++
T Consensus        72 l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L-~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~  150 (313)
T d1ogqa_          72 LANLPYLNFLYIGGINNLVGPIPPAIAKLTQL-HYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPN  150 (313)
T ss_dssp             GGGCTTCSEEEEEEETTEESCCCGGGGGCTTC-SEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTT
T ss_pred             HhcCcccccccccccccccccccccccccccc-chhhhccccccccccccccchhhhcccccccccccccCchhhccCcc
Confidence            99999999999997 88999999999999999 99999999999999999999999999999999999999999999999


Q ss_pred             CCEEecccCcceecccccccccc--cceeeCCCCcCcccCchhhhhcCCCCcEeeecccccccccccCcccccEEEcccc
Q 039925          156 LFYDNINRNEFSGLIPSFIFNIS--LKWNFLPENSFTGNLPLEIGVTLPKGRNYYILLLAQKLYWSDVSTTATIIAMGGN  233 (549)
Q Consensus       156 L~~L~L~~n~l~~~~p~~~~~l~--L~~L~l~~n~l~~~~p~~~~~~l~~L~~L~l~~~~~~l~~l~~~~~L~~L~l~~n  233 (549)
                      |+++++++|.+.+.+|..+..+.  ++.+++++|++++..|..+. .+                      ....++++.+
T Consensus       151 L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~-~l----------------------~~~~l~l~~~  207 (313)
T d1ogqa_         151 LVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFA-NL----------------------NLAFVDLSRN  207 (313)
T ss_dssp             CCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGG-GC----------------------CCSEEECCSS
T ss_pred             cceeecccccccccccccccccccccccccccccccccccccccc-cc----------------------cccccccccc
Confidence            99999999999999999998887  69999999999988887765 22                      3557889999


Q ss_pred             ccccccChhhhhccccCccEEEcCCCcccccCCCcCccccCCccccCeeeccCccccccCCccccCCCCCCEEEccCCcc
Q 039925          234 QISGTITLGIKKLIFVNLYALTMVKNKLSGPIPHHIASSLGNLTLLTYLALDNNKLQGNLPSSLGYYQNLMELSVSRNKL  313 (549)
Q Consensus       234 ~l~~~~~~~~~~l~~~~L~~L~L~~n~l~~~~p~~l~~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l  313 (549)
                      .+.+.+|..+..+  ++++.+++++|.+.+.+     ..+..+++|+.|+|++|+++|.+|..|+++++|++|+|++|+|
T Consensus       208 ~~~~~~~~~~~~~--~~l~~l~~~~~~l~~~~-----~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l  280 (313)
T d1ogqa_         208 MLEGDASVLFGSD--KNTQKIHLAKNSLAFDL-----GKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNL  280 (313)
T ss_dssp             EEEECCGGGCCTT--SCCSEEECCSSEECCBG-----GGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEE
T ss_pred             ccccccccccccc--ccccccccccccccccc-----cccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcc
Confidence            9999999998888  99999999999998654     3578899999999999999999999999999999999999999


Q ss_pred             cccCCCCCCCCCCCcccCCcccccccceeeecCCCCCCCCc
Q 039925          314 SASLPPLNSQHNHSFSCPGFEFSVIKLEFQIPGNKKLCGGL  354 (549)
Q Consensus       314 ~~~~p~~~ls~N~~~~ip~~~~~~l~l~~~~~gn~~~c~~~  354 (549)
                      +|.+|..   .         -++.++. +.+.||+.+||.+
T Consensus       281 ~g~iP~~---~---------~L~~L~~-l~l~~N~~l~g~p  308 (313)
T d1ogqa_         281 CGEIPQG---G---------NLQRFDV-SAYANNKCLCGSP  308 (313)
T ss_dssp             EEECCCS---T---------TGGGSCG-GGTCSSSEEESTT
T ss_pred             cccCCCc---c---------cCCCCCH-HHhCCCccccCCC
Confidence            9988852   0         1333433 6789999999974
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure