Citrus Sinensis ID: 039997


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330---
DSALEILDLRDNYFSGRIPYGINEHSNLRALLLKGNYLQGPIPHQLCQLRKLSIMDLSHNRLNGSIPSCITNLLFWKVGNGDLYGLVERGRDFDLEDIYNYYNSTVPLSLDRSDTRTLDTQVVVNFMTKNRYESYKGVILEYMAGLDLSSNELTGDISSEIGDLRNIHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPQLTELHSLSKFDVSYNNLSCPIPDKEQFSTFDESSYRGNLNLCCPPINKSCTNLPELLETSSKGPEDESAVDMVALYWSFVASCVTVMLGLLAILWVNPYWRKLWFYFIEECIDLRYYWLFKYVIYW
cccccEEEcccccccEEccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccEEEccccccccccccccccHHccccccccccccccccccccccccEEEEEEEEcccEEEEccccccccEEEEcccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEHHHHEEHHHHHcccHHHHHHHHHHHHHHcEEEEEEEEEEEEc
cccEEEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEccccccccccccHcccccEEEccccccccccccccccEEEcccccccccccHHHHccccccEEEEcccccccccccHHHcccccccEEEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccccccccccEEEEEcccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHEEEEEEEHEcc
dsaleildlrdnyfsgripyginEHSNLRALLLKgnylqgpiphqlcqLRKLSImdlshnrlngsipscITNLLfwkvgngdlyglvergrdfdleDIYNYYnstvplsldrsdtrtlDTQVVVNFMTKNRYESYKGVILEYMAgldlssneltgdisseigdlrnihglnlshnflsgsipesfsnlkMIESLDLshnklngqipqltelhslskfdvsynnlscpipdkeqfstfdessyrgnlnlccppinksctnlpelletsskgpedesaVDMVALYWSFVASCVTVMLGLLAILWVNPYWRKLWFYFIEECIDLRYYWLFKYVIYW
DSALEILDLRDNYFSGRIPYGINEHSNLRALLLKGNYLQGPIPHQLCQLRKLSIMDLSHNRLNGSIPSCITNLLFWKVGNGDLYGLVERGRDFDLEDIYNYYNStvplsldrsdtrtLDTQVVVnfmtknryesYKGVILEYMAGLDLSSNELTGDISSEIGDLRNIHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPQLTELHSLSKFDVSYNNLSCPIPDKEQFSTFDESSYRGNLNLCCPPINKSCTNLPELLETSSKGPEDESAVDMVALYWSFVASCVTVMLGLLAILWVNPYWRKLWFYFIEECIDLRYYWLFKYVIYW
DSALEILDLRDNYFSGRIPYGINEHSNLRALLLKGNYLQGPIPHQLCQLRKLSIMDLSHNRLNGSIPSCITNLLFWKVGNGDLYGLVERGRDFDLEDIYNYYNSTVPLSLDRSDTRTLDTQVVVNFMTKNRYESYKGVILEYMAGLDLSSNELTGDISSEIGDLRNIHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPQLTELHSLSKFDVSYNNLSCPIPDKEQFSTFDESSYRGNLNLCCPPINKSCTNLPELLETSSKGPEDESAVDMVALYWSFVASCVTVMLGLLAILWVNPYWRKLWFYFIEECIDLRYYWLFKYVIYW
****EILDLRDNYFSGRIPYGINEHSNLRALLLKGNYLQGPIPHQLCQLRKLSIMDLSHNRLNGSIPSCITNLLFWKVGNGDLYGLVERGRDFDLEDIYNYYNSTVPLSLDRSDTRTLDTQVVVNFMTKNRYESYKGVILEYMAGLDLSSNELTGDISSEIGDLRNIHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPQLTELHSLSKFDVSYNNLSCPIPDKEQFSTFDESSYRGNLNLCCPPINKSCTNL****************VDMVALYWSFVASCVTVMLGLLAILWVNPYWRKLWFYFIEECIDLRYYWLFKYVIYW
DSALEILDLRDNYFSGRIPYGINEHSNLRALLLKGNYLQGPIPHQLCQLRKLSIMDLSHNRLNGSIPSCITNLLFWKVGNGDLYGLVERGRDFDLEDIYNYYNSTVPLSLDRSDTRTLDTQVVVNFMTKNRYESYKGVILEYMAGLDLSSNELTGDISSEIGDLRNIHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPQLTELHSLSKFDVSYNNLSCPIPDKEQFSTFDESSYRGNLNLCCPPI**************************VALYWSFVASCVTVMLGLLAILWVNPYWRKLWFYFIEECIDLRYYWLFKYVIYW
DSALEILDLRDNYFSGRIPYGINEHSNLRALLLKGNYLQGPIPHQLCQLRKLSIMDLSHNRLNGSIPSCITNLLFWKVGNGDLYGLVERGRDFDLEDIYNYYNSTVPLSLDRSDTRTLDTQVVVNFMTKNRYESYKGVILEYMAGLDLSSNELTGDISSEIGDLRNIHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPQLTELHSLSKFDVSYNNLSCPIPDKEQFSTFDESSYRGNLNLCCPPINKSCTNLPELLETSSKGPEDESAVDMVALYWSFVASCVTVMLGLLAILWVNPYWRKLWFYFIEECIDLRYYWLFKYVIYW
*SALEILDLRDNYFSGRIPYGINEHSNLRALLLKGNYLQGPIPHQLCQLRKLSIMDLSHNRLNGSIPSCITNLLFWKVGNGDLYGLVERGRDFDLEDIYNYYNSTVPLSLDRSDTRTLDTQVVVNFMTKNRYESYKGVILEYMAGLDLSSNELTGDISSEIGDLRNIHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPQLTELHSLSKFDVSYNNLSCPIPDKEQFSTFDESSYRGNLNLCCPPINKSCT****************SAVDMVALYWSFVASCVTVMLGLLAILWVNPYWRKLWFYFIEECIDLRYYWLFKYVIYW
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DSALEILDLRDNYFSGRIPYGINEHSNLRALLLKGNYLQGPIPHQLCQLRKLSIMDLSHNRLNGSIPSCITNLLFWKVGNGDLYGLVERGRDFDLEDIYNYYNSTVPLSLDRSDTRTLDTQVVVNFMTKNRYESYKGVILEYMAGLDLSSNELTGDISSEIGDLRNIHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPQLTELHSLSKFDVSYNNLSCPIPDKEQFSTFDESSYRGNLNLCCPPINKSCTNLPELLETSSKGPEDESAVDMVALYWSFVASCVTVMLGLLAILWVNPYWRKLWFYFIEECIDLRYYWLFKYVIYW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query333 2.2.26 [Sep-21-2011]
Q9ZWC8 1166 Serine/threonine-protein no no 0.867 0.247 0.310 1e-26
Q8LPB4 1021 Phytosulfokine receptor 1 N/A no 0.648 0.211 0.365 2e-26
C0LGW6 966 LRR receptor-like serine/ no no 0.756 0.260 0.325 1e-25
Q9LHP4 1141 Receptor-like protein kin no no 0.672 0.196 0.326 3e-25
C0LGE4 882 Probable LRR receptor-lik no no 0.627 0.236 0.347 5e-25
Q9ZVR7 1008 Phytosulfokine receptor 1 no no 0.678 0.224 0.361 5e-25
Q9LJF3 1164 Receptor-like protein kin no no 0.864 0.247 0.328 6e-25
C0LGF5 1072 Probable LRR receptor-lik no no 0.672 0.208 0.340 1e-24
Q6XAT2 967 LRR receptor-like serine/ no no 0.708 0.244 0.329 2e-24
O22476 1196 Protein BRASSINOSTEROID I no no 0.879 0.244 0.291 2e-24
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function desciption
 Score =  120 bits (301), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 98/316 (31%), Positives = 144/316 (45%), Gaps = 27/316 (8%)

Query: 7   LDLRDNYFSGRIPYGINEHSNLRALLLKGNYLQGPIPHQLCQLRKLSIMDLSHNRLNGSI 66
           + L  N  +G+IP GI   S L  L L  N L G +P QL   + L  +DL+ N L G +
Sbjct: 504 ISLSSNRLTGKIPSGIGNLSKLAILQLGNNSLSGNVPRQLGNCKSLIWLDLNSNNLTGDL 563

Query: 67  PSCITN---LLFWKVGNGDLYGLV--ERGRD-------FDLEDIYNYYNSTVPLSLDRSD 114
           P  + +   L+     +G  +  V  E G D        + E I       +P+      
Sbjct: 564 PGELASQAGLVMPGSVSGKQFAFVRNEGGTDCRGAGGLVEFEGIRAERLERLPMVHSCPA 623

Query: 115 TRTLDTQVVVNFMTKNRYESYKGVILEYMAGLDLSSNELTGDISSEIGDLRNIHGLNLSH 174
           TR      +  F       S  G ++ +    D+S N ++G I    G++  +  LNL H
Sbjct: 624 TRIYSGMTMYTF-------SANGSMIYF----DISYNAVSGFIPPGYGNMGYLQVLNLGH 672

Query: 175 NFLSGSIPESFSNLKMIESLDLSHNKLNGQIP-QLTELHSLSKFDVSYNNLSCPIPDKEQ 233
           N ++G+IP+SF  LK I  LDLSHN L G +P  L  L  LS  DVS NNL+ PIP   Q
Sbjct: 673 NRITGTIPDSFGGLKAIGVLDLSHNNLQGYLPGSLGSLSFLSDLDVSNNNLTGPIPFGGQ 732

Query: 234 FSTFDESSYRGNLNLCCPPINKSCTNLPELLETSSKGPEDESAVDMVALYWSFVASCVTV 293
            +TF  S Y  N  LC  P+ + C + P    TS    + ++    V    +F   C  +
Sbjct: 733 LTTFPVSRYANNSGLCGVPL-RPCGSAPRRPITSRIHAKKQTVATAVIAGIAFSFMCFVM 791

Query: 294 MLGLLAILWVNPYWRK 309
           +  ++A+  V    +K
Sbjct: 792 L--VMALYRVRKVQKK 805




Receptor with a serine/threonine-protein kinase activity. Regulates, in response to brassinosteroid binding, a signaling cascade involved in plant development. Binds brassinolide. May be involved in cell growth and vascular differentiation.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1 Back     alignment and function description
>sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGE4|Y1124_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g12460 OS=Arabidopsis thaliana GN=At1g12460 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=2 SV=4 Back     alignment and function description
>sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 Back     alignment and function description
>sp|C0LGF5|Y1341_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2 Back     alignment and function description
>sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 Back     alignment and function description
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query333
357468861 1016 Receptor-like protein kinase [Medicago t 0.951 0.312 0.472 9e-73
358345693 1011 Receptor-like protein kinase [Medicago t 0.951 0.313 0.472 1e-72
357468851 942 Receptor-like protein kinase [Medicago t 0.915 0.323 0.466 1e-68
359483163 1047 PREDICTED: LRR receptor-like serine/thre 0.957 0.304 0.469 2e-68
358345471 933 Receptor kinase [Medicago truncatula] gi 0.987 0.352 0.447 2e-68
224134891 953 predicted protein [Populus trichocarpa] 0.957 0.334 0.456 2e-68
358345705 703 Receptor protein kinase-like protein [Me 0.921 0.436 0.481 3e-68
357468869 703 Receptor protein kinase-like protein [Me 0.921 0.436 0.481 4e-68
224115344 552 predicted protein [Populus trichocarpa] 0.957 0.577 0.472 2e-67
298204682 453 unnamed protein product [Vitis vinifera] 0.873 0.642 0.483 9e-67
>gi|357468861|ref|XP_003604715.1| Receptor-like protein kinase [Medicago truncatula] gi|355505770|gb|AES86912.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
 Score =  280 bits (715), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 152/322 (47%), Positives = 214/322 (66%), Gaps = 5/322 (1%)

Query: 4   LEILDLRDNYFSGRIPYGINEHSNLRALLLKGNYLQGPIPHQLCQLRKLSIMDLSHNRLN 63
           L++LDLR+N FSG+IP  +++ S LR LLL GN  +G IP QLC+L+K++IMDLS N LN
Sbjct: 645 LQLLDLRENKFSGKIPNWMDKFSELRVLLLGGNNFEGEIPMQLCRLKKINIMDLSRNMLN 704

Query: 64  GSIPSCITNLLFWKVGNGD-LYGLVERGRDFDLEDIYNYYNSTVPLSLDRSDTRTLDT-- 120
            SIPSC  N+LF      D ++ L        ++D + +++S++ + L     + ++   
Sbjct: 705 ASIPSCFRNMLFGMRQYVDAVFDLSSILYGQHIQDTHYFFDSSLSIDLPLEKDQLIEDLL 764

Query: 121 QVVVNFMTKNRYESYKGVILEYMAGLDLSSNELTGDISSEIGDLRNIHGLNLSHNFLSGS 180
            + V F TK+    YKG +LE M GLDLS N+LTG I S+IGDL+ I  LNLSHN LSG 
Sbjct: 765 HLEVEFRTKHYEYFYKGKVLENMTGLDLSCNKLTGVIPSQIGDLQQIRALNLSHNHLSGP 824

Query: 181 IPESFSNLKMIESLDLSHNKLNGQIP-QLTELHSLSKFDVSYNNLSCPIPDKEQFSTFDE 239
           IP +FSNL  IESLDLS+N L+G+IP +LT+L+ LS F+VSYNNLS   P   QF+ FDE
Sbjct: 825 IPITFSNLTQIESLDLSYNDLSGKIPNELTQLNFLSTFNVSYNNLSGTPPSIGQFANFDE 884

Query: 240 SSYRGNLNLCCPPINKSCTNL-PELLETSSKGPEDESAVDMVALYWSFVASCVTVMLGLL 298
            +YRGN +LC P +++ C  + P     S+   E+E+ VDM+  YWSF AS +T++L  +
Sbjct: 885 DNYRGNPSLCGPLLSRKCERVEPPPSSQSNDNEEEETGVDMITFYWSFTASYITILLAFI 944

Query: 299 AILWVNPYWRKLWFYFIEECID 320
            +L +NP WR  WFY+I + ++
Sbjct: 945 TVLCINPRWRMAWFYYISKFMN 966




Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|358345693|ref|XP_003636910.1| Receptor-like protein kinase [Medicago truncatula] gi|355502845|gb|AES84048.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|357468851|ref|XP_003604710.1| Receptor-like protein kinase [Medicago truncatula] gi|355505765|gb|AES86907.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|359483163|ref|XP_002263908.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|358345471|ref|XP_003636801.1| Receptor kinase [Medicago truncatula] gi|355502736|gb|AES83939.1| Receptor kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|224134891|ref|XP_002327515.1| predicted protein [Populus trichocarpa] gi|222836069|gb|EEE74490.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|358345705|ref|XP_003636916.1| Receptor protein kinase-like protein [Medicago truncatula] gi|355502851|gb|AES84054.1| Receptor protein kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357468869|ref|XP_003604719.1| Receptor protein kinase-like protein [Medicago truncatula] gi|355505774|gb|AES86916.1| Receptor protein kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224115344|ref|XP_002332173.1| predicted protein [Populus trichocarpa] gi|222832421|gb|EEE70898.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|298204682|emb|CBI25180.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query333
TAIR|locus:20250121083 RLP1 "AT1G07390" [Arabidopsis 0.945 0.290 0.460 1.1e-65
TAIR|locus:2019662965 RLP15 "AT1G74190" [Arabidopsis 0.939 0.324 0.465 1e-64
TAIR|locus:2155909908 RLP56 "AT5G49290" [Arabidopsis 0.936 0.343 0.455 6e-64
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.915 0.305 0.458 4.5e-63
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.939 0.351 0.464 3.8e-62
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.939 0.334 0.434 5.4e-60
TAIR|locus:2037308976 RLP14 "AT1G74180" [Arabidopsis 0.924 0.315 0.436 7.5e-59
TAIR|locus:2137296811 RLP46 "receptor like protein 4 0.870 0.357 0.310 1.5e-29
TAIR|locus:2020382756 RLP3 "AT1G17250" [Arabidopsis 0.732 0.322 0.351 1.6e-29
TAIR|locus:2168907 966 XIP1 "XYLEM INTERMIXED WITH PH 0.837 0.288 0.334 1.4e-27
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 675 (242.7 bits), Expect = 1.1e-65, P = 1.1e-65
 Identities = 152/330 (46%), Positives = 207/330 (62%)

Query:     2 SALEILDLRDNYFSGRIPYGINEHSNLRALLLKGNYLQGPIPHQLCQLRKLSIMDLSHNR 61
             + LE+LDLR+N FSG+I   I++ S LR LLL+ N  Q  IP ++CQL ++ ++DLSHN+
Sbjct:   744 AGLEVLDLRNNNFSGKILNTIDQTSKLRILLLRNNSFQTYIPGKICQLSEVGLLDLSHNQ 803

Query:    62 LNGSIPSCITNLLFWKVGNGDLYGLVERGRDFDLEDI----YNYYNSTVPLSLDRSDTRT 117
               G IPSC + + F    N     LV    DFD   I    +  Y S + L     +   
Sbjct:   804 FRGPIPSCFSKMSFGAEQNDRTMSLVA---DFDFSYITFLPHCQYGSHLNLDDGVRNGYQ 860

Query:   118 LDTQVVVNFMTKNRYESYKGVILEYMAGLDLSSNELTGDISSEIGDLRNIHGLNLSHNFL 177
                  VV+F+TK+RYE+Y+G IL YM GLDLSSNEL+G+I  EIGDL+NI  LNLS N L
Sbjct:   861 PKPATVVDFLTKSRYEAYQGDILRYMHGLDLSSNELSGEIPIEIGDLQNIRSLNLSSNRL 920

Query:   178 SGSIPESFSNLKMIESLDLSHNKLNGQIPQ-LTELHSLSKFDVSYNNLSCPIPDKEQFST 236
             +GSIP+S S LK +ESLDLS+NKL+G IP  L +L+SL   ++SYNNLS  IP K    T
Sbjct:   921 TGSIPDSISKLKGLESLDLSNNKLDGSIPPALADLNSLGYLNISYNNLSGEIPFKGHLVT 980

Query:   237 FDESSYRGNLNLCCPPINKSCTN--LPE--LLETSSKGPEDE---SAVDMVALYWSFVAS 289
             FDE SY GN +LC  P NK+C +  +PE   + T +K  E+E   + +DMV  YW+  A 
Sbjct:   981 FDERSYIGNAHLCGLPTNKNCISQRVPEPPSVSTHAKEEENEEEGNVIDMVWFYWTCAAV 1040

Query:   290 CVTVMLGLLAILWVNPYWRKLWFYFIEECI 319
              ++  L L A L+++  W + WFY ++ C+
Sbjct:  1041 YISTSLALFAFLYIDSRWSREWFYRVDLCV 1070


GO:0005575 "cellular_component" evidence=ND
GO:0007165 "signal transduction" evidence=IC
GO:0006457 "protein folding" evidence=RCA
GO:0006857 "oligopeptide transport" evidence=RCA
GO:0009408 "response to heat" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137296 RLP46 "receptor like protein 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020382 RLP3 "AT1G17250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168907 XIP1 "XYLEM INTERMIXED WITH PHLOEM 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query333
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-29
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-25
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-24
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-22
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-16
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-04
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  119 bits (299), Expect = 1e-29
 Identities = 91/309 (29%), Positives = 144/309 (46%), Gaps = 37/309 (11%)

Query: 4   LEILDLRDNYFSGRIPYGINEHSNLRALLLKGNYLQGPIPHQLCQLRKLSIMDLSHNRLN 63
           L +LDL  N  +G IP G+    NL  L+L  N L+G IP  L   R L  + L  N  +
Sbjct: 358 LTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFS 417

Query: 64  GSIPSCITNL---LFWKVGNGDLYGLVERGRDFDLEDI------YNYYNSTVPLSLDRSD 114
           G +PS  T L    F  + N +L G +   R +D+  +       N +   +P S     
Sbjct: 418 GELPSEFTKLPLVYFLDISNNNLQGRIN-SRKWDMPSLQMLSLARNKFFGGLPDSFGSKR 476

Query: 115 TRTLDTQVVVNFMTKNRYE----SYKGVILEYMAGLDLSSNELTGDISSEIGDLRNIHGL 170
              LD       +++N++        G + E M  L LS N+L+G+I  E+   + +  L
Sbjct: 477 LENLD-------LSRNQFSGAVPRKLGSLSELMQ-LKLSENKLSGEIPDELSSCKKLVSL 528

Query: 171 NLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPQ-LTELHSLSKFDVSYNNLSCPIP 229
           +LSHN LSG IP SFS + ++  LDLS N+L+G+IP+ L  + SL + ++S+N+L   +P
Sbjct: 529 DLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLP 588

Query: 230 DKEQFSTFDESSYRGNLNLCCPPINKSCTNLPELLETSSKGPEDESAVDMVALYWSFVAS 289
               F   + S+  GN++LC                 ++ G      V     +W ++  
Sbjct: 589 STGAFLAINASAVAGNIDLCG--------------GDTTSGLPPCKRVRKTPSWWFYITC 634

Query: 290 CVTVMLGLL 298
            +   L L 
Sbjct: 635 TLGAFLVLA 643


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 333
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.93
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.9
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.89
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.86
KOG0617264 consensus Ras suppressor protein (contains leucine 99.79
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.75
KOG4237498 consensus Extracellular matrix protein slit, conta 99.74
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.66
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.66
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.63
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.62
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.59
PLN03150623 hypothetical protein; Provisional 99.58
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.57
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.57
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.56
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.51
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.43
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.43
PLN03150623 hypothetical protein; Provisional 99.39
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.39
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.39
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.34
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.34
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.32
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.29
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.27
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.27
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.18
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.17
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.09
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.01
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.01
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.95
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.78
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.74
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.69
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.62
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.61
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.57
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.4
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.36
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.32
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.29
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.19
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.18
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.18
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.1
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.1
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.02
PRK15386426 type III secretion protein GogB; Provisional 97.79
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.59
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.57
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.5
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.48
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.35
PRK15386426 type III secretion protein GogB; Provisional 97.3
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.29
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.25
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.05
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.86
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.53
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.44
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.37
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.95
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 95.89
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.25
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 95.23
smart0037026 LRR Leucine-rich repeats, outliers. 95.23
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.74
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.7
smart0037026 LRR Leucine-rich repeats, outliers. 94.7
KOG4308478 consensus LRR-containing protein [Function unknown 93.73
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.48
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.9
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 90.12
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.71
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 89.32
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 88.26
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 87.92
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 87.05
KOG4308478 consensus LRR-containing protein [Function unknown 86.15
PF12273130 RCR: Chitin synthesis regulation, resistance to Co 84.17
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 82.14
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.93  E-value=3.7e-25  Score=225.15  Aligned_cols=243  Identities=34%  Similarity=0.527  Sum_probs=179.3

Q ss_pred             CcccEEECCCCcCCCCCCccccCCcccceeeccccccccccchhhcCCCCCCEEeCCCCcCCCCCChhhhcc---ccccc
Q 039997            2 SALEILDLRDNYFSGRIPYGINEHSNLRALLLKGNYLQGPIPHQLCQLRKLSIMDLSHNRLNGSIPSCITNL---LFWKV   78 (333)
Q Consensus         2 ~~L~~L~Ls~N~i~~~~~~~~~~l~~L~~L~L~~N~i~~~~~~~f~~L~~L~~LdLs~N~l~~~~p~~l~~L---~~L~~   78 (333)
                      ++|+.||+++|.+++..|..+..+++|+.|++++|.+.+..|..+..+++|+.|++++|++++..|..+..+   ..|++
T Consensus       356 ~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L  435 (968)
T PLN00113        356 NNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDI  435 (968)
T ss_pred             CCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEEC
Confidence            467888888888888888888888888888888888887888888888888888888888877777666544   45556


Q ss_pred             cCCccccccccCCCCcccccccccCCCCCcCCCCCCCCc------cccceEEEEeeccccc-cchhh--hhccccEEECC
Q 039997           79 GNGDLYGLVERGRDFDLEDIYNYYNSTVPLSLDRSDTRT------LDTQVVVNFMTKNRYE-SYKGV--ILEYMAGLDLS  149 (333)
Q Consensus        79 ~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~-~~~~~--~l~~L~~L~Ls  149 (333)
                      ++|.+.+..........        ....+.+..+.+..      .........+..+.+. ..+..  .+++|+.|+++
T Consensus       436 s~N~l~~~~~~~~~~l~--------~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls  507 (968)
T PLN00113        436 SNNNLQGRINSRKWDMP--------SLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLS  507 (968)
T ss_pred             cCCcccCccChhhccCC--------CCcEEECcCceeeeecCcccccccceEEECcCCccCCccChhhhhhhccCEEECc
Confidence            66666553321110000        00001111110000      0011222233333322 11111  16789999999


Q ss_pred             CCcccccCCccccCccccceeecccccCCCCchHHHhCCCCCCEEeccCCcccCCCC-CCCCCCCCCEEEcccCcCcccC
Q 039997          150 SNELTGDISSEIGDLRNIHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIP-QLTELHSLSKFDVSYNNLSCPI  228 (333)
Q Consensus       150 ~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~-~~~~l~~L~~L~l~~N~l~~~~  228 (333)
                      +|++.+..|..+.++++|+.|+|++|.+++..|..|+.+++|+.|++++|++++..| .+..+..|+.+++++|++.+.+
T Consensus       508 ~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~  587 (968)
T PLN00113        508 ENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSL  587 (968)
T ss_pred             CCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeC
Confidence            999999999999999999999999999999999999999999999999999998888 8899999999999999999999


Q ss_pred             CCCccccccCccccCCCCCCCCCC
Q 039997          229 PDKEQFSTFDESSYRGNLNLCCPP  252 (333)
Q Consensus       229 ~~~~~~~~l~~~~~~~n~~~c~~~  252 (333)
                      |....+..+...++.+|+..|+.+
T Consensus       588 p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        588 PSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             CCcchhcccChhhhcCCccccCCc
Confidence            988888888888899999999754



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF12273 RCR: Chitin synthesis regulation, resistance to Congo red; InterPro: IPR020999 RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query333
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-25
3rgx_A768 Structural Insight Into Brassinosteroid Perception 4e-25
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-16
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-07
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 112 bits (279), Expect = 4e-25, Method: Compositional matrix adjust. Identities = 104/332 (31%), Positives = 147/332 (44%), Gaps = 80/332 (24%) Query: 2 SALEILDLRDNYFSGRIPYGINEHSNLRALLLKGNYLQGPIPHQLCQLRKLSIMDLSHNR 61 S L L L NY SG IP + S LR L L N L+G IP +L ++ L + L N Sbjct: 415 SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFND 474 Query: 62 LNGSIPSCI---TNLLFWKVGNGDLYGLVER--GRDFDLEDIY---NYYNSTVPLSLDRS 113 L G IPS + TNL + + N L G + + GR +L + N ++ +P L Sbjct: 475 LTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAEL--G 532 Query: 114 DTRTL---------------------DTQVVVNFMTKNRYESYK-----------GVILE 141 D R+L ++ NF+ RY K G +LE Sbjct: 533 DCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLE 592 Query: 142 Y-------------------------------------MAGLDLSSNELTGDISSEIGDL 164 + M LD+S N L+G I EIG + Sbjct: 593 FQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSM 652 Query: 165 RNIHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPQ-LTELHSLSKFDVSYNN 223 + LNL HN +SGSIP+ +L+ + LDLS NKL+G+IPQ ++ L L++ D+S NN Sbjct: 653 PYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNN 712 Query: 224 LSCPIPDKEQFSTFDESSYRGNLNLCCPPINK 255 LS PIP+ QF TF + + N LC P+ + Sbjct: 713 LSGPIPEMGQFETFPPAKFLNNPGLCGYPLPR 744
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query333
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-77
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-39
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-37
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-36
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-36
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-36
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-36
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-34
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-33
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-33
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-32
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-32
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-28
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-16
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-56
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-36
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-32
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-28
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-23
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-22
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-20
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-24
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-23
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-23
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-22
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-21
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-21
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-21
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-19
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-16
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-21
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-20
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-20
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-18
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-17
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-21
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-20
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-19
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-18
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-14
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-16
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-16
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-16
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-16
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-15
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-14
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-11
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-13
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-08
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-14
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 8e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-09
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-10
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 6e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-11
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-07
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 8e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-07
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 5e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-05
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 8e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-04
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  250 bits (640), Expect = 4e-77
 Identities = 82/273 (30%), Positives = 126/273 (46%), Gaps = 4/273 (1%)

Query: 2   SALEILDLRDNYFSGRIPYGINEHSNLRALLLKGNYLQGPIPHQLCQLRKLSIMDLSHNR 61
           + L  + L +N  +G IP  I    NL  L L  N   G IP +L   R L  +DL+ N 
Sbjct: 490 TNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNL 549

Query: 62  LNGSIPSCITNLLFWKVGNGDLYGLVERGRDFDLEDIYNYYNSTVPLSLDRSDTRTLDTQ 121
            NG+IP+ +         N          ++  ++   +   + +     RS+     + 
Sbjct: 550 FNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLST 609

Query: 122 VVVNFMTKNRY---ESYKGVILEYMAGLDLSSNELTGDISSEIGDLRNIHGLNLSHNFLS 178
                +T   Y    S        M  LD+S N L+G I  EIG +  +  LNL HN +S
Sbjct: 610 RNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDIS 669

Query: 179 GSIPESFSNLKMIESLDLSHNKLNGQIP-QLTELHSLSKFDVSYNNLSCPIPDKEQFSTF 237
           GSIP+   +L+ +  LDLS NKL+G+IP  ++ L  L++ D+S NNLS PIP+  QF TF
Sbjct: 670 GSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETF 729

Query: 238 DESSYRGNLNLCCPPINKSCTNLPELLETSSKG 270
             + +  N  LC  P+ +   +  +      + 
Sbjct: 730 PPAKFLNNPGLCGYPLPRCDPSNADGYAHHQRS 762


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query333
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.92
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.91
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.9
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.9
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.9
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.89
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.89
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.89
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.89
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.89
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.89
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.89
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.88
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.88
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.88
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.88
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.88
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.87
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.87
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.87
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.87
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.87
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.86
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.86
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.86
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.86
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.85
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.85
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.85
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.85
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.85
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.85
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.84
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.84
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.84
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.84
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.84
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.83
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.83
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.83
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.83
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.83
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.82
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.82
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.82
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.81
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.81
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.8
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.8
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.79
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.79
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.78
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.78
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.77
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.77
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.77
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.77
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.76
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.75
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.75
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.75
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.74
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.73
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.72
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.72
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.72
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.71
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.7
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.7
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.68
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.67
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.66
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.66
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.66
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.63
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.61
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.61
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.6
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.6
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.59
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.54
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.52
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.47
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.44
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.42
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.26
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.21
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.19
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.12
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.12
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.94
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.74
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.64
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.61
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.56
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.56
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.53
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.46
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.33
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.09
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.07
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.05
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.01
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.0
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.0
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.94
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.8
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.41
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.33
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 89.24
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 87.83
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 80.04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=99.96  E-value=3.2e-28  Score=240.51  Aligned_cols=119  Identities=44%  Similarity=0.679  Sum_probs=113.4

Q ss_pred             hccccEEECCCCcccccCCccccCccccceeecccccCCCCchHHHhCCCCCCEEeccCCcccCCCC-CCCCCCCCCEEE
Q 039997          140 LEYMAGLDLSSNELTGDISSEIGDLRNIHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIP-QLTELHSLSKFD  218 (333)
Q Consensus       140 l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~-~~~~l~~L~~L~  218 (333)
                      +.+|+.|||++|++++..|..++++++|+.|+|++|++++.+|..++.+++|+.|||++|++++..| .+..++.|+.|+
T Consensus       631 l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~  710 (768)
T 3rgz_A          631 NGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEID  710 (768)
T ss_dssp             SBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEE
T ss_pred             cccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEE
Confidence            5779999999999999999999999999999999999999999999999999999999999999998 999999999999


Q ss_pred             cccCcCcccCCCCccccccCccccCCCCCCCCCCCCCCCCC
Q 039997          219 VSYNNLSCPIPDKEQFSTFDESSYRGNLNLCCPPINKSCTN  259 (333)
Q Consensus       219 l~~N~l~~~~~~~~~~~~l~~~~~~~n~~~c~~~~~~~c~~  259 (333)
                      +++|+++|.+|....+..+...++.||+.+|+.|.. .|..
T Consensus       711 ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~  750 (768)
T 3rgz_A          711 LSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDP  750 (768)
T ss_dssp             CCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCS
T ss_pred             CcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-CCCC
Confidence            999999999999999999999999999999999876 8864



>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 333
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-08
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-11
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-06
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 75.4 bits (184), Expect = 6e-16
 Identities = 46/217 (21%), Positives = 81/217 (37%), Gaps = 36/217 (16%)

Query: 7   LDLRDNYFSGRIPYGINEHSNLRALLLKGNYLQGPIPHQLCQLRKLSIMDLSHNRLNGSI 66
           L   +N  S   P GI   +NL  L L GN L+      L  L  L+ +DL++N+++   
Sbjct: 202 LIATNNQISDITPLGI--LTNLDELSLNGNQLKDI--GTLASLTNLTDLDLANNQISNLA 257

Query: 67  P-SCITNLLFWKVGNGDLYGLVERGRDFDLEDIYNYYNSTVPLSLDRSDTRTLDTQVVVN 125
           P S +T L   K+G   +  +        L ++    N                      
Sbjct: 258 PLSGLTKLTELKLGANQISNISPLAGLTALTNLELNEN---------------------- 295

Query: 126 FMTKNRYESYKGVILEYMAGLDLSSNELTGDISSEIGDLRNIHGLNLSHNFLSGSIPESF 185
                  +      L+ +  L L  N ++    S +  L  +  L  ++N +S     S 
Sbjct: 296 ----QLEDISPISNLKNLTYLTLYFNNISD--ISPVSSLTKLQRLFFANNKVSD--VSSL 347

Query: 186 SNLKMIESLDLSHNKLNGQIPQLTELHSLSKFDVSYN 222
           +NL  I  L   HN+++   P L  L  +++  ++  
Sbjct: 348 ANLTNINWLSAGHNQISDLTP-LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query333
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.91
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.87
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.86
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.84
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.83
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.79
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.76
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.76
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.75
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.66
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.63
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.63
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.6
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.56
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.56
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.56
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.5
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.4
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.37
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.35
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.07
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.05
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.95
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.88
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.78
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.69
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.6
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.92
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.78
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.32
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.08
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93  E-value=6.2e-26  Score=194.21  Aligned_cols=200  Identities=18%  Similarity=0.113  Sum_probs=145.0

Q ss_pred             cccEEECCCCcCCCCCCccccCCcccceeeccccccccccchhhcCCCCCCEEeCCCCcCCCCCC-hhhhccccccccCC
Q 039997            3 ALEILDLRDNYFSGRIPYGINEHSNLRALLLKGNYLQGPIPHQLCQLRKLSIMDLSHNRLNGSIP-SCITNLLFWKVGNG   81 (333)
Q Consensus         3 ~L~~L~Ls~N~i~~~~~~~~~~l~~L~~L~L~~N~i~~~~~~~f~~L~~L~~LdLs~N~l~~~~p-~~l~~L~~L~~~~n   81 (333)
                      .+.+.|.++++++ .+|..+.  +++++|+|++|+|+++.+++|.++++|++|+|++|+|+...+ ..+.+|+.|++++|
T Consensus        11 ~~~~v~C~~~~L~-~iP~~lp--~~l~~L~Ls~N~i~~l~~~~f~~l~~L~~L~L~~N~l~~l~~~~~l~~L~~L~Ls~N   87 (266)
T d1p9ag_          11 SHLEVNCDKRNLT-ALPPDLP--KDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRAELTKLQVDGTLPVLGTLDLSHN   87 (266)
T ss_dssp             TCCEEECTTSCCS-SCCSCCC--TTCCEEECTTSCCSEEEGGGGTTCTTCCEEECTTSCCCEEECCSCCTTCCEEECCSS
T ss_pred             CCeEEEccCCCCC-eeCcCcC--cCCCEEECcCCcCCCcCHHHhhccccccccccccccccccccccccccccccccccc
Confidence            4556788888887 4666554  567888888888877777778888888888888888773221 24556777777777


Q ss_pred             ccccccccCCCCcccccccccCCCCCcCCCCCCCCccccceEEEEeeccccccch---hhhhccccEEECCCCcccccCC
Q 039997           82 DLYGLVERGRDFDLEDIYNYYNSTVPLSLDRSDTRTLDTQVVVNFMTKNRYESYK---GVILEYMAGLDLSSNELTGDIS  158 (333)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~l~~L~~L~Ls~n~l~~~~~  158 (333)
                      .+..........  .       ...                 ...+..+......   ...+.+++.|++++|.++.+.+
T Consensus        88 ~l~~~~~~~~~l--~-------~L~-----------------~L~l~~~~~~~~~~~~~~~l~~l~~L~l~~n~l~~l~~  141 (266)
T d1p9ag_          88 QLQSLPLLGQTL--P-------ALT-----------------VLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPP  141 (266)
T ss_dssp             CCSSCCCCTTTC--T-------TCC-----------------EEECCSSCCCCCCSSTTTTCTTCCEEECTTSCCCCCCT
T ss_pred             cccccccccccc--c-------ccc-----------------cccccccccceeeccccccccccccccccccccceecc
Confidence            765533221110  0       000                 0011111111111   1116789999999999998888


Q ss_pred             ccccCccccceeecccccCCCCchHHHhCCCCCCEEeccCCcccCCCCCCCCCCCCCEEEcccCcCcccCCCC
Q 039997          159 SEIGDLRNIHGLNLSHNFLSGSIPESFSNLKMIESLDLSHNKLNGQIPQLTELHSLSKFDVSYNNLSCPIPDK  231 (333)
Q Consensus       159 ~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~l~~L~~L~l~~N~l~~~~~~~  231 (333)
                      ..+..+++++.+++++|++++..+..|+.+++|++|+|++|+|+.+++.+..+++|+.|++++|+|.|.|...
T Consensus       142 ~~~~~l~~l~~l~l~~N~l~~~~~~~~~~l~~L~~L~Ls~N~L~~lp~~~~~~~~L~~L~L~~Np~~CdC~~~  214 (266)
T d1p9ag_         142 GLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEIL  214 (266)
T ss_dssp             TTTTTCTTCCEEECTTSCCSCCCTTTTTTCTTCCEEECCSSCCCCCCTTTTTTCCCSEEECCSCCBCCSGGGH
T ss_pred             ccccccccchhcccccccccccCccccccccccceeecccCCCcccChhHCCCCCCCEEEecCCCCCCCcchH
Confidence            9999999999999999999999889999999999999999999977667778999999999999999999644



>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure