Citrus Sinensis ID: 039954

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------58
MHDLISDLAQWAAEEIYFTMEYTSEVNKQQSFSENLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVMLSNSEPGYLAPSILPKLLKLQRLRVFSLRGYRIPELPDSVGDLRYLRYLNLSGTEIRTLPESVNKLYNLHSLLLEDCWELEKLCADMGNLAKLHHLKNSNTKSLEEMPVGIGRLTCLQTLCNFVVGNGSGSGLSELKLLMHLRGALEISKLENVKDVGNAKEARGYGGTNFPAWLGDSSFSNLVTLKFKNCDMCTALPSVGQLPSLTHLAVCGMSRVKRLGSEFYGNDAPIPFPCLETLHFEDMQGWEDWIPHGSSQGVERFPKLRELHILRCSKLQGTFPEHLPALEKLSLYVYGCSKLESIAERLDNNTSLETIRIFNCGNLKTLPSGLHNLGQLQEIRIQKCRNLESFPEGGLPCAKLTRLTILDCKRLEALPKGLHNLTSLQELTIGGELPSLEEDGLPTNLHSMIERGRGFHRFSSLRQLAIINCDDDMVSFPPKADDKGSGTALPLPASLTSLMINNFPNLERLSSSIVDLQNLTILQLYNCPKLKYFPEKGLPSSLLELDINR
ccHHHHHHHHHHHHHHEEEEEEcccccccccccccEEEEEEEEcccccccccccccccccccEEEEccccccccccccccHHHHccccccEEEEEEcccccccccccccccccccEEEccccccccccccccccccccEEEcccccccHHHHHHccccccccEEEcccccccccccccccccccccccccEEEccccccccHHccccccccccEEEccccccccccHHHHHcccccccccccccccccccccEEEEEccccccccccccccccccEEEEEcccccEEccccccccccccccccccEEEccccccccccccccccccccccccccEEEEccccccccccccccccccEEEEEEccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEccccccccccccccccccccEEEEccccccccccccccccHHHHHccccccccccccEEEEccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEEc
ccHHHHHHHHHHHccEEEEEEcccccccccccccccEEEEEEEcccccccccccccccccccEEEcccccccccccccccHHHHHcccccEEEEEEcccccccccccccccccccEEEccccccccccccccccccccEEEEcccccHcccccHccccccccEEEEcccccHccccccccccccccEEEEEEccccccccHHHHHcHHHcccccccccccccccHHHHHHHccccccccccccccccccccEEEEEcccccccccccccccccHcEEEEccccccEEccHHHcccccccccccHcEEEEcccHHHHccccccccccccccccccEEEEccccHHcccccccccccHHEEEEHccccccccccccccccccccEEEEcccccHccccHHccccccccEEEEccccccccccccccccccccEEEEcccccHccccccccccccccEEEEccccccccccccccccHHcccccccccccccccEEEcccccccccccccccccccccccccccccccEEEEcccccHHHccHHccccccccEEEEcccccccccccccccccccEEEEcc
MHDLISDLAQWAAEEIYFTMEYTSEVNKQQSFSENLRHLSYirgdydgvqrfgdlydIQHLRTFLpvmlsnsepgylapsilpkLLKLQRLRVFSlrgyripelpdsvgdlrYLRYLNlsgteirtlPESVNKLYNLHSLLLEDCWELEKLCADMGNLaklhhlknsntksleempvgigRLTCLQTLCNfvvgngsgsglSELKLLMHLRGAleisklenvkdvgnakeargyggtnfpawlgdssfsnlvtlkfkncdmctalpsvgqlpslthlAVCGMSRvkrlgsefygndapipfpcletlhfedmqgwedwiphgssqgverfpklRELHILRCSKlqgtfpehlpaleKLSLYVYGCSKLESIAErldnntsletirifncgnlktlpsglhnlgQLQEIRIQKCrnlesfpegglpcakltrltildckrlealpkglhnltslqeltiggelpsleedglptnlHSMIErgrgfhrfsSLRQLAIincdddmvsfppkaddkgsgtalplpasltslminnfpnlerlsssivdlqnltilqlyncpklkyfpekglpsslleldinr
MHDLISDLAQWAAEEIYFTMEYTSEVNKQQSFSENLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVMLSNSEPGYLAPSILPKLLKLQRLRVFSLRgyripelpdsvgdlrYLRYLNLSGTEIRTLPESVNKLYNLHSLLLEDCWELEKLCADMGNLAKLHHLKNSNTKSLEEMPVGIGRLTCLQTLCNFVVGNGSGSGLSELKLLMHLRGALeisklenvkdvgNAKEARGYGGTNFPAWLGDSSFSNLVTLKFKNCDMCTALPSVGQLPSLTHLAVCGMSRVKRLGSEFYGNDAPIPFPCLETLHFEDMQGWEDWIPHGSSQGVERFPKLRELHILRCSKLQGTFPEHLPALEKLSLYVYGCSKLESIAERLDNNTSLETIRIFNCGNLKTLPSGLHNLGQLQEIRIQKCRNLESFpegglpcakltRLTILDCKRLEALPKGLHNLTSLQELTIGGELPSLEEDGLPTNLHSMIERGRGFHRFSSLRQLAIINCDDDMVSFPPKADDKGSGTALPLPASLTSLMINNFPNLERLSSSIVDLQNLTILQLYNCPKlkyfpekglpsslleldinr
MHDLISDLAQWAAEEIYFTMEYTSEVNKQQSFSENLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVMLSNSEPGYLAPSILPKLLKLQRLRVFSLRGYRIPELPDSVGDLRYLRYLNLSGTEIRTLPESVNKLYNLHSLLLEDCWELEKLCADMGNLAKLHHLKNSNTKSLEEMPVGIGRLTCLQTLCNFVVgngsgsglselkllMHLRGALEISKLENVKDVGNAKEARGYGGTNFPAWLGDSSFSNLVTLKFKNCDMCTALPSVGQLPSLTHLAVCGMSRVKRLGSEFYGNDAPIPFPCLETLHFEDMQGWEDWIPHGSSQGVERFPKLRELHILRCSKLQGTFPEHLPALEKLSLYVYGCSKLESIAERLDNNTSLETIRIFNCGNLKTLPSGLHNLGQLQEIRIQKCRNLESFPEGGLPCAKLTRLTILDCKRLEALPKGLHNLTSLQELTIGGELPSLEEDGLPTNLHSMIERGRGFHRFSSLRQLAIINCDDDMVSFPPKADDKGSGTALPLPASLTSLMINNFPNLERLSSSIVDLQNLTILQLYNCPKLKYFPEKGLPSSLLELDINR
****ISDLAQWAAEEIYFTMEYTSEVNKQQSFSENLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVMLSNSEPGYLAPSILPKLLKLQRLRVFSLRGYRIPELPDSVGDLRYLRYLNLSGTEIRTLPESVNKLYNLHSLLLEDCWELEKLCADMGNLAKLHHLKNSNTKSLEEMPVGIGRLTCLQTLCNFVVGNGSGSGLSELKLLMHLRGALEISKLENVKDVGNAKEARGYGGTNFPAWLGDSSFSNLVTLKFKNCDMCTALPSVGQLPSLTHLAVCGMSRVKRLGSEFYGNDAPIPFPCLETLHFEDMQGWEDWIPHGSSQGVERFPKLRELHILRCSKLQGTFPEHLPALEKLSLYVYGCSKLESIAERLDNNTSLETIRIFNCGNLKTLPSGLHNLGQLQEIRIQKCRNLESFPEGGLPCAKLTRLTILDCKRLEALPKGLHNLTSLQELTIGGEL*********TNLHSMIERGRGFHRFSSLRQLAIINCDDDMV******************ASLTSLMINNFPNLERLSSSIVDLQNLTILQLYNCPKLKYFPEK*************
MHDLISDLAQWAAEEIYFTMEYTSEVNKQQSFSENLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVMLSNSEPGYLAPSILPKLLKLQRLRVFSLRGYRIPELPDSVGDLRYLRYLNLSGTEIRTLPESVNKLYNLHSLLLEDCWELEKLCADMGNLAKLHHLKNSNTKSLEEMPVGIGRLTCLQTLCNFVVGNGSGSGLSELKLLMHLRGALEISKLENVKDVGNAKEARGYGGTNFPAWLGDSSFSNLVTLKFKNCDMCTALPSVGQLPSLTHLAVCGMSRVKRLGSEFYGNDAPIPFPCLETLHFEDMQGWEDWIPHGSSQGVERFPKLRELHILRCSKLQGTFPEHLPALEKLSLYVYGCSKLESIAERLDNNTSLETIRIFNCGNLKTLPSGLHNLGQLQEIRIQKCRNLESFPEGGLPCAKLTRLTILDCKRLEALPKGLHNLTSLQELTIGGELPSLEEDGLPTNLHSMIERGRGFHRFSSLRQLAIINCDDDMVSFPPKADDKGSGTALPLPASLTSLMINNFPNLERLSSSIVDLQNLTILQLYNCPKLKYFPEKGLPSSLLELDINR
MHDLISDLAQWAAEEIYFTMEYTSEVNKQQSFSENLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVMLSNSEPGYLAPSILPKLLKLQRLRVFSLRGYRIPELPDSVGDLRYLRYLNLSGTEIRTLPESVNKLYNLHSLLLEDCWELEKLCADMGNLAKLHHLKNSNTKSLEEMPVGIGRLTCLQTLCNFVVGNGSGSGLSELKLLMHLRGALEISKLENVKDVGNAKEARGYGGTNFPAWLGDSSFSNLVTLKFKNCDMCTALPSVGQLPSLTHLAVCGMSRVKRLGSEFYGNDAPIPFPCLETLHFEDMQGWEDWIPHGSSQGVERFPKLRELHILRCSKLQGTFPEHLPALEKLSLYVYGCSKLESIAERLDNNTSLETIRIFNCGNLKTLPSGLHNLGQLQEIRIQKCRNLESFPEGGLPCAKLTRLTILDCKRLEALPKGLHNLTSLQELTIGGELPSLEEDGLPTNLHSMIERGRGFHRFSSLRQLAIINCDDDMVSFPP********TALPLPASLTSLMINNFPNLERLSSSIVDLQNLTILQLYNCPKLKYFPEKGLPSSLLELDINR
*HDLISDLAQWAAEEIYFTMEYTSEVNKQQSFSENLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVMLSNSEPGYLAPSILPKLLKLQRLRVFSLRGYRIPELPDSVGDLRYLRYLNLSGTEIRTLPESVNKLYNLHSLLLEDCWELEKLCADMGNLAKLHHLKNSNTKSLEEMPVGIGRLTCLQTLCNFVVGNGSGSGLSELKLLMHLRGALEISKLENVKDVGNAKEARGYGGTNFPAWLGDSSFSNLVTLKFKNCDMCTALPSVGQLPSLTHLAVCGMSRVKRLGSEFYGNDAPIPFPCLETLHFEDMQGWEDWIPHGSSQGVERFPKLRELHILRCSKLQGTFPEHLPALEKLSLYVYGCSKLESIAERLDNNTSLETIRIFNCGNLKTLPSGLHNLGQLQEIRIQKCRNLESFPEGGLPCAKLTRLTILDCKRLEALPKGLHNLTSLQELTIGGELPSLEEDGLPTNLHSMIERGRGFHRFSSLRQLAIINCDDDMVSFPPKADDKGSGTALPLPASLTSLMINNFPNLERLSSSIVDLQNLTILQLYNCPKLKYFPEKGLPSSLLELDIN*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHDLISDLAQWAAEEIYFTMEYTSEVNKQQSFSENLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVMLSNSEPGYLAPSILPKLLKLQRLRVFSLRGYRIPELPDSVGDLRYLRYLNLSGTEIRTLPESVNKLYNLHSLLLEDCWELEKLCADMGNLAKLHHLKNSNTKSLEEMPVGIGRLTCLQTLCNFVVGNGSGSGLSELKLLMHLRGALEISKLENVKDVGNAKEARGYGGTNFPAWLGDSSFSNLVTLKFKNCDMCTALPSVGQLPSLTHLAVCGMSRVKRLGSEFYGNDAPIPFPCLETLHFEDMQGWEDWIPHGSSQGVERFPKLRELHILRCSKLQGTFPEHLPALEKLSLYVYGCSKLESIAERLDNNTSLETIRIFNCGNLKTLPSGLHNLGQLQEIRIQKCRNLESFPEGGLPCAKLTRLTILDCKRLEALPKGLHNLTSLQELTIGGELPSLEEDGLPTNLHSMIERGRGFHRFSSLRQLAIINCDDDMVSFPPKADDKGSGTALPLPASLTSLMINNFPNLERLSSSIVDLQNLTILQLYNCPKLKYFPEKGLPSSLLELDINR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query578 2.2.26 [Sep-21-2011]
Q9LRR41054 Putative disease resistan yes no 0.752 0.412 0.348 2e-62
Q9LRR5 1424 Putative disease resistan no no 0.610 0.247 0.350 6e-54
Q7XBQ9970 Disease resistance protei N/A no 0.673 0.401 0.334 3e-44
Q7XA39988 Putative disease resistan N/A no 0.638 0.373 0.311 5e-42
Q7XA42979 Putative disease resistan N/A no 0.695 0.410 0.297 1e-37
Q7XA40992 Putative disease resistan N/A no 0.704 0.410 0.305 2e-37
P0CB16 1201 Putative disease resistan no no 0.685 0.329 0.254 4e-12
P26337630 Putative adenylate cyclas N/A no 0.754 0.692 0.248 3e-09
P0DI181049 Probable disease resistan no no 0.610 0.336 0.266 4e-09
P0DI171049 Probable disease resistan no no 0.610 0.336 0.266 4e-09
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function desciption
 Score =  240 bits (613), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 178/511 (34%), Positives = 261/511 (51%), Gaps = 76/511 (14%)

Query: 1   MHDLISDLAQWAAEEIYFTMEYTSEVNKQQSFSENLRHLSYIRGDYDGVQRFGDLYDIQH 60
           MHD I++LAQ+A+ E  F+ ++      Q   SE  R+LSY+R +Y     F  L +++ 
Sbjct: 492 MHDFINELAQFASGE--FSSKFEDGCKLQ--VSERTRYLSYLRDNYAEPMEFEALREVKF 547

Query: 61  LRTFLPVMLSNSEPGY-LAPSILPKLL-KLQRLRVFSLRGYRIPELP-DSVGDLRYLRYL 117
           LRTFLP+ L+NS     L   +  KLL  L RLRV SL  Y+I  LP D   ++ + R+L
Sbjct: 548 LRTFLPLSLTNSSRSCCLDQMVSEKLLPTLTRLRVLSLSHYKIARLPPDFFKNISHARFL 607

Query: 118 NLSGTEIRTLPESVNKLYNLHSLLLEDCWELEKLCADMGNLAKLHHLKNSNTKSLEEMPV 177
           +LS TE+  LP+S+  +YNL +LLL  C  L++L  D+ NL  L +L    TK L +MP 
Sbjct: 608 DLSRTELEKLPKSLCYMYNLQTLLLSYCSSLKELPTDISNLINLRYLDLIGTK-LRQMPR 666

Query: 178 GIGRLTCLQTLCNFVVGNGSGSGLSELKLLMHLRGALEISKLENVKDVG-------NAKE 230
             GRL  LQTL  F V    GS +SEL  L  L G L+I +L+ V DV        N+K+
Sbjct: 667 RFGRLKSLQTLTTFFVSASDGSRISELGGLHDLHGKLKIVELQRVVDVADAAEANLNSKK 726

Query: 231 ---------------------------------------------ARGYGGTNFPAWLGD 245
                                                           Y G  FP WL D
Sbjct: 727 HLREIDFVWRTGSSSSENNTNPHRTQNEAEVFEKLRPHRHIEKLAIERYKGRRFPDWLSD 786

Query: 246 SSFSNLVTLKFKNCDMCTALPSVGQLPSLTHLAVCGMSRVKRLGSEFYGN------DAPI 299
            SFS +V ++ + C  CT+LPS+GQLP L  L + GM  ++ +G +FY +          
Sbjct: 787 PSFSRIVCIRLRECQYCTSLPSLGQLPCLKELHISGMVGLQSIGRKFYFSDQQLRDQDQQ 846

Query: 300 PFPCLETLHFEDMQGWEDWIPHGSSQGVERFPKLRELHILRCSKLQGTFPEHLPALEKLS 359
           PF  LETL F+++  W++W+    ++G + FP L++L ILRC +L GT P  LP+L  +S
Sbjct: 847 PFRSLETLRFDNLPDWQEWLDVRVTRG-DLFPSLKKLFILRCPELTGTLPTFLPSL--IS 903

Query: 360 LYVYGCSKLESIAERLD-NNTSLETIRI-FNCGNLKTLPSGLHNLGQLQEIRIQKCRNLE 417
           L++Y C  L+   +  + +  +L+T+ I  +C  L   P  L++   L ++ + +C +L 
Sbjct: 904 LHIYKCGLLDFQPDHHEYSYRNLQTLSIKSSCDTLVKFP--LNHFANLDKLEVDQCTSLY 961

Query: 418 SFP---EGGLPCAKLTRLTILDCKRLEALPK 445
           S     E       L  L I DC+ L+ LPK
Sbjct: 962 SLELSNEHLRGPNALRNLRINDCQNLQLLPK 992
Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description
>sp|P26337|ESA8C_TRYEQ Putative adenylate cyclase regulatory protein OS=Trypanosoma equiperdum GN=ESAG8C PE=2 SV=1 Back     alignment and function description
>sp|P0DI18|DRL45_ARATH Probable disease resistance protein RDL6 OS=Arabidopsis thaliana GN=RDL6 PE=2 SV=1 Back     alignment and function description
>sp|P0DI17|DRL11_ARATH Probable disease resistance protein RF9 OS=Arabidopsis thaliana GN=RF9 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query578
296090374 908 unnamed protein product [Vitis vinifera] 0.937 0.596 0.380 2e-95
284026888 1424 CC-NBS-LRR protein [Quercus suber] 0.963 0.391 0.367 1e-94
359487225 1373 PREDICTED: putative disease resistance R 0.967 0.407 0.388 2e-92
359487247 1944 PREDICTED: putative disease resistance p 0.951 0.282 0.372 2e-92
147785815 1662 hypothetical protein VITISV_003572 [Viti 0.951 0.330 0.374 6e-92
225449959 1350 PREDICTED: putative disease resistance p 0.946 0.405 0.374 7e-92
147825318 1824 hypothetical protein VITISV_003723 [Viti 0.941 0.298 0.376 2e-90
296083967 730 unnamed protein product [Vitis vinifera] 0.967 0.765 0.362 8e-88
225465831 1483 PREDICTED: putative disease resistance R 0.972 0.378 0.364 5e-87
297742879 1058 unnamed protein product [Vitis vinifera] 0.956 0.522 0.380 4e-86
>gi|296090374|emb|CBI40193.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  356 bits (913), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 259/681 (38%), Positives = 349/681 (51%), Gaps = 139/681 (20%)

Query: 1   MHDLISDLAQWAAEEIYFTMEYTSEVNKQQSFSENLRHLSYIRGDYDGVQRFGDLYDIQH 60
           MHDLI+DLAQ+ +EEI F +E + + N++ +FS ++RH S+ R  Y+  ++F D Y  ++
Sbjct: 175 MHDLINDLAQYVSEEICFHLEDSLDSNQKHTFSGSVRHSSFARCKYEVFRKFEDFYKAKN 234

Query: 61  LRTFL--PVMLSNSEPGYLAPSILPKLL-KLQRLRVFSLRGYRIPELPDSVGDLRYLRYL 117
           LRTFL  P+ +   +  +L   +   LL KL+ LRV SL  Y I ELP+S+GDL++LRYL
Sbjct: 235 LRTFLALPIHMQYYDFFHLTDKVSHDLLPKLRYLRVLSLSHYEIRELPNSIGDLKHLRYL 294

Query: 118 NLSGTEIRTLPESVNKLYNLHSLLLEDCWELEKLCADMGNLAKLHHLKNSNTKSLEEMPV 177
           NLS T I+ LP+S++ L+NL +L+L  C  L +L     NL  L HL  ++T  LE MP 
Sbjct: 295 NLSCTIIQELPDSLSDLHNLQTLVLFRCRRLNRLPRGFKNLINLRHLDIAHTHQLEVMPP 354

Query: 178 GIGRLTCLQTLCNFVVGNGSGSGLSELKLLMHLRGALEISKLENVKDVGNAKEA------ 231
            +G+L  LQTL  F+VG     G+ EL  L+HLRG L I  L+NV D+ +A++A      
Sbjct: 355 QMGKLKSLQTLSKFIVGKSKELGIKELGDLLHLRGKLSILDLQNVVDIQDARDANLKDKH 414

Query: 232 -----------------------------------------RGYGGTNFPAWLGDSSFSN 250
                                                    + YGG  FP W+GD SFS 
Sbjct: 415 HLEELLMEWSSNMFDDSQNETIELNVLHFLQPNTNLKKLTIQSYGGLTFPYWIGDPSFSK 474

Query: 251 LVTLKFKNCDMCTALPSVGQLPSLTHLAVCGMSRVKRLGSEFYGNDAPI--PFPCLETLH 308
           +V L+   C  CT LPS+G+L SL  L V GM  VK +G EFYG  +    PFP LE L 
Sbjct: 475 MVCLELNYCRKCTLLPSLGRLSSLKKLCVKGMQGVKSVGIEFYGEPSLCVKPFPSLEFLR 534

Query: 309 FEDMQGWEDWIPHGSSQGVERFPKLRELHILRCSKLQGTFPEHLPALEKLSLYVYGCSKL 368
           FEDM  WE+W         E +P+LREL I  C KL    P HLP+L KL   +  C KL
Sbjct: 535 FEDMPEWEEWC------SSESYPRLRELEIHHCPKLIQKLPSHLPSLVKLD--IIDCPKL 586

Query: 369 ESIAERLDNNTSLETIRIFNCGNLKTLPSGLHNLGQLQEIRIQKCRNLES-----FP--- 420
            +         +LE + I  C +L+ LP GL +L  L+E+ IQKC  L S     FP   
Sbjct: 587 VAPLPNQPLPCNLEYLEINKCASLEKLPIGLQSLTSLRELSIQKCPKLCSLAEMDFPPML 646

Query: 421 -----------EGGLP----------CAKLTRLT------------ILDCKRLEALPKGL 447
                      EG LP          C +L  ++            I DCK L++LP  +
Sbjct: 647 ISLELYDCEGLEGLLPSTMKRLEIRNCKQLESISLGFSSPNLKMLHIDDCKNLKSLPLQM 706

Query: 448 HNLTSLQELTIGG--ELPSLEEDGLPTNLHSMIERG----------RGFHRFSSLRQLAI 495
            + TSL++L I     L S  E+GL  NL S   R            G H  +SL+   I
Sbjct: 707 QSFTSLRDLRIYDCPNLVSFAEEGLSLNLTSFWIRNCKNLKMPLYQWGLHGLTSLQTFVI 766

Query: 496 IN----CDDDMVSFPPKADDKGSGTALP-LPASLTSLMINNFPNLERLSSSIVDLQNLT- 549
            N    CD D               +LP LP +LT L I+ F NLE LSS  + LQNLT 
Sbjct: 767 NNVAPFCDHD---------------SLPLLPRTLTYLSISKFHNLESLSS--MGLQNLTS 809

Query: 550 --ILQLYNCPKLKYF-PEKGL 567
             IL++Y+CPKL+ F P++GL
Sbjct: 810 LEILEIYSCPKLQTFLPKEGL 830

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|284026888|gb|ADB66335.1| CC-NBS-LRR protein [Quercus suber] Back     alignment and taxonomy information
>gi|359487225|ref|XP_002268551.2| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487247|ref|XP_003633546.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147785815|emb|CAN66378.1| hypothetical protein VITISV_003572 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225449959|ref|XP_002271030.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147825318|emb|CAN73260.1| hypothetical protein VITISV_003723 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296083967|emb|CBI24355.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225465831|ref|XP_002264750.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297742879|emb|CBI35644.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query578
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.391 0.158 0.381 1e-65
TAIR|locus:20916721054 AT3G14470 [Arabidopsis thalian 0.669 0.367 0.307 6.4e-36
UNIPROTKB|O486471802 O48647 "XA1" [Oryza sativa (ta 0.346 0.110 0.315 1.6e-20
TAIR|locus:22058041556 AT1G27180 [Arabidopsis thalian 0.638 0.237 0.281 1.4e-15
TAIR|locus:22058241384 AT1G27170 [Arabidopsis thalian 0.633 0.264 0.273 2e-15
TAIR|locus:5049561841017 AT1G58807 "AT1G58807" [Arabido 0.603 0.343 0.285 3.2e-13
TAIR|locus:28270381017 AT1G59124 "AT1G59124" [Arabido 0.603 0.343 0.285 3.2e-13
TAIR|locus:2129236 1301 SNC1 "SUPPRESSOR OF NPR1-1, CO 0.553 0.245 0.265 4.1e-12
TAIR|locus:21634261187 TAO1 "target of AVRB operation 0.629 0.306 0.240 3e-12
TAIR|locus:5049561861138 AT1G58602 [Arabidopsis thalian 0.629 0.319 0.278 4.7e-12
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 316 (116.3 bits), Expect = 1.0e-65, Sum P(3) = 1.0e-65
 Identities = 89/233 (38%), Positives = 117/233 (50%)

Query:     1 MHDLISDLAQWAAEEIYFTMEYTSEVNKQQSFSENLRHLSYIRGDYDGVQRFGDLYDIQH 60
             MHDL++DLA+  + +  F +E   + N  +      RH S+ R   D    F  +   + 
Sbjct:   487 MHDLMNDLAKAVSGDFCFRLE---DDNIPE-IPSTTRHFSFSRSQCDASVAFRSICGAEF 542

Query:    61 LRTFLPVMLSNS-EPGYLAPSILPKLLK-LQRLRVFSLRGYRIPELPDSVGDLRYLRYLN 118
             LRT LP     S E   L   +L  LL  L  LR+ SL  Y+I  LP S+  L+ LRYL+
Sbjct:   543 LRTILPFNSPTSLESLQLTEKVLNPLLNALSGLRILSLSHYQITNLPKSLKGLKLLRYLD 602

Query:   119 LSGTEIRTLPESVNKLYNLHSLLLEDCWELEKLCADMGNLAKLHHLKNSNTKSLEEMPVG 178
             LS T+I+ LPE V  L NL +LLL +C +L  L   +  L  L  L    T  L EMP G
Sbjct:   603 LSSTKIKELPEFVCTLCNLQTLLLSNCRDLTSLPKSIAELINLRLLDLVGTP-LVEMPPG 661

Query:   179 IGRLTCLQTLCNFVVXXXXXXXXXXXXXXMHLRGALEISKLENVKDVGNAKEA 231
             I +L  LQ L NFV+               HLRG L IS+L+NV     AK+A
Sbjct:   662 IKKLRSLQKLSNFVIGRLSGAGLHELKELSHLRGTLRISELQNVAFASEAKDA 714
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956184 AT1G58807 "AT1G58807" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827038 AT1G59124 "AT1G59124" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129236 SNC1 "SUPPRESSOR OF NPR1-1, CONSTITUTIVE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956186 AT1G58602 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00028675001
SubName- Full=Chromosome chr13 scaffold_45, whole genome shotgun sequence; (802 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query578
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-12
PLN03210 1153 PLN03210, PLN03210, Resistant to P 3e-06
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-05
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 70.3 bits (172), Expect = 1e-12
 Identities = 79/275 (28%), Positives = 122/275 (44%), Gaps = 50/275 (18%)

Query: 328 ERF----PKLRELHI----LRCSKLQGTF-PEHL-------PALEKLSLYVYGCSKLESI 371
           E F    PKLR L      LRC  +   F PE+L         LEKL   V+  + L +I
Sbjct: 582 EGFDYLPPKLRLLRWDKYPLRC--MPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNI 639

Query: 372 AERLDNN----------TSLETIRIFNCGNLKTLPSGLHNLGQLQEIRIQKCRNLESFPE 421
             R   N          T+LET+++ +C +L  LPS +  L +L+++ + +C NLE  P 
Sbjct: 640 DLRGSKNLKEIPDLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPT 699

Query: 422 GGLPCAKLTRLTILDCKRLEALPKGLHNLTSLQELTIGGELPSLEEDGLPTNLHSMIERG 481
           G +    L RL +  C RL++ P      T++  L +     ++EE   P+NL       
Sbjct: 700 G-INLKSLYRLNLSGCSRLKSFPD---ISTNISWLDLDET--AIEE--FPSNLR------ 745

Query: 482 RGFHRFSSLRQLAIINCDDDMVSFPPKADDKGSGTALPLPASLTSLMINNFPNLERLSSS 541
                  +L +L +  C+        +         + L  SLT L +++ P+L  L SS
Sbjct: 746 -----LENLDELIL--CEMKSEKLWERVQPLTPLMTM-LSPSLTRLFLSDIPSLVELPSS 797

Query: 542 IVDLQNLTILQLYNCPKLKYFPEKGLPSSLLELDI 576
           I +L  L  L++ NC  L+  P      SL  LD+
Sbjct: 798 IQNLHKLEHLEIENCINLETLPTGINLESLESLDL 832

syringae 6; Provisional. Length = 1153
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 578
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.94
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.91
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.91
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.9
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.88
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.67
KOG4237498 consensus Extracellular matrix protein slit, conta 99.63
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.62
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.51
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.51
KOG0617264 consensus Ras suppressor protein (contains leucine 99.48
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.47
KOG4237498 consensus Extracellular matrix protein slit, conta 99.46
KOG0617264 consensus Ras suppressor protein (contains leucine 99.44
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.3
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.24
KOG4341483 consensus F-box protein containing LRR [General fu 99.11
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.01
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.81
KOG4341483 consensus F-box protein containing LRR [General fu 98.78
PRK15386 426 type III secretion protein GogB; Provisional 98.75
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.74
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.71
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.7
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.66
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.63
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.63
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.6
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.57
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.54
PRK15386 426 type III secretion protein GogB; Provisional 98.44
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.43
PLN03150623 hypothetical protein; Provisional 98.4
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.39
PLN03150623 hypothetical protein; Provisional 98.37
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.28
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.27
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.26
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.95
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.94
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.92
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.9
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.89
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.79
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.73
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.62
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.51
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.45
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.36
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.35
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.34
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.33
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.21
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.19
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.79
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.75
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.67
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.59
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.37
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.31
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.07
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.0
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.83
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.32
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.63
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.58
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.39
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.9
smart0037026 LRR Leucine-rich repeats, outliers. 91.9
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.41
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.09
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.63
smart0037026 LRR Leucine-rich repeats, outliers. 87.74
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.74
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 87.11
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 85.05
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.6e-36  Score=339.49  Aligned_cols=497  Identities=16%  Similarity=0.198  Sum_probs=272.8

Q ss_pred             CCeeEEEeeeCCCCccccccCccccccccEEeeeccCCCCCCCCCcCchhhhc-ccCcccEEEecCCCCC-ccCCccccc
Q 039954           34 ENLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVMLSNSEPGYLAPSILPKLL-KLQRLRVFSLRGYRIP-ELPDSVGDL  111 (578)
Q Consensus        34 ~~~r~ls~~~~~~~~~~~~~~~~~~~~Lr~L~~~~~~~~~~~~~~~~~~~~~~-~l~~Lr~L~L~~~~i~-~lp~~i~~l  111 (578)
                      .+++.+.+..+.+.... ...+..+++|++|.+.+      |.+...+|..++ .+++||+|++++|.++ .+|.  +.+
T Consensus        69 ~~v~~L~L~~~~i~~~~-~~~~~~l~~L~~L~Ls~------n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l  139 (968)
T PLN00113         69 SRVVSIDLSGKNISGKI-SSAIFRLPYIQTINLSN------NQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSI  139 (968)
T ss_pred             CcEEEEEecCCCccccC-ChHHhCCCCCCEEECCC------CccCCcCChHHhccCCCCCEEECcCCccccccCc--ccc
Confidence            46778888776654432 35677889999996543      455678888888 9999999999999885 3453  468


Q ss_pred             ccccEEeccCCCcc-cccccccCcCCccEEecCCCchhHHhhHHHhccccCcccccCCCCcccccCCCCCCcccccccCc
Q 039954          112 RYLRYLNLSGTEIR-TLPESVNKLYNLHSLLLEDCWELEKLCADMGNLAKLHHLKNSNTKSLEEMPVGIGRLTCLQTLCN  190 (578)
Q Consensus       112 ~~L~~L~L~~~~i~-~lp~~~~~l~~L~~L~l~~~~~~~~lp~~l~~l~~L~~L~l~~~~~~~~lp~~i~~l~~L~~L~~  190 (578)
                      ++|++|++++|.+. .+|..++.+++|++|++++|.....+|..++++++|++|++++|.+.+.+|..++++++|+.|..
T Consensus       140 ~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L  219 (968)
T PLN00113        140 PNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYL  219 (968)
T ss_pred             CCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEEC
Confidence            88999999998875 67888888999999999988766778888888999999999888877778888888888888854


Q ss_pred             ceeecCCCCCccccccccccccceeeccccC----------ccccchhhhhcCCCCCCCCCCcCCCCCCceeEEEeccCC
Q 039954          191 FVVGNGSGSGLSELKLLMHLRGALEISKLEN----------VKDVGNAKEARGYGGTNFPAWLGDSSFSNLVTLKFKNCD  260 (578)
Q Consensus       191 ~~~~~~~~~~~~~L~~l~~l~~~l~~~~~~~----------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~  260 (578)
                      ..... .......+..+.+++ .+.+....-          +..+.............+|.++..  +++|+.|++++|.
T Consensus       220 ~~n~l-~~~~p~~l~~l~~L~-~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~--l~~L~~L~Ls~n~  295 (968)
T PLN00113        220 GYNNL-SGEIPYEIGGLTSLN-HLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFS--LQKLISLDLSDNS  295 (968)
T ss_pred             cCCcc-CCcCChhHhcCCCCC-EEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhh--ccCcCEEECcCCe
Confidence            33221 122333344444444 333322110          000000000000001122333322  4455555555554


Q ss_pred             CCCCCC-CCCCCCCcceeeecCcCCceecCccccCCCCCCCCCCCCeeeeccCCCccccccCCCCCccccCcccceeecc
Q 039954          261 MCTALP-SVGQLPSLTHLAVCGMSRVKRLGSEFYGNDAPIPFPCLETLHFEDMQGWEDWIPHGSSQGVERFPKLRELHIL  339 (578)
Q Consensus       261 ~~~~~~-~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~  339 (578)
                      +.+.+| .+..+++|+.|++++|......+..      ...+++|+.|++.++....     ..+..++.+++|+.|+++
T Consensus       296 l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~------~~~l~~L~~L~L~~n~l~~-----~~p~~l~~~~~L~~L~Ls  364 (968)
T PLN00113        296 LSGEIPELVIQLQNLEILHLFSNNFTGKIPVA------LTSLPRLQVLQLWSNKFSG-----EIPKNLGKHNNLTVLDLS  364 (968)
T ss_pred             eccCCChhHcCCCCCcEEECCCCccCCcCChh------HhcCCCCCEEECcCCCCcC-----cCChHHhCCCCCcEEECC
Confidence            444433 3444555555555444322222211      1124555555555443111     111124445555555555


Q ss_pred             cccccccCCCCCCCCCcceE-EEEecCCchhhHHHhcCCCCCccEEEeecCCCCcccccCCCCCCCcceEEeccCCCccc
Q 039954          340 RCSKLQGTFPEHLPALEKLS-LYVYGCSKLESIAERLDNNTSLETIRIFNCGNLKTLPSGLHNLGQLQEIRIQKCRNLES  418 (578)
Q Consensus       340 ~~~~l~~~~~~~l~~l~~L~-l~~~~~~~l~~i~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~  418 (578)
                      +| .+.+.+|..+..+..|. +...++...+.+|..+..+++|+.|++++|.....+|..+..+++|+.|++++|...+.
T Consensus       365 ~n-~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~  443 (968)
T PLN00113        365 TN-NLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGR  443 (968)
T ss_pred             CC-eeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCc
Confidence            55 44444444333222222 12222222233555555666666666666655555555566666666666666655555


Q ss_pred             cCCCCcCCCCccEEEeCcCCCCCccccccCCCCCccEEEecC-CcCCcccCCC--CCCCcceeec--------cccccCC
Q 039954          419 FPEGGLPCAKLTRLTILDCKRLEALPKGLHNLTSLQELTIGG-ELPSLEEDGL--PTNLHSMIER--------GRGFHRF  487 (578)
Q Consensus       419 ~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~-~l~~l~~~~~--~~~l~~l~~~--------~~~~~~l  487 (578)
                      ++.....+++|+.|++++|...+.+|..+ ..++|+.|++++ ++.......+  .++|+.+.+.        +..+..+
T Consensus       444 ~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l  522 (968)
T PLN00113        444 INSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSC  522 (968)
T ss_pred             cChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCc
Confidence            55555556666666666666555555443 345666666666 4432221111  1233334332        2233445


Q ss_pred             CcccEEEEeecCCCccccCCCCCCCCCCCCCCCCccccEEEeccCCCccccccccCCCCCcceEEeccCCCCcccCCCC
Q 039954          488 SSLRQLAIINCDDDMVSFPPKADDKGSGTALPLPASLTSLMINNFPNLERLSSSIVDLQNLTILQLYNCPKLKYFPEKG  566 (578)
Q Consensus       488 ~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~i~~~~~~l~~L~~L~l~~c~~l~~l~~~~  566 (578)
                      ++|+.|++++ |.....+|...         ..+++|++|++++|.....+|..+..+++|+.+++++|+-...+|..+
T Consensus       523 ~~L~~L~Ls~-N~l~~~~p~~~---------~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~  591 (968)
T PLN00113        523 KKLVSLDLSH-NQLSGQIPASF---------SEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTG  591 (968)
T ss_pred             cCCCEEECCC-CcccccCChhH---------hCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcc
Confidence            5566666655 22223333322         344566666666654434556555666666666666654334455443

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query578
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 4e-06
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure 
Iteration: 1

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 53/161 (32%), Positives = 76/161 (47%), Gaps = 27/161 (16%)
Query: 332 KLRELHILRCSKLQGTFPEHLPA------------LEKLSLYVYGCSKLESIAERLDNNT 379
           +LREL I  C +L    PE L +            L+ L L   G   L +    L N  
Sbjct: 151 RLRELSIRACPELT-ELPEPLASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQN-- 207
Query: 380 SLETIRIFNCGNLKTLPSGLHNLGQLQEIRIQKCRNLESFPE--GGLPCAKLTRLTILDC 437
            L++++I N   L  L   +H+L +L+E+ ++ C  L ++P   GG   A L RL + DC
Sbjct: 208 -LKSLKIRNSP-LSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGR--APLKRLILKDC 263
Query: 438 KRLEALPKGLHNLTSLQELTIGG-----ELPSLEEDGLPTN 473
             L  LP  +H LT L++L + G      LPSL    LP N
Sbjct: 264 SNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQ-LPAN 303

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query578
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-14
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-13
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-10
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-09
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-07
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-07
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 91.5 bits (228), Expect = 2e-20
 Identities = 61/374 (16%), Positives = 110/374 (29%), Gaps = 65/374 (17%)

Query: 88  LQRLRVFSLRGY-RIPELPDSVGDLRYLRYLNLSGTEIRTLPESVNKLYNLHSLLLEDCW 146
                    +G   +    D +   +     + +         + N       +      
Sbjct: 11  SSGRENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQANSNNP----QIETRTGR 66

Query: 147 ELEKLCADMGNLA--KLHHLKNSNTKSLEEMPVGIGRLTCLQTLCNFVVGNGSGSGLSEL 204
            L+     + +        L+  +   L + P    RL+ LQ +          +GL EL
Sbjct: 67  ALKATADLLEDATQPGRVALELRSVP-LPQFPDQAFRLSHLQHM------TIDAAGLMEL 119

Query: 205 KLLMHLRGALEISKLENVKDVGNAKEARGYGGTNFPAWLGDSSFSNLVTLKFKNCDMCTA 264
                                              P  +    F+ L TL      +  A
Sbjct: 120 -----------------------------------PDTMQ--QFAGLETLTLARNPL-RA 141

Query: 265 LP-SVGQLPSLTHLAVCGMSRVKRLGSEFYGNDAPIPF---PCLETLHFEDMQGWEDWIP 320
           LP S+  L  L  L++     +  L       DA         L++L  E        +P
Sbjct: 142 LPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTGIRS--LP 199

Query: 321 HGSSQGVERFPKLRELHILRCSKLQGTFPEHLPALEKL-SLYVYGCSKLESIAERLDNNT 379
                 +     L+ L  +R S L       +  L KL  L + GC+ L +         
Sbjct: 200 ----ASIANLQNLKSLK-IRNSPLS-ALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRA 253

Query: 380 SLETIRIFNCGNLKTLPSGLHNLGQLQEIRIQKCRNLESFPEGGLPCAKLTRLTILDCKR 439
            L+ + + +C NL TLP  +H L QL+++ ++ C NL   P           + +    +
Sbjct: 254 PLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQLPANCIILVPPHLQ 313

Query: 440 LEALPKGLHNLTSL 453
            +          + 
Sbjct: 314 AQLDQHRPVARPAE 327
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query578
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.98
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.92
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.92
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.9
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.89
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.88
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.88
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.86
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.85
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.85
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.85
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.85
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.85
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.85
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.84
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.84
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.83
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.83
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.83
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.83
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.83
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.8
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.8
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.8
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.79
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.78
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.77
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.76
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.76
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.73
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.73
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.72
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.72
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.7
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.7
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.7
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.68
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.68
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.67
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.66
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.66
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.64
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.64
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.64
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.64
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.63
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.62
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.61
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.61
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.6
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.59
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.59
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.56
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.55
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.53
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.52
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.52
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.51
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.48
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.46
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.46
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.43
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.43
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.42
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.42
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.41
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.4
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.4
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.4
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.39
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.37
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.37
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.36
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.36
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.35
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.33
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.32
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.32
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.3
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.3
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.25
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.24
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.22
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.21
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.18
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.17
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.17
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.16
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.14
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.14
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.13
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.11
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.07
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.02
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.02
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.98
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.96
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.94
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.93
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.92
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.8
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.64
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.56
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.45
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.35
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.28
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.27
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.23
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.13
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.13
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.11
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.02
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.85
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.71
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.58
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.98
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.97
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.76
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 92.81
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
Probab=100.00  E-value=2.7e-37  Score=332.89  Aligned_cols=519  Identities=15%  Similarity=0.101  Sum_probs=305.1

Q ss_pred             CCCCCeeEEEeeeCCCCccccccCccccccccEEeeeccCCCCCCCCCcCchhhhcccCcccEEEecCCCCCccCC-ccc
Q 039954           31 SFSENLRHLSYIRGDYDGVQRFGDLYDIQHLRTFLPVMLSNSEPGYLAPSILPKLLKLQRLRVFSLRGYRIPELPD-SVG  109 (578)
Q Consensus        31 ~~~~~~r~ls~~~~~~~~~~~~~~~~~~~~Lr~L~~~~~~~~~~~~~~~~~~~~~~~l~~Lr~L~L~~~~i~~lp~-~i~  109 (578)
                      ..+.+++++.+..+.+.... ...+.++++|++|.+.+      +.+....|..|.++++|++|++++|.++.+|. .|+
T Consensus        22 ~~~~~l~~L~Ls~n~l~~~~-~~~~~~l~~L~~L~Ls~------n~l~~~~~~~~~~l~~L~~L~L~~n~l~~l~~~~~~   94 (680)
T 1ziw_A           22 DLPTNITVLNLTHNQLRRLP-AANFTRYSQLTSLDVGF------NTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFA   94 (680)
T ss_dssp             CSCTTCSEEECCSSCCCCCC-GGGGGGGTTCSEEECCS------SCCCCCCTTHHHHCTTCCEEECCSSCCCCCCTTTTT
T ss_pred             ccCCCCcEEECCCCCCCCcC-HHHHhCCCcCcEEECCC------CccCccCHHHHhcccCcCEEECCCCccCccChhhhc
Confidence            35678999999988776543 24688899999996543      34455556667799999999999999998875 699


Q ss_pred             ccccccEEeccCCCccccc-ccccCcCCccEEecCCCchhHHhhHHHhccccCcccccCCCCcccccCCCC--CCccccc
Q 039954          110 DLRYLRYLNLSGTEIRTLP-ESVNKLYNLHSLLLEDCWELEKLCADMGNLAKLHHLKNSNTKSLEEMPVGI--GRLTCLQ  186 (578)
Q Consensus       110 ~l~~L~~L~L~~~~i~~lp-~~~~~l~~L~~L~l~~~~~~~~lp~~l~~l~~L~~L~l~~~~~~~~lp~~i--~~l~~L~  186 (578)
                      ++++|++|++++|.+..+| ..++++++|++|++++|......|..++.+++|++|++++|.+....+..+  ..+++|+
T Consensus        95 ~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~~L~  174 (680)
T 1ziw_A           95 FCTNLTELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQALKSEELDIFANSSLK  174 (680)
T ss_dssp             TCTTCSEEECCSSCCCCCCSCTTTTCTTCCEEECCSSCCSCCCCCSSSCCTTCCEEECCSSCCCCBCHHHHGGGTTCEES
T ss_pred             cCCCCCEEECCCCccCccChhHccccCCCCEEECCCCcccccCchhhcccccCCEEEccCCcccccCHHHhhcccccccc
Confidence            9999999999999998886 678999999999999996666666678899999999999998443333333  3457788


Q ss_pred             ccCcceeecCCCCCccccccccccccceeeccccCc-------------cccchhhhhcCCCCCCCCCCcCCCCCCceeE
Q 039954          187 TLCNFVVGNGSGSGLSELKLLMHLRGALEISKLENV-------------KDVGNAKEARGYGGTNFPAWLGDSSFSNLVT  253 (578)
Q Consensus       187 ~L~~~~~~~~~~~~~~~L~~l~~l~~~l~~~~~~~~-------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~  253 (578)
                      .|....... .......+..+..++ .+.+....-.             ..+..............|.++.....++|+.
T Consensus       175 ~L~L~~n~l-~~~~~~~~~~l~~L~-~L~l~~~~l~~~~~~~~~~~l~~~~L~~L~L~~n~l~~~~~~~~~~l~~~~L~~  252 (680)
T 1ziw_A          175 KLELSSNQI-KEFSPGCFHAIGRLF-GLFLNNVQLGPSLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTM  252 (680)
T ss_dssp             EEECTTCCC-CCBCTTGGGGSSEEC-EEECTTCCCHHHHHHHHHHHHTTSCCCEEECTTSCCCEECTTTTGGGGGSCCCE
T ss_pred             EEECCCCcc-cccChhhhhhhhhhh-hhhccccccChhhHHHHHHHhhhccccEEEccCCcccccChhHhhccCcCCCCE
Confidence            774433211 111122222232222 2222111100             0000000000001111233333311234888


Q ss_pred             EEeccCCCCCCCC-CCCCCCCcceeeecCcCCceecCccccCCCCCCCCCCCCeeeeccCCCccccccCCCC----Cccc
Q 039954          254 LKFKNCDMCTALP-SVGQLPSLTHLAVCGMSRVKRLGSEFYGNDAPIPFPCLETLHFEDMQGWEDWIPHGSS----QGVE  328 (578)
Q Consensus       254 L~l~~~~~~~~~~-~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~----~~~~  328 (578)
                      |++++|.+.+..+ .+..+++|++|++++|......+..+      ..+++|+.|++.++...........+    ..+.
T Consensus       253 L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~------~~l~~L~~L~L~~~~~~~~~~~~~lp~i~~~~~~  326 (680)
T 1ziw_A          253 LDLSYNNLNVVGNDSFAWLPQLEYFFLEYNNIQHLFSHSL------HGLFNVRYLNLKRSFTKQSISLASLPKIDDFSFQ  326 (680)
T ss_dssp             EECTTSCCCEECTTTTTTCTTCCEEECCSCCBSEECTTTT------TTCTTCCEEECTTCBCCC------CCEECTTTTT
T ss_pred             EECCCCCcCccCcccccCcccccEeeCCCCccCccChhhh------cCCCCccEEeccchhhhcccccccccccChhhcc
Confidence            8888887776554 67778888888888775433322222      22666666666543211100000000    0144


Q ss_pred             cCcccceeecccccccccCCCCCCCC---CcceEEE-------------------------EecCCchhh-HHHhcCCCC
Q 039954          329 RFPKLRELHILRCSKLQGTFPEHLPA---LEKLSLY-------------------------VYGCSKLES-IAERLDNNT  379 (578)
Q Consensus       329 ~~~~L~~L~l~~~~~l~~~~~~~l~~---l~~L~l~-------------------------~~~~~~l~~-i~~~~~~l~  379 (578)
                      .+++|++|++++| .+.+..+..+..   ++.|.+.                         ..+.+.+.. .|..+.+++
T Consensus       327 ~l~~L~~L~l~~n-~l~~~~~~~~~~l~~L~~L~Ls~n~~~~~~l~~~~f~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~  405 (680)
T 1ziw_A          327 WLKCLEHLNMEDN-DIPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKISKIESDAFSWLG  405 (680)
T ss_dssp             TCTTCCEEECCSC-CBCCCCTTTTTTCTTCCEEECTTCBSCCCEECTTTTGGGTTSCCCEEECTTSCCCEECTTTTTTCT
T ss_pred             cCCCCCEEECCCC-ccCCCChhHhccccCCcEEECCCCchhhhhcchhhhcccccCcCceEECCCCCCCeEChhhhhCCC
Confidence            5566666666665 454333333332   2222211                         001111222 244566677


Q ss_pred             CccEEEeecCCCCcccc-cCCCCCCCcceEEeccCCCccccCCCCcCCCCccEEEeCcCCCC--CccccccCCCCCccEE
Q 039954          380 SLETIRIFNCGNLKTLP-SGLHNLGQLQEIRIQKCRNLESFPEGGLPCAKLTRLTILDCKRL--EALPKGLHNLTSLQEL  456 (578)
Q Consensus       380 ~L~~L~l~~~~~~~~~~-~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~--~~~~~~~~~l~~L~~L  456 (578)
                      +|++|++++|.....++ ..+..+++|++|++++|......+..+..+++|+.|++++|...  +.+|..+.++++|++|
T Consensus       406 ~L~~L~L~~N~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~p~~~~~l~~L~~L  485 (680)
T 1ziw_A          406 HLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFALVPSLQRLMLRRVALKNVDSSPSPFQPLRNLTIL  485 (680)
T ss_dssp             TCCEEECCSSCCEEECCSGGGTTCTTCCEEECCSCSEEECCTTTTTTCTTCCEEECTTSCCBCTTCSSCTTTTCTTCCEE
T ss_pred             CCCEEeCCCCcCccccCcccccCcccccEEecCCCCcceeChhhhhcCcccccchhccccccccccCCcccccCCCCCEE
Confidence            77777777775544443 45666777777777776655444555666677777777776543  4566677777777777


Q ss_pred             EecC-CcCCcccCCC--CCCCcceeeccc----------------cccCCCcccEEEEeecCCCccccCCCCCCCCCCCC
Q 039954          457 TIGG-ELPSLEEDGL--PTNLHSMIERGR----------------GFHRFSSLRQLAIINCDDDMVSFPPKADDKGSGTA  517 (578)
Q Consensus       457 ~l~~-~l~~l~~~~~--~~~l~~l~~~~~----------------~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~  517 (578)
                      ++++ .+..++...+  ..+|+.+.+..+                .+.++++|+.|++++  +.+..+|.+.        
T Consensus       486 ~Ls~N~l~~i~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~~~~~~~~~l~~L~~L~L~~--N~l~~i~~~~--------  555 (680)
T 1ziw_A          486 DLSNNNIANINDDMLEGLEKLEILDLQHNNLARLWKHANPGGPIYFLKGLSHLHILNLES--NGFDEIPVEV--------  555 (680)
T ss_dssp             ECCSSCCCCCCTTTTTTCTTCCEEECCSSCCGGGGSTTSTTSCCCTTTTCTTCCEEECCS--SCCCCCCTTT--------
T ss_pred             ECCCCCCCcCChhhhccccccCEEeCCCCCccccchhhccCCcchhhcCCCCCCEEECCC--CCCCCCCHHH--------
Confidence            7777 6666654432  234444444322                145566677777766  3555565543        


Q ss_pred             CCCCccccEEEeccCCCcccccc-ccCCCCCcceEEeccCCCCcccCCCCC---CCcccceEec
Q 039954          518 LPLPASLTSLMINNFPNLERLSS-SIVDLQNLTILQLYNCPKLKYFPEKGL---PSSLLELDIN  577 (578)
Q Consensus       518 ~~~~~~L~~L~l~~~~~l~~i~~-~~~~l~~L~~L~l~~c~~l~~l~~~~~---~~sL~~l~l~  577 (578)
                      +..+++|++|++++ ++++.+|. .+..+++|++|++++ ++++.+++..+   .++|+.|++.
T Consensus       556 ~~~l~~L~~L~Ls~-N~l~~l~~~~~~~l~~L~~L~L~~-N~l~~~~~~~~~~~~~~L~~l~l~  617 (680)
T 1ziw_A          556 FKDLFELKIIDLGL-NNLNTLPASVFNNQVSLKSLNLQK-NLITSVEKKVFGPAFRNLTELDMR  617 (680)
T ss_dssp             TTTCTTCCEEECCS-SCCCCCCTTTTTTCTTCCEEECTT-SCCCBCCHHHHHHHHTTCSEEECT
T ss_pred             cccccCcceeECCC-CCCCcCCHhHhCCCCCCCEEECCC-CcCCccChhHhcccccccCEEEcc
Confidence            24556777777766 46666665 456667777777776 46666655432   2466666654
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 578
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.003
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.004
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Leucine rich effector protein YopM
domain: Leucine rich effector protein YopM
species: Yersinia pestis [TaxId: 632]

 Score = 48.3 bits (113), Expect = 1e-06
 Identities = 47/325 (14%), Positives = 92/325 (28%), Gaps = 23/325 (7%)

Query: 91  LRVFSLRGYRIPELPDSVGDLRYLRYLNLSGTEIRTLPESVNKLY--NLHSLLLEDCWEL 148
                L    +  LP+       L  L  S   +  LPE    L    + +  L+   +L
Sbjct: 40  AHELELNNLGLSSLPELPPH---LESLVASCNSLTELPELPQSLKSLLVDNNNLKALSDL 96

Query: 149 EKL-------CADMGNLAKLHHLKNSNTKSLEEMPVGIGRLTCLQTLCNFVVGNGSGSGL 201
             L          +  L +L +        ++   +                 N      
Sbjct: 97  PPLLEYLGVSNNQLEKLPELQNSSFLKIIDVDNNSLKKLPDLPPSLEFIAAGNNQLEELP 156

Query: 202 SELKLLMHLRGALEISKLENVKDVGNAKEARGYGGTNFPAWLGDSSFSNLVTLKFKNCDM 261
               L        + + L+ + D+  + E+   G           +   L T+   N  +
Sbjct: 157 ELQNLPFLTAIYADNNSLKKLPDLPLSLESIVAGNNILEELPELQNLPFLTTIYADNNLL 216

Query: 262 CTALPSVGQLPSLTHLAVCGMSRVKRLGSEFYGNDAPIPFPCLETLHFEDMQGWEDWIPH 321
            T       L +L           +   S  + + +   F             + +   +
Sbjct: 217 KTLPDLPPSLEALNVRDNYLTDLPELPQSLTFLDVSENIFSG--LSELPPNLYYLNASSN 274

Query: 322 GSSQGVERFPKLRELHILRCSKLQGTFPEHLPALEKLSLYVYGCSKLESIAERLDNNTSL 381
                 +  P L EL+ +  +KL    P   P LE+L       + L  + E   N   L
Sbjct: 275 EIRSLCDLPPSLEELN-VSNNKLI-ELPALPPRLERLIA---SFNHLAEVPELPQN---L 326

Query: 382 ETIRIFNCGNLKTLPSGLHNLGQLQ 406
           + + +     L+  P    ++  L+
Sbjct: 327 KQLHVEYN-PLREFPDIPESVEDLR 350
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query578
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.88
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.84
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.84
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.82
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.8
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.75
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.71
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.71
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.7
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.65
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.62
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.59
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.47
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.46
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.46
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.45
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.44
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.43
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.43
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.42
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.41
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.37
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.35
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.33
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.28
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.25
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.14
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.12
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.11
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.1
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.04
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.94
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.86
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.76
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.69
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.43
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.87
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.7
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.0
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.59
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.16
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.37
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.88  E-value=2.8e-21  Score=190.66  Aligned_cols=80  Identities=20%  Similarity=0.327  Sum_probs=69.2

Q ss_pred             ccCcccEEEecCCCCCccCCcccccccccEEeccCCCcccccccccCcCCccEEecCCCchhHHhhHHHhccccCccccc
Q 039954           87 KLQRLRVFSLRGYRIPELPDSVGDLRYLRYLNLSGTEIRTLPESVNKLYNLHSLLLEDCWELEKLCADMGNLAKLHHLKN  166 (578)
Q Consensus        87 ~l~~Lr~L~L~~~~i~~lp~~i~~l~~L~~L~L~~~~i~~lp~~~~~l~~L~~L~l~~~~~~~~lp~~l~~l~~L~~L~l  166 (578)
                      .+.+|++|+++++.|+.+ +.+..+++|++|++++|.++.+|. ++++++|++|++++|.. ..++. ++.+++|+.|++
T Consensus        42 ~l~~l~~L~l~~~~I~~l-~gl~~L~nL~~L~Ls~N~l~~l~~-l~~L~~L~~L~L~~n~i-~~i~~-l~~l~~L~~L~~  117 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQLTDITP-LKNLTKLVDILMNNNQI-ADITP-LANLTNLTGLTL  117 (384)
T ss_dssp             HHTTCCEEECCSSCCCCC-TTGGGCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSSCC-CCCGG-GTTCTTCCEEEC
T ss_pred             HhCCCCEEECCCCCCCCc-cccccCCCCCEEeCcCCcCCCCcc-ccCCccccccccccccc-ccccc-cccccccccccc
Confidence            678899999999999888 578899999999999999999975 88999999999999954 44543 889999999999


Q ss_pred             CCCC
Q 039954          167 SNTK  170 (578)
Q Consensus       167 ~~~~  170 (578)
                      +++.
T Consensus       118 ~~~~  121 (384)
T d2omza2         118 FNNQ  121 (384)
T ss_dssp             CSSC
T ss_pred             cccc
Confidence            8887
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure