Citrus Sinensis ID: 039991

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MVIETQKNNKVAFTNNSSLSLYLIRKLNMGSEIPQLHVFFFPFMAHGHMIPIVDMAKLFVTRGVKASVITTPANTPYVSKSVERANELGIEMDVKTVKFPSVEAGLPDGCENLDAITNEVNKELIVKFFGATTKLQEPLEQLLRDHKPDCLVADIFFPWATDAAAKFGIPRL
ccEEcccccccEEccccccHHHHHHHHcccccccccEEEEEcccccccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHcccccEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHcccccc
cEEEEccccEEEEEcccHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHccccEEEEEEEcccHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHcccccc
mvietqknnkvaftnnsSLSLYLIRKLnmgseipqlhvfffpfmahghmipIVDMAKLFVTRGVkasvittpantpyvsKSVERANELGiemdvktvkfpsveaglpdgcenLDAITNEVNKELIVKFFGATTKLQEPLEQLLrdhkpdclvadiffpwatdaaakfgiprl
mvietqknnkvaftnnsSLSLYLIRKLNMGSEIPQLHVFFFPFMAHGHMIPIVDMAKLFVTRGVKASvittpantpyvskSVERANELGIEMDVKTVKFPSVEAGLPDGCENLDAITNEVNKELIVKFFGATTKLQEPLEQLLRDHKPDCLVADIFFPWATDAAAKFGIPRL
MVIETQKNNKVAFTNNSSLSLYLIRKLNMGSEIPQLHVFFFPFMAHGHMIPIVDMAKLFVTRGVKASVITTPANTPYVSKSVERANELGIEMDVKTVKFPSVEAGLPDGCENLDAITNEVNKELIVKFFGATTKLQEPLEQLLRDHKPDCLVADIFFPWATDAAAKFGIPRL
************FTNNSSLSLYLIRKLNMGSEIPQLHVFFFPFMAHGHMIPIVDMAKLFVTRGVKASVITTPANTPYVSKSVERANELGIEMDVKTVKFPSVEAGLPDGCENLDAITNEVNKELIVKFFGATTKLQEPLEQLLRDHKPDCLVADIFFPWATDAAAKFG****
*************************************VFFFPFMAHGHMIPIVDMAKLFVTRGVKASVITTPANTPYV**************DVKTVKFPSVEAGLPDGCENLDAITNEVNKELIVKFFGATTKLQEPLEQLLRDHKPDCLVADIFFPWATDAAAKFGIPRL
MVIETQKNNKVAFTNNSSLSLYLIRKLNMGSEIPQLHVFFFPFMAHGHMIPIVDMAKLFVTRGVKASVITTPANTPYVSKSVERANELGIEMDVKTVKFPSVEAGLPDGCENLDAITNEVNKELIVKFFGATTKLQEPLEQLLRDHKPDCLVADIFFPWATDAAAKFGIPRL
MVIETQKNNKVAFTNNSSLSLYLIRKLNMGSEIPQLHVFFFPFMAHGHMIPIVDMAKLFVTRGVKASVITTPANTPYVSKSVERANELGIEMDVKTVKFPSVEAGLPDGCENLDAITNEVNKELIVKFFGATTKLQEPLEQLLRDHKPDCLVADIFFPWATDAAAKFGIPRL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVIETQKNNKVAFTNNSSLSLYLIRKLNMGSEIPQLHVFFFPFMAHGHMIPIVDMAKLFVTRGVKASVITTPANTPYVSKSVERANELGIEMDVKTVKFPSVEAGLPDGCENLDAITNEVNKELIVKFFGATTKLQEPLEQLLRDHKPDCLVADIFFPWATDAAAKFGIPRL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query172 2.2.26 [Sep-21-2011]
Q94C57 483 UDP-glucosyl transferase no no 0.802 0.285 0.524 2e-39
Q8W491 481 UDP-glycosyltransferase 7 no no 0.802 0.286 0.517 5e-39
Q7Y232 484 UDP-glycosyltransferase 7 no no 0.796 0.283 0.486 3e-35
Q2V6J9 487 UDP-glucose flavonoid 3-O N/A no 0.755 0.266 0.5 3e-35
Q8VZE9 488 UDP-glycosyltransferase 7 no no 0.837 0.295 0.490 2e-34
Q9ZQG4 484 UDP-glycosyltransferase 7 no no 0.796 0.283 0.479 2e-33
Q8H0F2 482 Anthocyanin 3'-O-beta-glu N/A no 0.796 0.284 0.55 4e-33
Q9ZQ96 496 UDP-glycosyltransferase 7 no no 0.790 0.274 0.411 9e-27
Q9ZQ99 491 UDP-glycosyltransferase 7 no no 0.819 0.287 0.421 1e-26
Q9ZQ98 496 UDP-glycosyltransferase 7 no no 0.796 0.276 0.408 2e-26
>sp|Q94C57|U73B2_ARATH UDP-glucosyl transferase 73B2 OS=Arabidopsis thaliana GN=UGT73B2 PE=1 SV=1 Back     alignment and function desciption
 Score =  161 bits (408), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 104/143 (72%), Gaps = 5/143 (3%)

Query: 35  QLHVFFFPFMAHGHMIPIVDMAKLFVTRGVKASVITTPANTPYVSKSVERANEL--GIEM 92
           +LHV FFPFMA+GHMIP +DMAKLF +RG K++++TT  N+  + K ++    L  G+E+
Sbjct: 9   KLHVMFFPFMAYGHMIPTLDMAKLFSSRGAKSTILTTSLNSKILQKPIDTFKNLNPGLEI 68

Query: 93  DVKTVKFPSVEAGLPDGCENLDAIT---NEVNKELIVKFFGATTKLQEPLEQLLRDHKPD 149
           D++   FP VE GLP+GCEN+D  T   N+   E+IVKFF +T   ++ LE+LL   +PD
Sbjct: 69  DIQIFNFPCVELGLPEGCENVDFFTSNNNDDKNEMIVKFFFSTRFFKDQLEKLLGTTRPD 128

Query: 150 CLVADIFFPWATDAAAKFGIPRL 172
           CL+AD+FFPWAT+AA KF +PRL
Sbjct: 129 CLIADMFFPWATEAAGKFNVPRL 151
Catalyzes the glycosylation of flavonoids from UDP-glucose. Uses a wide range of flavonoid substrates including flavonols (quercetin, kaempferol, isorhamnetin, 3-OH 7,2',4'-MeO-flavone), flavones (luteolin, apigenin), flavanones (naringenin, hesperetin), flavanonols (taxifolin), isoflavones (genistein, daidzein), flavonol glycosides (quercitrin, isoquercitrin, rutin), and chalcones (isoliquiritigenin). Specific for the C-7 position, with a 20-fold lower activity for the C-3 position.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: -
>sp|Q8W491|U73B3_ARATH UDP-glycosyltransferase 73B3 OS=Arabidopsis thaliana GN=UGT73B3 PE=2 SV=1 Back     alignment and function description
>sp|Q7Y232|U73B4_ARATH UDP-glycosyltransferase 73B4 OS=Arabidopsis thaliana GN=UGT73B4 PE=2 SV=1 Back     alignment and function description
>sp|Q2V6J9|UFOG7_FRAAN UDP-glucose flavonoid 3-O-glucosyltransferase 7 OS=Fragaria ananassa GN=GT7 PE=1 SV=1 Back     alignment and function description
>sp|Q8VZE9|U73B1_ARATH UDP-glycosyltransferase 73B1 OS=Arabidopsis thaliana GN=UGT73B1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZQG4|U73B5_ARATH UDP-glycosyltransferase 73B5 OS=Arabidopsis thaliana GN=UGT73B5 PE=2 SV=1 Back     alignment and function description
>sp|Q8H0F2|ANGT_GENTR Anthocyanin 3'-O-beta-glucosyltransferase OS=Gentiana triflora PE=1 SV=1 Back     alignment and function description
>sp|Q9ZQ96|U73C3_ARATH UDP-glycosyltransferase 73C3 OS=Arabidopsis thaliana GN=UGT73C3 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZQ99|U73C1_ARATH UDP-glycosyltransferase 73C1 OS=Arabidopsis thaliana GN=UGT73C1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZQ98|U73C2_ARATH UDP-glycosyltransferase 73C2 OS=Arabidopsis thaliana GN=UGT73C2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
224101569 486 predicted protein [Populus trichocarpa] 0.837 0.296 0.643 1e-51
224056136 483 predicted protein [Populus trichocarpa] 0.837 0.298 0.620 1e-51
224103633 485 predicted protein [Populus trichocarpa] 0.837 0.296 0.620 2e-50
255555377 483 UDP-glucosyltransferase, putative [Ricin 0.837 0.298 0.606 6e-48
255555375 486 UDP-glucosyltransferase, putative [Ricin 0.825 0.292 0.602 8e-48
224056138 485 predicted protein [Populus trichocarpa] 0.837 0.296 0.6 1e-46
387135096 495 UDP-glycosyltransferase 1 [Linum usitati 0.848 0.294 0.581 9e-46
45155264 480 UDP-glucose glucosyltransferase [Rhodiol 0.819 0.293 0.562 4e-45
225428871 482 PREDICTED: UDP-glucose flavonoid 3-O-glu 0.819 0.292 0.590 9e-45
147839909 482 hypothetical protein VITISV_004870 [Viti 0.819 0.292 0.590 1e-44
>gi|224101569|ref|XP_002334266.1| predicted protein [Populus trichocarpa] gi|222870374|gb|EEF07505.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 118/146 (80%), Gaps = 2/146 (1%)

Query: 29  MGSEIPQLHVFFFPFMAHGHMIPIVDMAKLFVTRGVKASVITTPANTPYVSKSVERANEL 88
           MGS   QLH+FFFPF+AHGHMIP VDMAKLF +RGVK ++ITTP N P  SK++++  +L
Sbjct: 1   MGSLGHQLHIFFFPFLAHGHMIPTVDMAKLFASRGVKTTIITTPLNAPLFSKTIQKTKDL 60

Query: 89  GIEMDVKTVKFPSVEAGLPDGCENLDAI--TNEVNKELIVKFFGATTKLQEPLEQLLRDH 146
           G ++D++T+KFP+ EAGLP+GCEN DA   TNE   E+  KFF ATT LQEP E++L++ 
Sbjct: 61  GFDIDIQTIKFPAAEAGLPEGCENTDAFITTNENAGEMTKKFFIATTFLQEPFEKVLQER 120

Query: 147 KPDCLVADIFFPWATDAAAKFGIPRL 172
            PDC+VAD+FFPWATDAAAKFGIPRL
Sbjct: 121 HPDCVVADMFFPWATDAAAKFGIPRL 146

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224056136|ref|XP_002298733.1| predicted protein [Populus trichocarpa] gi|222845991|gb|EEE83538.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224103633|ref|XP_002313131.1| predicted protein [Populus trichocarpa] gi|222849539|gb|EEE87086.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255555377|ref|XP_002518725.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223542106|gb|EEF43650.1| UDP-glucosyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255555375|ref|XP_002518724.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223542105|gb|EEF43649.1| UDP-glucosyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224056138|ref|XP_002298734.1| predicted protein [Populus trichocarpa] gi|222845992|gb|EEE83539.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|387135096|gb|AFJ52929.1| UDP-glycosyltransferase 1 [Linum usitatissimum] Back     alignment and taxonomy information
>gi|45155264|gb|AAS55083.1| UDP-glucose glucosyltransferase [Rhodiola sachalinensis] Back     alignment and taxonomy information
>gi|225428871|ref|XP_002282463.1| PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147839909|emb|CAN65903.1| hypothetical protein VITISV_004870 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
UNIPROTKB|Q9AT54 476 togt1 "Phenylpropanoid:glucosy 0.784 0.283 0.572 4.6e-41
TAIR|locus:505006555 483 UGT73B2 "UDP-glucosyltransfera 0.837 0.298 0.516 8.9e-38
TAIR|locus:2831352 481 UGT73B3 "UDP-glucosyl transfer 0.802 0.286 0.517 6.3e-37
TAIR|locus:2053669 484 UGT73B4 "UDP-glycosyltransfera 0.796 0.283 0.486 3.6e-34
TAIR|locus:505006556 488 UGT73B1 "UDP-glucosyl transfer 0.837 0.295 0.490 7.4e-34
TAIR|locus:2053618 484 UGT73B5 "UDP-glucosyl transfer 0.831 0.295 0.470 1.1e-32
TAIR|locus:2040590 491 UGT73C1 "UDP-glucosyl transfer 0.819 0.287 0.421 3.9e-26
TAIR|locus:2040530 496 AT2G36780 [Arabidopsis thalian 0.790 0.274 0.411 1.5e-25
TAIR|locus:2040600 496 UGT73C2 "UDP-glucosyl transfer 0.796 0.276 0.408 2.5e-25
TAIR|locus:2040570 495 DOGT1 "don-glucosyltransferase 0.779 0.270 0.410 3.2e-25
UNIPROTKB|Q9AT54 togt1 "Phenylpropanoid:glucosyltransferase 1" [Nicotiana tabacum (taxid:4097)] Back     alignment and assigned GO terms
 Score = 436 (158.5 bits), Expect = 4.6e-41, P = 4.6e-41
 Identities = 79/138 (57%), Positives = 104/138 (75%)

Query:    35 QLHVFFFPFMAHGHMIPIVDMAKLFVTRGVKASVITTPANTPYVSKSVERANELGIEMDV 94
             QLH FFFP MAHGHMIP +DMAKLF +RGVKA++ITTP N    SK+++R   LGIE+++
Sbjct:     3 QLHFFFFPVMAHGHMIPTLDMAKLFASRGVKATIITTPLNEFVFSKAIQRNKHLGIEIEI 62

Query:    95 KTVKFPSVEAGLPDGCENLDAITNEVNKELIVKFFGATTKLQEPLEQLLRDHKPDCLVAD 154
             + +KFP+VE GLP+ CE LD I ++   E +  FF A   +QEPLEQL+ + +PDCL++D
Sbjct:    63 RLIKFPAVENGLPEECERLDQIPSD---EKLPNFFKAVAMMQEPLEQLIEECRPDCLISD 119

Query:   155 IFFPWATDAAAKFGIPRL 172
             +F PW TD AAKF IPR+
Sbjct:   120 MFLPWTTDTAAKFNIPRI 137
GO:0042802 "identical protein binding" evidence=IDA
GO:0050275 "scopoletin glucosyltransferase activity" evidence=IDA
TAIR|locus:505006555 UGT73B2 "UDP-glucosyltransferase 73B2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2831352 UGT73B3 "UDP-glucosyl transferase 73B3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053669 UGT73B4 "UDP-glycosyltransferase 73B4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006556 UGT73B1 "UDP-glucosyl transferase 73B1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053618 UGT73B5 "UDP-glucosyl transferase 73B5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040590 UGT73C1 "UDP-glucosyl transferase 73C1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040530 AT2G36780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040600 UGT73C2 "UDP-glucosyl transferase 73C2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040570 DOGT1 "don-glucosyltransferase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
PLN03007 482 PLN03007, PLN03007, UDP-glucosyltransferase family 2e-56
PLN02534 491 PLN02534, PLN02534, UDP-glycosyltransferase 3e-39
PLN02863 477 PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl 6e-16
PLN02670 472 PLN02670, PLN02670, transferase, transferring glyc 7e-13
PLN00414 446 PLN00414, PLN00414, glycosyltransferase family pro 4e-08
cd03784 401 cd03784, GT1_Gtf_like, This family includes the Gt 5e-08
PLN02555 480 PLN02555, PLN02555, limonoid glucosyltransferase 3e-06
PLN02448 459 PLN02448, PLN02448, UDP-glycosyltransferase family 2e-05
PLN02173 449 PLN02173, PLN02173, UDP-glucosyl transferase famil 4e-05
PLN02208 442 PLN02208, PLN02208, glycosyltransferase family pro 7e-05
PLN02764 453 PLN02764, PLN02764, glycosyltransferase family pro 1e-04
PLN02410 451 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl 2e-04
PLN02562 448 PLN02562, PLN02562, UDP-glycosyltransferase 3e-04
TIGR01426 392 TIGR01426, MGT, glycosyltransferase, MGT family 3e-04
>gnl|CDD|178584 PLN03007, PLN03007, UDP-glucosyltransferase family protein Back     alignment and domain information 
 Score =  183 bits (467), Expect = 2e-56
 Identities = 77/143 (53%), Positives = 103/143 (72%), Gaps = 5/143 (3%)

Query: 35  QLHVFFFPFMAHGHMIPIVDMAKLFVTRGVKASVITTPANTPYVSKSVERANEL--GIEM 92
           +LH+ FFPFMAHGHMIP +DMAKLF +RG K++++TTP N     K +E    L  G+E+
Sbjct: 5   KLHILFFPFMAHGHMIPTLDMAKLFSSRGAKSTILTTPLNAKIFEKPIEAFKNLNPGLEI 64

Query: 93  DVKTVKFPSVEAGLPDGCENLDAITNEVN---KELIVKFFGATTKLQEPLEQLLRDHKPD 149
           D++   FP VE GLP+GCEN+D IT+  N    +L +KF  +T   ++ LE+LL   +PD
Sbjct: 65  DIQIFNFPCVELGLPEGCENVDFITSNNNDDSGDLFLKFLFSTKYFKDQLEKLLETTRPD 124

Query: 150 CLVADIFFPWATDAAAKFGIPRL 172
           CLVAD+FFPWAT+AA KFG+PRL
Sbjct: 125 CLVADMFFPWATEAAEKFGVPRL 147

Length = 482
>gnl|CDD|215293 PLN02534, PLN02534, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|215465 PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|178275 PLN02670, PLN02670, transferase, transferring glycosyl groups Back     alignment and domain information
>gnl|CDD|177807 PLN00414, PLN00414, glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|99960 cd03784, GT1_Gtf_like, This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>gnl|CDD|178170 PLN02555, PLN02555, limonoid glucosyltransferase Back     alignment and domain information
>gnl|CDD|215247 PLN02448, PLN02448, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|177830 PLN02173, PLN02173, UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|177858 PLN02208, PLN02208, glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|178364 PLN02764, PLN02764, glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|178032 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|215305 PLN02562, PLN02562, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|233407 TIGR01426, MGT, glycosyltransferase, MGT family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 172
PLN02534 491 UDP-glycosyltransferase 99.89
PLN02863 477 UDP-glucoronosyl/UDP-glucosyl transferase family p 99.89
PLN02670 472 transferase, transferring glycosyl groups 99.88
PLN03007 482 UDP-glucosyltransferase family protein 99.87
PLN00414 446 glycosyltransferase family protein 99.86
PLN02208 442 glycosyltransferase family protein 99.85
PLN02173 449 UDP-glucosyl transferase family protein 99.85
PLN02764 453 glycosyltransferase family protein 99.85
PLN02410 451 UDP-glucoronosyl/UDP-glucosyl transferase family p 99.84
PLN02210 456 UDP-glucosyl transferase 99.82
PLN02555 480 limonoid glucosyltransferase 99.82
PLN02992 481 coniferyl-alcohol glucosyltransferase 99.82
PLN02562 448 UDP-glycosyltransferase 99.82
PLN02448 459 UDP-glycosyltransferase family protein 99.81
PLN00164 480 glucosyltransferase; Provisional 99.8
PLN02152 455 indole-3-acetate beta-glucosyltransferase 99.79
PLN03015 470 UDP-glucosyl transferase 99.78
PLN03004 451 UDP-glycosyltransferase 99.77
PLN02167 475 UDP-glycosyltransferase family protein 99.76
PLN02207 468 UDP-glycosyltransferase 99.76
PLN02554 481 UDP-glycosyltransferase family protein 99.75
cd03784 401 GT1_Gtf_like This family includes the Gtfs, a grou 99.64
TIGR01426 392 MGT glycosyltransferase, MGT family. This model de 99.58
PF03033139 Glyco_transf_28: Glycosyltransferase family 28 N-t 99.35
PHA03392 507 egt ecdysteroid UDP-glucosyltransferase; Provision 99.03
PF00201 500 UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera 98.9
KOG1192 496 consensus UDP-glucuronosyl and UDP-glucosyl transf 98.9
COG1819 406 Glycosyl transferases, related to UDP-glucuronosyl 98.79
PF13528 318 Glyco_trans_1_3: Glycosyl transferase family 1 98.67
TIGR00661 321 MJ1255 conserved hypothetical protein. This model 98.37
PRK12446 352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 98.29
COG0707 357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami 97.97
cd03785 350 GT1_MurG MurG is an N-acetylglucosaminyltransferas 97.77
PRK00726 357 murG undecaprenyldiphospho-muramoylpentapeptide be 97.7
TIGR01133 348 murG undecaprenyldiphospho-muramoylpentapeptide be 97.64
TIGR00215 385 lpxB lipid-A-disaccharide synthase. Lipid-A precur 97.32
cd03816 415 GT1_ALG1_like This family is most closely related 96.88
PRK00025 380 lpxB lipid-A-disaccharide synthase; Reviewed 96.68
cd03818 396 GT1_ExpC_like This family is most closely related 96.63
PF13579160 Glyco_trans_4_4: Glycosyl transferase 4-like domai 96.07
TIGR03590 279 PseG pseudaminic acid biosynthesis-associated prot 96.0
PF13477139 Glyco_trans_4_2: Glycosyl transferase 4-like 95.81
cd03823 359 GT1_ExpE7_like This family is most closely related 95.72
cd03800 398 GT1_Sucrose_synthase This family is most closely r 95.62
COG4671 400 Predicted glycosyl transferase [General function p 95.55
cd03794 394 GT1_wbuB_like This family is most closely related 95.52
PRK10307 412 putative glycosyl transferase; Provisional 95.35
COG1703 323 ArgK Putative periplasmic protein kinase ArgK and 94.99
cd03805 392 GT1_ALG2_like This family is most closely related 94.69
PF04007 335 DUF354: Protein of unknown function (DUF354); Inte 94.09
cd03796 398 GT1_PIG-A_like This family is most closely related 93.93
PF12000171 Glyco_trans_4_3: Gkycosyl transferase family 4 gro 92.93
PRK13609 380 diacylglycerol glucosyltransferase; Provisional 92.56
PLN02275 371 transferase, transferring glycosyl groups 92.53
TIGR02472 439 sucr_P_syn_N sucrose-phosphate synthase, putative, 92.29
PLN00142 815 sucrose synthase 91.74
cd04962 371 GT1_like_5 This family is most closely related to 91.48
TIGR02470 784 sucr_synth sucrose synthase. This model represents 91.43
cd03819 355 GT1_WavL_like This family is most closely related 91.36
cd02067119 B12-binding B12 binding domain (B12-BD). This doma 91.31
cd03808 359 GT1_cap1E_like This family is most closely related 89.93
cd03814 364 GT1_like_2 This family is most closely related to 89.86
PRK02261137 methylaspartate mutase subunit S; Provisional 89.66
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 88.94
cd03817 374 GT1_UGDG_like This family is most closely related 88.85
PF13439177 Glyco_transf_4: Glycosyltransferase Family 4; PDB: 88.61
cd02070201 corrinoid_protein_B12-BD B12 binding domain of cor 88.01
PLN02871 465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 87.82
COG3980 318 spsG Spore coat polysaccharide biosynthesis protei 86.67
cd04951 360 GT1_WbdM_like This family is most closely related 85.68
cd03802 335 GT1_AviGT4_like This family is most closely relate 85.55
cd03825 365 GT1_wcfI_like This family is most closely related 84.83
PRK01021 608 lpxB lipid-A-disaccharide synthase; Reviewed 84.45
PRK05749 425 3-deoxy-D-manno-octulosonic-acid transferase; Revi 83.99
TIGR02370197 pyl_corrinoid methyltransferase cognate corrinoid 83.92
COG1484254 DnaC DNA replication protein [DNA replication, rec 83.56
cd03821 375 GT1_Bme6_like This family is most closely related 83.19
PLN02846 462 digalactosyldiacylglycerol synthase 83.18
cd03786 363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 82.09
PF02951119 GSH-S_N: Prokaryotic glutathione synthetase, N-ter 81.04
COG2910211 Putative NADH-flavin reductase [General function p 80.93
cd02071122 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin 80.66
PRK00654 466 glgA glycogen synthase; Provisional 80.52
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 80.44
cd02069213 methionine_synthase_B12_BD B12 binding domain of m 80.43
cd01635229 Glycosyltransferase_GTB_type Glycosyltransferases 80.29
>PLN02534 UDP-glycosyltransferase Back     alignment and domain information 
Probab=99.89  E-value=3.3e-22  Score=170.94  Aligned_cols=135  Identities=44%  Similarity=0.904  Sum_probs=100.5

Q ss_pred             cceEEEEcCCCccchHHHHHHHHHHHHCCCEEEEEeCCCChhhhhhhhhhhhcCCCCeEEEEeeCCCCCCCCCCCCCccc
Q 039991           35 QLHVFFFPFMAHGHMIPIVDMAKLFVTRGVKASVITTPANTPYVSKSVERANELGIEMDVKTVKFPSVEAGLPDGCENLD  114 (172)
Q Consensus        35 ~~~Ilv~p~p~~GH~~P~l~La~~La~rGh~Vt~it~~~~~~~~~~~~~~~~~~~~~i~~~~l~~~~~~~~~p~~~~~~~  114 (172)
                      +.||+++|+|++||++||++||+.|++||+.||+++++.+..++.+........+..++++.+|++...+++|++.+..+
T Consensus         8 ~~Hvv~vPfpaqGHi~P~l~LAk~La~~G~~vT~v~t~~n~~~~~~~~~~~~~~~~~i~~~~lp~p~~~dglp~~~~~~~   87 (491)
T PLN02534          8 QLHFVLIPLMAQGHMIPMIDMARLLAERGVIVSLVTTPQNASRFAKTIDRARESGLPIRLVQIPFPCKEVGLPIGCENLD   87 (491)
T ss_pred             CCEEEEECCCCcchHHHHHHHHHHHHhCCCeEEEEECCCcHHHHhhhhhhccccCCCeEEEEcCCCCccCCCCCCccccc
Confidence            47999999999999999999999999999999999999886655543321100112489999987643357877644322


Q ss_pred             ccchhhhHHHHHHHHHHHHHhHHHHHHHhhhC--CCCEEEecCCCccHHHHHHHhCCCCC
Q 039991          115 AITNEVNKELIVKFFGATTKLQEPLEQLLRDH--KPDCLVADIFFPWATDAAAKFGIPRL  172 (172)
Q Consensus       115 ~~~~~~~~~~~~~~~~~~~~~~~~l~~ll~~~--~~d~VI~D~~~~~a~~vA~~lgiP~v  172 (172)
                      ..+..   .....+......+.+.+++++++.  +++|||+|.+++|+.++|+++|||++
T Consensus        88 ~~~~~---~~~~~~~~~~~~l~~~l~~lL~~~~~pp~cIV~D~f~~Wa~dVA~~lgIP~v  144 (491)
T PLN02534         88 TLPSR---DLLRKFYDAVDKLQQPLERFLEQAKPPPSCIISDKCLSWTSKTAQRFNIPRI  144 (491)
T ss_pred             cCCcH---HHHHHHHHHHHHhHHHHHHHHHhcCCCCcEEEECCccHHHHHHHHHhCCCeE
Confidence            22211   233344455567888888888763  68999999999999999999999975

>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02670 transferase, transferring glycosyl groups Back     alignment and domain information
>PLN03007 UDP-glucosyltransferase family protein Back     alignment and domain information
>PLN00414 glycosyltransferase family protein Back     alignment and domain information
>PLN02208 glycosyltransferase family protein Back     alignment and domain information
>PLN02173 UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02764 glycosyltransferase family protein Back     alignment and domain information
>PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02210 UDP-glucosyl transferase Back     alignment and domain information
>PLN02555 limonoid glucosyltransferase Back     alignment and domain information
>PLN02992 coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>PLN02562 UDP-glycosyltransferase Back     alignment and domain information
>PLN02448 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN00164 glucosyltransferase; Provisional Back     alignment and domain information
>PLN02152 indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>PLN03015 UDP-glucosyl transferase Back     alignment and domain information
>PLN03004 UDP-glycosyltransferase Back     alignment and domain information
>PLN02167 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02207 UDP-glycosyltransferase Back     alignment and domain information
>PLN02554 UDP-glycosyltransferase family protein Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family Back     alignment and domain information
>PF03033 Glyco_transf_28: Glycosyltransferase family 28 N-terminal domain; InterPro: IPR004276 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule Back     alignment and domain information
>KOG1192 consensus UDP-glucuronosyl and UDP-glucosyl transferase [Carbohydrate transport and metabolism; Energy production and conversion] Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>TIGR00215 lpxB lipid-A-disaccharide synthase Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF13579 Glyco_trans_4_4: Glycosyl transferase 4-like domain; PDB: 3C4Q_B 3C4V_A 3C48_B 1Z2T_A Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>PF13477 Glyco_trans_4_2: Glycosyl transferase 4-like Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG4671 Predicted glycosyl transferase [General function prediction only] Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF12000 Glyco_trans_4_3: Gkycosyl transferase family 4 group; InterPro: IPR022623 This presumed domain is functionally uncharacterised and found in bacteria Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>PLN02275 transferase, transferring glycosyl groups Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain Back     alignment and domain information
>PLN00142 sucrose synthase Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK02261 methylaspartate mutase subunit S; Provisional Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF13439 Glyco_transf_4: Glycosyltransferase Family 4; PDB: 2JJM_E 3MBO_C 2GEJ_A 2GEK_A Back     alignment and domain information
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>TIGR02370 pyl_corrinoid methyltransferase cognate corrinoid proteins, Methanosarcina family Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02846 digalactosyldiacylglycerol synthase Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>PF02951 GSH-S_N: Prokaryotic glutathione synthetase, N-terminal domain; InterPro: IPR004215 Prokaryotic glutathione synthetase 6 Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd02069 methionine_synthase_B12_BD B12 binding domain of methionine synthase Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
2pq6_A 482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 2e-40
2acv_A 463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 6e-38
3hbf_A 454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 1e-34
2c1x_A 456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 1e-33
2vch_A 480 Hydroquinone glucosyltransferase; glycosyltransfer 6e-31
2iya_A 424 OLEI, oleandomycin glycosyltransferase; carbohydra 1e-14
2iyf_A 430 OLED, oleandomycin glycosyltransferase; antibiotic 4e-14
3ia7_A 402 CALG4; glycosysltransferase, calicheamicin, enediy 5e-10
3rsc_A 415 CALG2; TDP, enediyne, structural genomics, PSI-2, 2e-09
3otg_A 412 CALG1; calicheamicin, TDP, structural genomics, PS 5e-09
3oti_A 398 CALG3; calicheamicin, TDP, structural genomics, PS 4e-08
2yjn_A 441 ERYCIII, glycosyltransferase; transferase, cytochr 9e-08
4fzr_A 398 SSFS6; structural genomics, PSI-biology, protein s 2e-07
3tsa_A 391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 2e-06
2p6p_A 384 Glycosyl transferase; X-RAY-diffraction,urdamycina 3e-06
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Length = 482 Back     alignment and structure
 Score =  140 bits (356), Expect = 2e-40
 Identities = 34/147 (23%), Positives = 55/147 (37%), Gaps = 7/147 (4%)

Query: 29  MGS-EIPQLHVFFFPFMAHGHMIPIVDMAKLFVTRGVKASVITTPANTPYVSKSVERANE 87
           MG+    + HV   P+   GH+ P+  +AKL   RG   + + T  N   + KS      
Sbjct: 1   MGNFANRKPHVVMIPYPVQGHINPLFKLAKLLHLRGFHITFVNTEYNHKRLLKSRGPKAF 60

Query: 88  LGIEMDVKTVKFPSVEAGLPDGCENLDAITN--EVNKELIVKFFGATTKLQEPLEQLLRD 145
            G         F S+  GL     + D   +   + + +   F     +L   L      
Sbjct: 61  DGFT----DFNFESIPDGLTPMEGDGDVSQDVPTLCQSVRKNFLKPYCELLTRLNHSTNV 116

Query: 146 HKPDCLVADIFFPWATDAAAKFGIPRL 172
               CLV+D    +   AA +F +P +
Sbjct: 117 PPVTCLVSDCCMSFTIQAAEEFELPNV 143
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Length = 463 Back     alignment and structure
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} PDB: 3hbj_A* Length = 454 Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Length = 456 Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Length = 480 Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Length = 424 Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Length = 430 Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Length = 402 Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Length = 415 Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Length = 412 Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Length = 398 Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 441 Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Length = 398 Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Length = 391 Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Length = 384 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
3hbf_A 454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 99.86
2acv_A 463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 99.79
2pq6_A 482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 99.78
2vch_A 480 Hydroquinone glucosyltransferase; glycosyltransfer 99.76
2c1x_A 456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 99.75
2iya_A 424 OLEI, oleandomycin glycosyltransferase; carbohydra 99.73
4amg_A 400 Snogd; transferase, polyketide biosynthesis, GT1 f 99.72
3ia7_A 402 CALG4; glycosysltransferase, calicheamicin, enediy 99.58
2iyf_A 430 OLED, oleandomycin glycosyltransferase; antibiotic 99.56
3rsc_A 415 CALG2; TDP, enediyne, structural genomics, PSI-2, 99.55
1iir_A 415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 99.53
1rrv_A 416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 99.45
3oti_A 398 CALG3; calicheamicin, TDP, structural genomics, PS 99.4
4fzr_A 398 SSFS6; structural genomics, PSI-biology, protein s 99.38
2p6p_A 384 Glycosyl transferase; X-RAY-diffraction,urdamycina 99.38
2yjn_A 441 ERYCIII, glycosyltransferase; transferase, cytochr 99.37
3tsa_A 391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 99.33
3h4t_A 404 Glycosyltransferase GTFA, glycosyltransferase; van 99.26
3otg_A 412 CALG1; calicheamicin, TDP, structural genomics, PS 99.15
3s2u_A 365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 98.86
1f0k_A 364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 98.21
3fro_A 439 GLGA glycogen synthase; glycosyltransferase family 96.87
2r60_A 499 Glycosyl transferase, group 1; rossmann-fold; 1.80 96.46
1v4v_A 376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t 95.22
3dzc_A 396 UDP-N-acetylglucosamine 2-epimerase; structural ge 94.99
3okp_A 394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 94.85
2jjm_A 394 Glycosyl transferase, group 1 family protein; anth 94.84
1vgv_A 384 UDP-N-acetylglucosamine 2-epimerase; structural ge 94.69
3c48_A 438 Predicted glycosyltransferases; retaining glycosyl 93.7
3beo_A 375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a 92.65
3ot5_A 403 UDP-N-acetylglucosamine 2-epimerase; structural ge 92.61
2iuy_A 342 Avigt4, glycosyltransferase; antibiotics, family G 90.74
2x6q_A 416 Trehalose-synthase TRET; biosynthetic protein; 2.2 90.69
2iw1_A 374 Lipopolysaccharide core biosynthesis protein RFAG; 90.39
2gek_A 406 Phosphatidylinositol mannosyltransferase (PIMA); G 90.13
1y80_A210 Predicted cobalamin binding protein; corrinoid, fa 88.69
2x0d_A 413 WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge 88.66
3vue_A 536 GBSS-I, granule-bound starch synthase 1, chloropla 87.88
1rzu_A 485 Glycogen synthase 1; glycosyl-transferase, GT-B fo 86.53
4hwg_A 385 UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc 86.51
3ezx_A215 MMCP 1, monomethylamine corrinoid protein 1; N ter 86.16
2qzs_A 485 Glycogen synthase; glycosyl-transferase, GT-B fold 85.97
3s28_A 816 Sucrose synthase 1; glycosyltransferase, sucrose m 85.43
1kjn_A157 MTH0777; hypotethical protein, structural genomics 85.09
2i2x_B258 MTAC, methyltransferase 1; TIM barrel and helix bu 84.09
4dry_A 281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 83.84
2yxb_A161 Coenzyme B12-dependent mutase; alpha/beta, structu 83.84
2lpm_A123 Two-component response regulator; transcription re 80.31
4b4o_A 298 Epimerase family protein SDR39U1; isomerase; HET: 80.29
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* Back     alignment and structure
Probab=99.86  E-value=1.3e-21  Score=165.17  Aligned_cols=134  Identities=22%  Similarity=0.335  Sum_probs=91.9

Q ss_pred             hhhhcCCCCCCCcceEEEEcCCCccchHHHHHHHHHHHHCC--CEEEEEeCCCChhhhhhhhhhhhcCCCCeEEEEeeCC
Q 039991           23 LIRKLNMGSEIPQLHVFFFPFMAHGHMIPIVDMAKLFVTRG--VKASVITTPANTPYVSKSVERANELGIEMDVKTVKFP  100 (172)
Q Consensus        23 ~~~~~~M~~~~~~~~Ilv~p~p~~GH~~P~l~La~~La~rG--h~Vt~it~~~~~~~~~~~~~~~~~~~~~i~~~~l~~~  100 (172)
                      ||-+  |+. .++.||+++|+|++||++||++|||+|++||  +.||+++++.+..++.+....   ..++++|+.+|  
T Consensus         4 ~~~~--M~~-~~~~hvv~~P~p~~GHi~P~l~Lak~L~~~g~~~~vT~~~t~~~~~~~~~~~~~---~~~~i~~~~ip--   75 (454)
T 3hbf_A            4 FKNE--MNG-NNLLHVAVLAFPFGTHAAPLLSLVKKIATEAPKVTFSFFCTTTTNDTLFSRSNE---FLPNIKYYNVH--   75 (454)
T ss_dssp             -----------CCCEEEEECCCSSSSHHHHHHHHHHHHHHCTTSEEEEEECHHHHHHSCSSSSC---CCTTEEEEECC--
T ss_pred             cccc--ccC-CCCCEEEEEcCCcccHHHHHHHHHHHHHhCCCCEEEEEEeCHHHHHhhhccccc---CCCCceEEecC--
Confidence            4555  443 3468999999999999999999999999999  999999987544333221100   12469998886  


Q ss_pred             CCCCCCCCCCCcccccchhhhHHHHHHHHHH-HHHhHHHHHHHhhh--CCCCEEEecCCCccHHHHHHHhCCCCC
Q 039991          101 SVEAGLPDGCENLDAITNEVNKELIVKFFGA-TTKLQEPLEQLLRD--HKPDCLVADIFFPWATDAAAKFGIPRL  172 (172)
Q Consensus       101 ~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~l~~ll~~--~~~d~VI~D~~~~~a~~vA~~lgiP~v  172 (172)
                         +++|++.+...+ +.    ..+..+.+. ...+.+.+++++++  .++||||+|++++|+.++|+++|||++
T Consensus        76 ---dglp~~~~~~~~-~~----~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~iI~D~~~~w~~~vA~~lgIP~~  142 (454)
T 3hbf_A           76 ---DGLPKGYVSSGN-PR----EPIFLFIKAMQENFKHVIDEAVAETGKNITCLVTDAFFWFGADLAEEMHAKWV  142 (454)
T ss_dssp             ---CCCCTTCCCCSC-TT----HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEETTCTTHHHHHHHTTCEEE
T ss_pred             ---CCCCCCccccCC-hH----HHHHHHHHHHHHHHHHHHHHHHhhcCCCCcEEEECCcchHHHHHHHHhCCCEE
Confidence               467766543222 11    333444443 34566777776654  379999999999999999999999975
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Back     alignment and structure
>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A* Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back     alignment and structure
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} Back     alignment and structure
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Back     alignment and structure
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Back     alignment and structure
>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* Back     alignment and structure
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure
>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Back     alignment and structure
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Back     alignment and structure
>1y80_A Predicted cobalamin binding protein; corrinoid, factor IIIM, methyl transferase, structural genomics, PSI, protein structure initiative; HET: B1M; 1.70A {Moorella thermoacetica} Back     alignment and structure
>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Back     alignment and structure
>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii} Back     alignment and structure
>3ezx_A MMCP 1, monomethylamine corrinoid protein 1; N terminal all helical bundle C terminal rossmann fold, cobalt, metal-binding; HET: HCB; 2.56A {Methanosarcina barkeri} Back     alignment and structure
>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Back     alignment and structure
>1kjn_A MTH0777; hypotethical protein, structural genomics, PSI, protein structure initiative; 2.20A {Methanothermobacterthermautotrophicus} SCOP: c.115.1.1 Back     alignment and structure
>2i2x_B MTAC, methyltransferase 1; TIM barrel and helix bundle (MTAB), rossman fold and helix B (MTAC); HET: B13; 2.50A {Methanosarcina barkeri} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 172
d2pq6a1 473 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransfe 1e-23
d2c1xa1 450 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-gluc 7e-20
d2acva1 461 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transf 3e-19
d2vcha1 471 c.87.1.10 (A:6-476) Hydroquinone glucosyltransfera 7e-18
d1rrva_ 401 c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Am 7e-10
d1pn3a_ 391 c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA 3e-05
d1iira_ 401 c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycol 3e-04
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Length = 473 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: UDPGT-like
domain: (Iso)flavonoid glycosyltransferase
species: Medicago truncatula [TaxId: 3880]

 Score = 93.7 bits (231), Expect = 1e-23
 Identities = 32/137 (23%), Positives = 50/137 (36%), Gaps = 6/137 (4%)

Query: 37  HVFFFPFMAHGHMIPIVDMAKLFVTRGVKASVITTPANTPYVSKSVERANELGIEMDVKT 96
           HV   P+   GH+ P+  +AKL   RG   + + T  N   + KS       G       
Sbjct: 3   HVVMIPYPVQGHINPLFKLAKLLHLRGFHITFVNTEYNHKRLLKSRGPKAFDGFT----D 58

Query: 97  VKFPSVEAGLPDGCENLDAITN--EVNKELIVKFFGATTKLQEPLEQLLRDHKPDCLVAD 154
             F S+  GL     + D   +   + + +   F     +L   L          CLV+D
Sbjct: 59  FNFESIPDGLTPMEGDGDVSQDVPTLCQSVRKNFLKPYCELLTRLNHSTNVPPVTCLVSD 118

Query: 155 IFFPWATDAAAKFGIPR 171
               +   AA +F +P 
Sbjct: 119 CCMSFTIQAAEEFELPN 135
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Length = 450 Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Length = 461 Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 471 Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Length = 391 Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
d2c1xa1 450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 99.72
d2acva1 461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 99.68
d2vcha1 471 Hydroquinone glucosyltransferase {Thale cress (Ara 99.62
d2pq6a1 473 (Iso)flavonoid glycosyltransferase {Medicago trunc 99.62
d1rrva_ 401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 99.47
d1pn3a_ 391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 99.43
d1iira_ 401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 99.29
d1f0ka_ 351 Peptidoglycan biosynthesis glycosyltransferase Mur 98.12
d2bisa1 437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 94.71
d1rzua_ 477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 93.78
d2iw1a1 370 Lipopolysaccharide core biosynthesis protein RfaG 92.51
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 89.97
d1vmaa2213 GTPase domain of the signal recognition particle r 87.41
d1j8yf2211 GTPase domain of the signal sequence recognition p 86.89
d2qy9a2211 GTPase domain of the signal recognition particle r 84.77
d3bula2156 Methionine synthase, C-terminal domain {Escherichi 83.41
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 81.58
d1okkd2207 GTPase domain of the signal recognition particle r 81.29
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 81.08
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: UDPGT-like
domain: UDP glucose:flavonoid 3-o-glucosyltransferase
species: Grape (Vitis vinifera) [TaxId: 29760]

Probab=99.72  E-value=1.3e-17  Score=135.58  Aligned_cols=127  Identities=20%  Similarity=0.296  Sum_probs=80.1

Q ss_pred             ceEEEEcCCCccchHHHHHHHHHHHHCCCEEEEEeCCCChhhhhhhhhhhhcCCCCeEEEEeeCCCCCCCCCCCCCcccc
Q 039991           36 LHVFFFPFMAHGHMIPIVDMAKLFVTRGVKASVITTPANTPYVSKSVERANELGIEMDVKTVKFPSVEAGLPDGCENLDA  115 (172)
Q Consensus        36 ~~Ilv~p~p~~GH~~P~l~La~~La~rGh~Vt~it~~~~~~~~~~~~~~~~~~~~~i~~~~l~~~~~~~~~p~~~~~~~~  115 (172)
                      +||+++|+|++||++|++.||++|++|||+||+++.....................+++..++     ++++.+......
T Consensus         2 ~hvl~~p~P~~gH~~p~l~la~~L~~rGH~Vt~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~   76 (450)
T d2c1xa1           2 PHVAVLAFPFSTHAAPLLAVVRRLAAAAPHAVFSFFSTSQSNASIFHDSMHTMQCNIKSYDIS-----DGVPEGYVFAGR   76 (450)
T ss_dssp             CEEEEECCCSSSSHHHHHHHHHHHHHHCTTSEEEEEECHHHHHHHC-------CTTEEEEECC-----CCCCTTCCCCCC
T ss_pred             CEEEEECchhHhHHHHHHHHHHHHHHCCCcEEEEEccCccchhhhhcccccccCCCceeeecC-----CCCCcchhhccc
Confidence            799999999999999999999999999999999986533221111100000012245555553     345443322221


Q ss_pred             cchhhhHHHHHHHHH-HHHHhHHHHHHHhhh--CCCCEEEecCCCccHHHHHHHhCCCCC
Q 039991          116 ITNEVNKELIVKFFG-ATTKLQEPLEQLLRD--HKPDCLVADIFFPWATDAAAKFGIPRL  172 (172)
Q Consensus       116 ~~~~~~~~~~~~~~~-~~~~~~~~l~~ll~~--~~~d~VI~D~~~~~a~~vA~~lgiP~v  172 (172)
                      ..     ..+..+.. ....+.+.+.+++.+  .++|+||+|.+..|+..+|+++|+|++
T Consensus        77 ~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dlvi~D~~~~~~~~~a~~~~~p~v  131 (450)
T d2c1xa1          77 PQ-----EDIELFTRAAPESFRQGMVMAVAETGRPVSCLVADAFIWFAADMAAEMGVAWL  131 (450)
T ss_dssp             TT-----HHHHHHHHHHHHHHHHHHHHHHHHHTCCCCEEEEETTSTTHHHHHHHHTCEEE
T ss_pred             hH-----HHHHHHHHHHHHHhHHHHHHHHHhCCCCCeEEEECCccHHHHHHHHHhCCCEE
Confidence            11     22333333 233444444444433  489999999999999999999999964
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bula2 c.23.6.1 (A:741-896) Methionine synthase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure