Citrus Sinensis ID: 040039

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270----
YACGFFCNGTCDSYLFAVFIVQAYNASLIDYQHIEFPQVVWSANRNNPVRINATLELTSDGNLVLQDADGAIAWSTNTSGKSVVGLNLTDMGNLVLFDKNNAAVWQSFDHPTDSLVPGQKLLEGKKLTASVSTTNWTDGGLFSLSVTNEGLFAFIESNNTSIRYYALVKATKTSKEPSHARYLNGSLAFFINSSEPREPDGAVPVPPASSSPGQYMRLWPDGHLRVYEWQASIGWTEVADLLTGYLGECGYPLVCGKYGICSQGQCSCPATYFK
cEEEcccccccccEEEEEEEEcccccccccccccccccEEEEcccccccccccEEEEcccccEEEEcccccEEEEcccccccccEEEEEccccEEEEcccccEEEEcccccccccccccccccccEEEEccEEEcccccccEEEEEcccccEEEEEEccccEEEcccccccccccccccEEEEcccEEEEEcccccccccEEEEEcccccccEEEEEEcccccEEEEEEEccccEEEEEEEccccccccccccccccccccccccccccccccc
cccccEcccccccEEEEEEEEEccccccHHHccccccEEEEEEEccccccccccEEEEccccEEEEcccccEEEEccccccccEHEEEcccccEEEEEccccEEEEEcccccccccccccccccccccccEEEEEEcccccEEEEEccccccEEEEEcccEEEEccccccEEEcccccccccccccccEEEEEEcccccEEEEEEEEccccEEEEEEEccccEEEEEEEccccccHHHHEEccccccccccHcccccccccccccccccccccc
yacgffcngtcdSYLFAVFIVQAYNAslidyqhiefpqvvwsanrnnpvriNATLeltsdgnlvlqdadgaiawstntsgksvvglnltdmgnlvlfdknnaavwqsfdhptdslvpgqkllegkkltasvsttnwtdgglfsLSVTNEGLFAFIESNNTSIRYYALVKAtktskepsharylNGSLAFfinsseprepdgavpvppassspgqymrlwpdghlRVYEWQASIGWTEVADLLTGylgecgyplvcgkygicsqgqcscpatyfk
YACGFFCNGTCDSYLFAVFIVQAYNASLIDYQHIEFPQVVWSANRNNPVRINATLELTSDGNLVLQDADGAIAWSTNTSGKSVVGLNLTDMGNLVLFDKNNAAVWQSFDHPTDSLVPGQKLLEGKKLTASVSTTNWTDGGLFSLSVTNEGLFAFIESNNTSIRYYALVKATktskepsharYLNGSLAFFINSSEPREPDGAVPVPPASSSPGQYMRLWPDGHLRVYEWQASIGWTEVADLLTGYLGECGYPLVCGKYGICSQGQCSCPATYFK
YACGFFCNGTCDSYLFAVFIVQAYNASLIDYQHIEFPQVVWSANRNNPVRINATLELTSDGNLVLQDADGAIAWSTNTSGKSVVGLNLTDMGNLVLFDKNNAAVWQSFDHPTDSLVPGQKLLEGKKLTASVSTTNWTDGGLFSLSVTNEGLFAFIESNNTSIRYYALVKATKTSKEPSHARYLNGSLAFFINSSEPREPDGavpvppassspGQYMRLWPDGHLRVYEWQASIGWTEVADLLTGYLGECGYPLVCGKYGICSQGQCSCPATYFK
*ACGFFCNGTCDSYLFAVFIVQAYNASLIDYQHIEFPQVVWSANRNNPVRINATLELTSDGNLVLQDADGAIAWSTNTSGKSVVGLNLTDMGNLVLFDKNNAAVWQSFDHPTDSLVPGQKLLEGKKLTASVSTTNWTDGGLFSLSVTNEGLFAFIESNNTSIRYYALVKAT********ARYLNGSLAFFI***********************YMRLWPDGHLRVYEWQASIGWTEVADLLTGYLGECGYPLVCGKYGICSQGQCSCPATY**
YACGFFCNGTCDSYLFAVFIVQAYNASLIDYQHIEFPQVVWSANRNNPVRINATLELTSDGNLVLQDADGAIAWSTNTSGKSVVGLNLTDMGNLVLFDKNNAAVWQSFDHPTDSLVPGQKLLEGKKLTASVSTTNWTDGGLFSLSVTNEGLFAFIESNNTSIRYYALVKATKTSKEPSHARYLNGSLAFFINSSEPREPDGAVPVPPASSSPGQYMRLWPDGHLRVYEWQASIGWTEVADLLTGYLGECGYPLVCGKYGICSQGQCSCPATYFK
YACGFFCNGTCDSYLFAVFIVQAYNASLIDYQHIEFPQVVWSANRNNPVRINATLELTSDGNLVLQDADGAIAWSTNTSGKSVVGLNLTDMGNLVLFDKNNAAVWQSFDHPTDSLVPGQKLLEGKKLTASVSTTNWTDGGLFSLSVTNEGLFAFIESNNTSIRYYALVKA********HARYLNGSLAFFINSSEP**************SPGQYMRLWPDGHLRVYEWQASIGWTEVADLLTGYLGECGYPLVCGKYGICSQGQCSCPATYFK
*ACGFFCNGTCDSYLFAVFIVQAYNASLIDYQHIEFPQVVWSANRNNPVRINATLELTSDGNLVLQDADGAIAWSTNTSGKSVVGLNLTDMGNLVLFDKNNAAVWQSFDHPTDSLVPGQKLLEGKKLTASVSTTNWTDGGLFSLSVTNEGLFAFIESNNTSIRYYALVKATKTSKEPSHARYLNGSLAFFINSSEPREPDGAVPVPPASSSPGQYMRLWPDGHLRVYEWQASIGWTEVADLLTGYLGECGYPLVCGKYGICSQGQCSCPATYFK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YACGFFCNGTCDSYLFAVFIVQAYNASLIDYQHIEFPQVVWSANRNNPVRINATLELTSDGNLVLQDADGAIAWSTNTSGKSVVGLNLTDMGNLVLFDKNNAAVWQSFDHPTDSLVPGQKLLEGKKLTASVSTTNWTDGGLFSLSVTNEGLFAFIESNNTSIRYYALVKATKTSKEPSHARYLNGSLAFFINSSEPREPDGAVPVPPASSSPGQYMRLWPDGHLRVYEWQASIGWTEVADLLTGYLGECGYPLVCGKYGICSQGQCSCPATYFK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query274 2.2.26 [Sep-21-2011]
Q39688389 Epidermis-specific secret N/A no 0.843 0.593 0.309 7e-25
O65238 872 G-type lectin S-receptor- no no 0.828 0.260 0.330 1e-22
P17801 817 Putative receptor protein N/A no 0.799 0.268 0.313 7e-17
Q8RWZ5 821 G-type lectin S-receptor- no no 0.405 0.135 0.376 7e-16
Q9FLV4 872 G-type lectin S-receptor- no no 0.441 0.138 0.348 1e-13
Q9SY89 842 Putative G-type lectin S- no no 0.839 0.273 0.284 2e-13
Q9ZR08 852 G-type lectin S-receptor- no no 0.759 0.244 0.303 6e-13
O81906 849 G-type lectin S-receptor- no no 0.934 0.301 0.267 1e-12
Q9S972 847 Receptor-like serine/thre no no 0.492 0.159 0.386 4e-12
Q39086 843 Receptor-like serine/thre no no 0.492 0.160 0.372 4e-12
>sp|Q39688|EP1G_DAUCA Epidermis-specific secreted glycoprotein EP1 OS=Daucus carota GN=EP1 PE=1 SV=1 Back     alignment and function desciption
 Score =  114 bits (285), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 82/265 (30%), Positives = 125/265 (47%), Gaps = 34/265 (12%)

Query: 40  VWSANRNNPVRINATLELTSDGNLVLQDADGAIAWSTNTSGKSVVGLNLTDMGNLVLFDK 99
           VW ANR NPV  NATL    DGNLVL  ++G +AW T+T+ K VVGL +   GN+VL+D 
Sbjct: 91  VWEANRGNPVDENATLTFGPDGNLVLARSNGQVAWQTSTANKGVVGLKILPNGNMVLYDS 150

Query: 100 NNAAVWQSFDHPTDSLVPGQKLLEG--KKLTASVSTTNWTDGGLFSLSVTNEGLFAFIES 157
               +WQSFD PTD+L+ GQ L  G   KL +  S     +G  +SL +  +GL  + + 
Sbjct: 151 KGKFLWQSFDTPTDTLLVGQSLKMGAVTKLVSRASPGENVNGP-YSLVMEPKGLHLYYKP 209

Query: 158 NNT--SIRYYALVKATKTSKEPSHARYL-------NGSLAFFIN---SSEPREPDGAVPV 205
             +   IRYY+    TK +K  S            +   AF ++    +       ++  
Sbjct: 210 TTSPKPIRYYSFSLFTKLNKNESLQNVTFEFENENDQGFAFLLSLKYGTSNSLGGASILN 269

Query: 206 PPASSSPGQYMRLWPDGHLRVYEWQASIGWTEVADLLTGYL------------------G 247
               ++   ++RL  DG++++Y +   + +       T +L                   
Sbjct: 270 RIKYNTTLSFLRLEIDGNVKIYTYNDKVDYGAWEVTYTLFLKAPPPLFQVSLAATESESS 329

Query: 248 ECGYPLVCGKYGICSQGQC-SCPAT 271
           EC  P  CG +G+C + QC  CP +
Sbjct: 330 ECQLPKKCGNFGLCEESQCVGCPTS 354
May be involved in the limitation of water flow through the outer epidermal cell wall, either by direct modification of wall structure or as a signal instructing the protoplast to restrict water transport across the cell wall.
Daucus carota (taxid: 4039)
>sp|O65238|Y5537_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At5g35370 OS=Arabidopsis thaliana GN=At5g35370 PE=2 SV=2 Back     alignment and function description
>sp|P17801|KPRO_MAIZE Putative receptor protein kinase ZmPK1 OS=Zea mays GN=PK1 PE=2 SV=2 Back     alignment and function description
>sp|Q8RWZ5|SD25_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5 OS=Arabidopsis thaliana GN=SD25 PE=1 SV=1 Back     alignment and function description
>sp|Q9FLV4|Y5248_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080 OS=Arabidopsis thaliana GN=At5g24080 PE=2 SV=1 Back     alignment and function description
>sp|Q9SY89|Y1661_ARATH Putative G-type lectin S-receptor-like serine/threonine-protein kinase At1g61610 OS=Arabidopsis thaliana GN=At1g61610 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZR08|Y4230_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230 OS=Arabidopsis thaliana GN=At4g03230 PE=3 SV=3 Back     alignment and function description
>sp|O81906|B120_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase B120 OS=Arabidopsis thaliana GN=B120 PE=1 SV=1 Back     alignment and function description
>sp|Q9S972|SD16_ARATH Receptor-like serine/threonine-protein kinase SD1-6 OS=Arabidopsis thaliana GN=SD16 PE=1 SV=2 Back     alignment and function description
>sp|Q39086|SD17_ARATH Receptor-like serine/threonine-protein kinase SD1-7 OS=Arabidopsis thaliana GN=SD17 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query274
338190111 830 lectin-domain receptor-like kinase [Nico 0.974 0.321 0.649 2e-99
255569833 837 serine-threonine protein kinase, plant-t 0.989 0.323 0.658 9e-97
255569831 457 S-locus-specific glycoprotein precursor, 0.989 0.592 0.658 6e-96
255569825 870 serine-threonine protein kinase, plant-t 0.978 0.308 0.546 1e-79
302143473 830 unnamed protein product [Vitis vinifera] 0.948 0.313 0.546 4e-79
359485463 848 PREDICTED: G-type lectin S-receptor-like 0.948 0.306 0.546 5e-79
116309112 838 OSIGBa0157N01.3 [Oryza sativa Indica Gro 0.974 0.318 0.501 6e-75
125547684 863 hypothetical protein OsI_15301 [Oryza sa 0.974 0.309 0.498 9e-75
116308953 864 H0215E01.7 [Oryza sativa Indica Group] 0.963 0.305 0.496 1e-72
70663992 864 OSJNBb0018A10.15 [Oryza sativa Japonica 0.963 0.305 0.496 2e-72
>gi|338190111|gb|AEI84329.1| lectin-domain receptor-like kinase [Nicotiana attenuata] Back     alignment and taxonomy information
 Score =  368 bits (944), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 176/271 (64%), Positives = 210/271 (77%), Gaps = 4/271 (1%)

Query: 1   YACGFFCNGTCDSYLFAVFIVQAYNASLIDYQHIEFPQVVWSANRNNPVRINATLELTSD 60
           YACGF+CNG C+SY+FA+FIVQ  + SLI    I FPQVVWSANRNNPV+IN+TL+LT+ 
Sbjct: 67  YACGFYCNGNCESYIFAIFIVQTNSISLITMPAIGFPQVVWSANRNNPVKINSTLQLTAQ 126

Query: 61  GNLVLQDADGAIAWSTNTSGKSVVGLNLTDMGNLVLFDKNNAAVWQSFDHPTDSLVPGQK 120
           G+LVL+DADG +AWSTN++GKSV GLNLTD GNLVLFD  NA VWQSFDHPTDSLVPGQK
Sbjct: 127 GDLVLRDADGTLAWSTNSTGKSVAGLNLTDEGNLVLFDSKNATVWQSFDHPTDSLVPGQK 186

Query: 121 LLEGKKLTASVSTTNWTDGGLFSLSVTNEGLFAFIESNNTSIRYYALVKATKTSKEPSHA 180
           L+ G KLTASVSTTNWT GGLFS S TN+GL AF+ESN     +   +    TS   ++ 
Sbjct: 187 LVPGMKLTASVSTTNWTKGGLFSFSATNDGLVAFVESNPPQTYFEKSIGGLNTSGGSNYV 246

Query: 181 RYLNGSLAFFINSSEPREPDGAVPVPPASSSPGQYMRLWPDGHLRVYEWQASIGWTEVAD 240
            YLNGSLA   NSS+   P   + +PPASS+  QYM+L  DGHL+VYEWQ+   W EV D
Sbjct: 247 MYLNGSLALLSNSSDSNNPRTLISIPPASSA--QYMKLESDGHLKVYEWQSR--WNEVND 302

Query: 241 LLTGYLGECGYPLVCGKYGICSQGQCSCPAT 271
           LLTG+ GEC YP++CG+YGICS+GQCSCP +
Sbjct: 303 LLTGFNGECYYPMICGRYGICSRGQCSCPKS 333

Source: Nicotiana attenuata

Species: Nicotiana attenuata

Genus: Nicotiana

Family: Solanaceae

Order: Solanales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255569833|ref|XP_002525880.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223534794|gb|EEF36484.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255569831|ref|XP_002525879.1| S-locus-specific glycoprotein precursor, putative [Ricinus communis] gi|223534793|gb|EEF36483.1| S-locus-specific glycoprotein precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255569825|ref|XP_002525876.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223534790|gb|EEF36480.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|302143473|emb|CBI22034.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485463|ref|XP_003633280.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|116309112|emb|CAH66217.1| OSIGBa0157N01.3 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|125547684|gb|EAY93506.1| hypothetical protein OsI_15301 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|116308953|emb|CAH66079.1| H0215E01.7 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|70663992|emb|CAE04686.2| OSJNBb0018A10.15 [Oryza sativa Japonica Group] gi|125589793|gb|EAZ30143.1| hypothetical protein OsJ_14197 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query274
TAIR|locus:2037568 443 AT1G78860 [Arabidopsis thalian 0.496 0.306 0.431 1.3e-31
TAIR|locus:2037508 441 AT1G78850 [Arabidopsis thalian 0.492 0.306 0.428 9e-31
UNIPROTKB|Q39688389 EP1 "Epidermis-specific secret 0.503 0.354 0.433 6.8e-30
TAIR|locus:4010713447423 AT1G16905 [Arabidopsis thalian 0.817 0.529 0.334 2.2e-27
TAIR|locus:2037548 455 AT1G78830 [Arabidopsis thalian 0.452 0.272 0.480 2.5e-27
TAIR|locus:2037563 455 AT1G78820 [Arabidopsis thalian 0.474 0.285 0.436 1.5e-25
TAIR|locus:2182603 872 AT5G35370 [Arabidopsis thalian 0.806 0.253 0.318 2.1e-22
TAIR|locus:2116525 821 SD2-5 "S-domain-2 5" [Arabidop 0.576 0.192 0.295 4.1e-20
TAIR|locus:2054326 764 AT2G41890 [Arabidopsis thalian 0.945 0.339 0.279 3.6e-16
TAIR|locus:2018506 847 RK2 "receptor kinase 2" [Arabi 0.485 0.157 0.391 4.5e-16
TAIR|locus:2037568 AT1G78860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 284 (105.0 bits), Expect = 1.3e-31, Sum P(2) = 1.3e-31
 Identities = 60/139 (43%), Positives = 83/139 (59%)

Query:    40 VWSANRNNPVRINATLELTSDGNLVLQDADGAIAWSTNTSGKSVVGLNLTDMGNLVLFDK 99
             VW ANR +PV+ NATL    DGNLVL +ADG + W TNT+ K VVG+ + + GN+V++D 
Sbjct:    90 VWEANRGSPVKENATLTFGEDGNLVLAEADGRVVWQTNTANKGVVGIKILENGNMVIYDS 149

Query:   100 NNAAVWQSFDHPTDSLVPGQKL-LEGKKLTASVSTTNWTDGGLFSLSVTNEGLFAFIESN 158
             N   VWQSFD PTD+L+ GQ L L G+    S  + +    G +SL +  + L  +  +N
Sbjct:   150 NGKFVWQSFDSPTDTLLVGQSLKLNGQNKLVSRLSPSVNANGPYSLVMEAKKLVLYYTTN 209

Query:   159 NTS--IRYYALVKATKTSK 175
              T   I YY     TK ++
Sbjct:   210 KTPKPIGYYEYEFFTKIAQ 228
GO:0005886 "plasma membrane" evidence=ISM
GO:0030246 "carbohydrate binding" evidence=IEA;ISS
GO:0005618 "cell wall" evidence=IDA
GO:0009505 "plant-type cell wall" evidence=IDA
TAIR|locus:2037508 AT1G78850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q39688 EP1 "Epidermis-specific secreted glycoprotein EP1" [Daucus carota (taxid:4039)] Back     alignment and assigned GO terms
TAIR|locus:4010713447 AT1G16905 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037548 AT1G78830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037563 AT1G78820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182603 AT5G35370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116525 SD2-5 "S-domain-2 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054326 AT2G41890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018506 RK2 "receptor kinase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query274
pfam01453109 pfam01453, B_lectin, D-mannose binding lectin 2e-31
cd00028116 cd00028, B_lectin, Bulb-type mannose-specific lect 4e-25
smart00108114 smart00108, B_lectin, Bulb-type mannose-specific l 4e-24
pfam01453109 pfam01453, B_lectin, D-mannose binding lectin 8e-08
>gnl|CDD|216511 pfam01453, B_lectin, D-mannose binding lectin Back     alignment and domain information 
 Score =  112 bits (281), Expect = 2e-31
 Identities = 50/85 (58%), Positives = 60/85 (70%), Gaps = 2/85 (2%)

Query: 39  VVWSANRNNPVRI-NATLELTSDGNLVLQDADGAIAWSTNTSGK-SVVGLNLTDMGNLVL 96
           VVW ANR NP+   + TL L SDGNLVL D +G + WS+NTSGK S     L D GNLVL
Sbjct: 4   VVWVANRLNPLTDSSYTLILQSDGNLVLYDGNGRVVWSSNTSGKGSGCVAVLQDDGNLVL 63

Query: 97  FDKNNAAVWQSFDHPTDSLVPGQKL 121
           +D +   +WQSFDHPTD+L+PGQK 
Sbjct: 64  YDNSGKVLWQSFDHPTDTLLPGQKD 88

These proteins include mannose-specific lectins from plants as well as bacteriocins from bacteria. Length = 109
>gnl|CDD|237995 cd00028, B_lectin, Bulb-type mannose-specific lectin Back     alignment and domain information
>gnl|CDD|214519 smart00108, B_lectin, Bulb-type mannose-specific lectin Back     alignment and domain information
>gnl|CDD|216511 pfam01453, B_lectin, D-mannose binding lectin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 274
PF01453114 B_lectin: D-mannose binding lectin; InterPro: IPR0 99.97
cd00028116 B_lectin Bulb-type mannose-specific lectin. The do 99.93
smart00108114 B_lectin Bulb-type mannose-specific lectin. 99.92
PF00954110 S_locus_glycop: S-locus glycoprotein family; Inter 99.89
smart00108114 B_lectin Bulb-type mannose-specific lectin. 98.93
cd00028116 B_lectin Bulb-type mannose-specific lectin. The do 98.91
PF01453114 B_lectin: D-mannose binding lectin; InterPro: IPR0 98.26
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 94.86
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 93.98
cd0005336 EGF Epidermal growth factor domain, found in epide 92.4
PF0168352 EB: EB module; InterPro: IPR006149 The EB domain h 92.01
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 89.65
smart0017939 EGF_CA Calcium-binding EGF-like domain. 89.5
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 88.82
PF0000832 EGF: EGF-like domain This is a sub-family of the P 88.4
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 85.79
PF1266224 cEGF: Complement Clr-like EGF-like 80.32
>PF01453 B_lectin: D-mannose binding lectin; InterPro: IPR001480 A bulb lectin super-family (Amaryllidaceae, Orchidaceae and Aliaceae) contains a ~115-residue-long domain whose overall three dimensional fold is very similar to that of [, ]: Dictyostelium discoideum comitin, an actin binding protein Curculigo latifolia curculin, a sweet tasting and taste-modifying protein This domain generally binds mannose, but in at least one protein, curculin, it is apparently devoid of mannose-binding activity Back     alignment and domain information 
Probab=99.97  E-value=1e-31  Score=209.45  Aligned_cols=102  Identities=54%  Similarity=0.820  Sum_probs=75.2

Q ss_pred             CCcEEEEcCCCCCCCC---CcEEEEecCCcEEEEcCCCCEEEee-cCCCCc--eeEEEEeeCCCeeEecCCCceEEeecC
Q 040039           36 FPQVVWSANRNNPVRI---NATLELTSDGNLVLQDADGAIAWST-NTSGKS--VVGLNLTDMGNLVLFDKNNAAVWQSFD  109 (274)
Q Consensus        36 ~~~vVWvANr~~Pv~~---~~~l~~~~~G~L~l~~~~~~~~Wss-~~~~~~--~~~~~l~d~GNlvl~~~~~~~lWqSFd  109 (274)
                      +++|||+|||++|+..   .++|.|+.||+|+|++..++++|++ ++.+..  ...|+|+|+|||||+|..+.+||||||
T Consensus         1 ~~tvvW~an~~~p~~~~s~~~~L~l~~dGnLvl~~~~~~~iWss~~t~~~~~~~~~~~L~~~GNlvl~d~~~~~lW~Sf~   80 (114)
T PF01453_consen    1 PRTVVWVANRNSPLTSSSGNYTLILQSDGNLVLYDSNGSVIWSSNNTSGRGNSGCYLVLQDDGNLVLYDSSGNVLWQSFD   80 (114)
T ss_dssp             ---------TTEEEEECETTEEEEEETTSEEEEEETTTEEEEE--S-TTSS-SSEEEEEETTSEEEEEETTSEEEEESTT
T ss_pred             CcccccccccccccccccccccceECCCCeEEEEcCCCCEEEEecccCCccccCeEEEEeCCCCEEEEeecceEEEeecC
Confidence            3689999999999942   3899999999999999988899999 655543  688999999999999988999999999


Q ss_pred             CCCCcccCCCcccCC------ceEeeecCCCCCC
Q 040039          110 HPTDSLVPGQKLLEG------KKLTASVSTTNWT  137 (274)
Q Consensus       110 ~PtDTlLpgq~l~~~------~~L~Sw~s~~dps  137 (274)
                      |||||+||+|+|+.+      ..|+||++.+|||
T Consensus        81 ~ptdt~L~~q~l~~~~~~~~~~~~~sw~s~~dps  114 (114)
T PF01453_consen   81 YPTDTLLPGQKLGDGNVTGKNDSLTSWSSNTDPS  114 (114)
T ss_dssp             SSS-EEEEEET--TSEEEEESTSSEEEESS----
T ss_pred             CCccEEEeccCcccCCCccccceEEeECCCCCCC
Confidence            999999999999863      3599999999986

Each bulb-type lectin domain consists of three sequential beta-sheet subdomains (I, II, III) that are inter-related by pseudo three-fold symmetry. The three subdomains are flat four-stranded, antiparrallel beta-sheets. Together they form a 12-stranded beta-barrel in which the barrel axis coincides with the pseudo 3-fold axis.; GO: 0005529 sugar binding; PDB: 3M7H_A 3M7J_B 3MEZ_D 1DLP_A 1BWU_D 1KJ1_A 1B2P_A 1XD6_A 2DPF_C 2D04_B ....
>cd00028 B_lectin Bulb-type mannose-specific lectin Back     alignment and domain information
>smart00108 B_lectin Bulb-type mannose-specific lectin Back     alignment and domain information
>PF00954 S_locus_glycop: S-locus glycoprotein family; InterPro: IPR000858 In Brassicaceae, self-incompatible plants have a self/non-self recognition system, which involves the inability of flowering plants to achieve self-fertilisation Back     alignment and domain information
>smart00108 B_lectin Bulb-type mannose-specific lectin Back     alignment and domain information
>cd00028 B_lectin Bulb-type mannose-specific lectin Back     alignment and domain information
>PF01453 B_lectin: D-mannose binding lectin; InterPro: IPR001480 A bulb lectin super-family (Amaryllidaceae, Orchidaceae and Aliaceae) contains a ~115-residue-long domain whose overall three dimensional fold is very similar to that of [, ]: Dictyostelium discoideum comitin, an actin binding protein Curculigo latifolia curculin, a sweet tasting and taste-modifying protein This domain generally binds mannose, but in at least one protein, curculin, it is apparently devoid of mannose-binding activity Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF01683 EB: EB module; InterPro: IPR006149 The EB domain has no known function Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query274
1kj1_A109 Lectin I, lecgna 1; BULB lectin, mannose, plant pr 3e-15
1kj1_A109 Lectin I, lecgna 1; BULB lectin, mannose, plant pr 4e-10
1b2p_A119 Protein (lectin); mannose-binding lectin, monocot, 2e-12
1b2p_A119 Protein (lectin); mannose-binding lectin, monocot, 1e-11
1xd5_A112 Gastrodianin-1, antifungal protein GAFP-1; monocot 6e-12
1xd5_A112 Gastrodianin-1, antifungal protein GAFP-1; monocot 4e-06
1xd5_A112 Gastrodianin-1, antifungal protein GAFP-1; monocot 1e-04
3a0c_A110 Mannose/sialic acid-binding lectin; beta-prism II, 2e-11
3a0c_A110 Mannose/sialic acid-binding lectin; beta-prism II, 3e-11
3m7h_A276 Putidacin L1; monocot mannose-binding lectin, bact 9e-11
3m7h_A276 Putidacin L1; monocot mannose-binding lectin, bact 2e-08
3dzw_A109 Agglutinin; lectin, mannobiose, mannose-alpha1, 3- 1e-10
3dzw_A109 Agglutinin; lectin, mannobiose, mannose-alpha1, 3- 1e-08
1dlp_A236 Lectin scafet precursor; two-domain lectin, beta p 2e-10
1dlp_A236 Lectin scafet precursor; two-domain lectin, beta p 6e-08
3r0e_B110 Lectin; carbohydrate binding, carbohydrate, sugar 4e-10
3r0e_B110 Lectin; carbohydrate binding, carbohydrate, sugar 9e-10
2dpf_A115 Curculin; sweet taste, taste modifying, plant prot 4e-10
2dpf_A115 Curculin; sweet taste, taste modifying, plant prot 6e-10
3mez_B113 Mannose-specific lectin 3 chain 2; heterotetramer, 2e-09
3mez_B113 Mannose-specific lectin 3 chain 2; heterotetramer, 7e-09
3r0e_A109 Lectin; carbohydrate binding, carbohydrate, sugar 3e-09
3r0e_A109 Lectin; carbohydrate binding, carbohydrate, sugar 2e-08
3mez_A111 Mannose-specific lectin 3 chain 1; heterotetramer, 4e-06
3mez_A111 Mannose-specific lectin 3 chain 1; heterotetramer, 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
>1kj1_A Lectin I, lecgna 1; BULB lectin, mannose, plant protein; HET: MAN; 2.20A {Allium sativum} SCOP: b.78.1.1 PDB: 1bwu_P* 1kj1_D* 1bwu_Q* 1bwu_A* 1bwu_D* Length = 109 Back     alignment and structure
 Score = 69.1 bits (169), Expect = 3e-15
 Identities = 19/74 (25%), Positives = 37/74 (50%), Gaps = 4/74 (5%)

Query: 38  QVVWSANRNNPVRINATLELTSDGNLVLQDADGAIAWSTNTSGKS-VVGLNLTDMGNLVL 96
             VW++N     +      L SDGN V+ DA+G   W++++   +    L L + GN+V+
Sbjct: 38  TSVWASNTGILGKKGCKAVLQSDGNFVVYDAEGRSLWASHSVRGNGNYVLVLQEDGNVVI 97

Query: 97  FDKNNAAVWQSFDH 110
           +    + +W +  +
Sbjct: 98  YG---SDIWSTGTY 108
>1kj1_A Lectin I, lecgna 1; BULB lectin, mannose, plant protein; HET: MAN; 2.20A {Allium sativum} SCOP: b.78.1.1 PDB: 1bwu_P* 1kj1_D* 1bwu_Q* 1bwu_A* 1bwu_D* Length = 109 Back     alignment and structure
>1b2p_A Protein (lectin); mannose-binding lectin, monocot, aglutinin, bluebell bulbs, carbohydrate interactions, sugar binding protein; 1.70A {Hyacinthoides hispanica} SCOP: b.78.1.1 Length = 119 Back     alignment and structure
>1b2p_A Protein (lectin); mannose-binding lectin, monocot, aglutinin, bluebell bulbs, carbohydrate interactions, sugar binding protein; 1.70A {Hyacinthoides hispanica} SCOP: b.78.1.1 Length = 119 Back     alignment and structure
>1xd5_A Gastrodianin-1, antifungal protein GAFP-1; monocot mannose binding lectin, monomer, homogeneous beta- sheet; 2.00A {Gastrodia elata} SCOP: b.78.1.1 PDB: 1xd6_A Length = 112 Back     alignment and structure
>1xd5_A Gastrodianin-1, antifungal protein GAFP-1; monocot mannose binding lectin, monomer, homogeneous beta- sheet; 2.00A {Gastrodia elata} SCOP: b.78.1.1 PDB: 1xd6_A Length = 112 Back     alignment and structure
>1xd5_A Gastrodianin-1, antifungal protein GAFP-1; monocot mannose binding lectin, monomer, homogeneous beta- sheet; 2.00A {Gastrodia elata} SCOP: b.78.1.1 PDB: 1xd6_A Length = 112 Back     alignment and structure
>3a0c_A Mannose/sialic acid-binding lectin; beta-prism II, sugar binding protein; 2.00A {Polygonatum cyrtonema} PDB: 3a0d_A* 3a0e_A* Length = 110 Back     alignment and structure
>3a0c_A Mannose/sialic acid-binding lectin; beta-prism II, sugar binding protein; 2.00A {Polygonatum cyrtonema} PDB: 3a0d_A* 3a0e_A* Length = 110 Back     alignment and structure
>3m7h_A Putidacin L1; monocot mannose-binding lectin, bacteriocin, LLPA, pseudomon bacterial toxin, siras, antimicrobial protein; 2.20A {Pseudomonas SP} PDB: 3m7j_A* Length = 276 Back     alignment and structure
>3m7h_A Putidacin L1; monocot mannose-binding lectin, bacteriocin, LLPA, pseudomon bacterial toxin, siras, antimicrobial protein; 2.20A {Pseudomonas SP} PDB: 3m7j_A* Length = 276 Back     alignment and structure
>3dzw_A Agglutinin; lectin, mannobiose, mannose-alpha1, 3-mannose, D sugar binding protein; HET: MAN; 1.70A {Narcissus pseudonarcissus} PDB: 1npl_A* 1jpc_A* 1msa_A* 1niv_A* Length = 109 Back     alignment and structure
>3dzw_A Agglutinin; lectin, mannobiose, mannose-alpha1, 3-mannose, D sugar binding protein; HET: MAN; 1.70A {Narcissus pseudonarcissus} PDB: 1npl_A* 1jpc_A* 1msa_A* 1niv_A* Length = 109 Back     alignment and structure
>1dlp_A Lectin scafet precursor; two-domain lectin, beta prism II fold, native, sugar binding protein; 3.30A {Hyacinthoides hispanica} SCOP: b.78.1.1 b.78.1.1 Length = 236 Back     alignment and structure
>1dlp_A Lectin scafet precursor; two-domain lectin, beta prism II fold, native, sugar binding protein; 3.30A {Hyacinthoides hispanica} SCOP: b.78.1.1 b.78.1.1 Length = 236 Back     alignment and structure
>3r0e_B Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} Length = 110 Back     alignment and structure
>3r0e_B Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} Length = 110 Back     alignment and structure
>2dpf_A Curculin; sweet taste, taste modifying, plant protein; 1.50A {Curculigo latifolia} PDB: 2d04_B* 2d04_A* Length = 115 Back     alignment and structure
>2dpf_A Curculin; sweet taste, taste modifying, plant protein; 1.50A {Curculigo latifolia} PDB: 2d04_B* 2d04_A* Length = 115 Back     alignment and structure
>3mez_B Mannose-specific lectin 3 chain 2; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} Length = 113 Back     alignment and structure
>3mez_B Mannose-specific lectin 3 chain 2; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} Length = 113 Back     alignment and structure
>3r0e_A Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} Length = 109 Back     alignment and structure
>3r0e_A Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} Length = 109 Back     alignment and structure
>3mez_A Mannose-specific lectin 3 chain 1; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} Length = 111 Back     alignment and structure
>3mez_A Mannose-specific lectin 3 chain 1; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} Length = 111 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query274
3m7h_A276 Putidacin L1; monocot mannose-binding lectin, bact 100.0
1dlp_A236 Lectin scafet precursor; two-domain lectin, beta p 100.0
4h3o_A105 Lectin; cadmium, plant protein; 2.17A {Allium sati 99.74
1xd5_A112 Gastrodianin-1, antifungal protein GAFP-1; monocot 99.73
3a0c_A110 Mannose/sialic acid-binding lectin; beta-prism II, 99.73
3a0c_A110 Mannose/sialic acid-binding lectin; beta-prism II, 99.7
1b2p_A119 Protein (lectin); mannose-binding lectin, monocot, 99.69
2dpf_A115 Curculin; sweet taste, taste modifying, plant prot 99.67
2dpf_A115 Curculin; sweet taste, taste modifying, plant prot 99.67
1xd5_A112 Gastrodianin-1, antifungal protein GAFP-1; monocot 99.66
1b2p_A119 Protein (lectin); mannose-binding lectin, monocot, 99.64
3dzw_A109 Agglutinin; lectin, mannobiose, mannose-alpha1, 3- 99.56
3mez_B113 Mannose-specific lectin 3 chain 2; heterotetramer, 99.5
3mez_A111 Mannose-specific lectin 3 chain 1; heterotetramer, 99.45
3mez_B113 Mannose-specific lectin 3 chain 2; heterotetramer, 99.44
3r0e_B110 Lectin; carbohydrate binding, carbohydrate, sugar 99.37
3dzw_A109 Agglutinin; lectin, mannobiose, mannose-alpha1, 3- 99.36
3r0e_B110 Lectin; carbohydrate binding, carbohydrate, sugar 99.35
3r0e_A109 Lectin; carbohydrate binding, carbohydrate, sugar 99.33
3r0e_A109 Lectin; carbohydrate binding, carbohydrate, sugar 99.31
4h3o_A105 Lectin; cadmium, plant protein; 2.17A {Allium sati 99.23
3m7h_A276 Putidacin L1; monocot mannose-binding lectin, bact 99.21
1dlp_A236 Lectin scafet precursor; two-domain lectin, beta p 99.2
3mez_A111 Mannose-specific lectin 3 chain 1; heterotetramer, 99.19
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 92.69
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 90.41
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 88.97
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 88.65
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 87.39
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 86.66
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 85.89
1a3p_A45 Epidermal growth factor; disulfide connectivities, 85.85
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 84.98
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 82.02
2k2s_B61 Micronemal protein 6; microneme protein complex, c 81.58
1as5_A26 Conotoxin Y-PIIIE; neurotoxin, acetylcholine; HET: 80.54
>3m7h_A Putidacin L1; monocot mannose-binding lectin, bacteriocin, LLPA, pseudomon bacterial toxin, siras, antimicrobial protein; 2.20A {Pseudomonas SP} PDB: 3m7j_A* Back     alignment and structure
Probab=100.00  E-value=9.3e-40  Score=290.58  Aligned_cols=196  Identities=22%  Similarity=0.307  Sum_probs=149.5

Q ss_pred             CeeccccCCCCCceEEEEEEeeeccccccccccCCCCcEEEEcCCCCCCCC-----CcEEEEecCCcEEE--EcCCCCEE
Q 040039            1 YACGFFCNGTCDSYLFAVFIVQAYNASLIDYQHIEFPQVVWSANRNNPVRI-----NATLELTSDGNLVL--QDADGAIA   73 (274)
Q Consensus         1 F~lGFf~~~~~~~~~l~iw~~~~~~~~~~~~~~~~~~~vVWvANr~~Pv~~-----~~~l~~~~~G~L~l--~~~~~~~~   73 (274)
                      ||||||+.+   +.||   |+             +.+ +||+|||++||.+     .++|+|+.||+|+|  .|+++.+|
T Consensus        36 F~lgf~~~~---~~~l---y~-------------~~~-vvW~Anr~~p~~~~~~~~~~~l~l~~~G~Lvl~~~~~~~~~v   95 (276)
T 3m7h_A           36 FKLLLQGDG---NLVI---QD-------------NGA-TVWVANEQQPFSSTIPLRNKKAPLAFYVQYGAFLDDYSRRRV   95 (276)
T ss_dssp             EEEEECTTS---CEEE---EE-------------TTE-EEEECSTTSTTEEEEECCCTTCCSEEEESSSEEEEEGGGTEE
T ss_pred             EEEEEECCC---CeEE---EC-------------CCC-eEEECCCCCCcCCcccccceEEEEeCCCcEEEEEeCCCCCEE
Confidence            899999432   5566   64             456 9999999999987     57899999999999  78888999


Q ss_pred             EeecCCC------CceeEEEEeeCCCeeEecCCCceEEeecCCCCCcccCCCc----ccCCceEeeecCCCCCCCCcceE
Q 040039           74 WSTNTSG------KSVVGLNLTDMGNLVLFDKNNAAVWQSFDHPTDSLVPGQK----LLEGKKLTASVSTTNWTDGGLFS  143 (274)
Q Consensus        74 Wss~~~~------~~~~~~~l~d~GNlvl~~~~~~~lWqSFd~PtDTlLpgq~----l~~~~~L~Sw~s~~dps~~G~ys  143 (274)
                      |++++..      ...+.|+|+|+|||||+|  +.+||||  ||||||||||+    |..+++|   ++.+||++ |.|+
T Consensus        96 Wst~~~~~~~~~~~~~~~a~L~d~GNlVl~~--~~~lWqS--~ptdtlLpg~~~~~~l~~g~~L---~S~~dps~-G~fs  167 (276)
T 3m7h_A           96 WLTDNSTFTSNDQWNRTHLVLQDDGNIVLVD--SLALWNG--TPAIPLVPGAIDSLLLAPGSEL---VQGVVYGA-GASK  167 (276)
T ss_dssp             EEECCCCCCCTTHHHHEEEEECTTSCEEEEE--EEEEEES--CTTSCCCCSCTTCEEECSSEEE---CTTCEEEE-TTEE
T ss_pred             EEeCCCcccccccCCceEEEEeCCCCEEecC--CceeeCc--ccccccccccccccccccCccc---ccCCCCCC-ceEE
Confidence            9999764      345789999999999998  7899999  99999999999    7788888   56789999 9999


Q ss_pred             EEecCCCceEEEecCCCeEEEecccCCCCcCCCcceeeee-cCceEEEeecCCCCCceEEEEecCCCCCCeEEEEEcCCC
Q 040039          144 LSVTNEGLFAFIESNNTSIRYYALVKATKTSKEPSHARYL-NGSLAFFINSSEPREPDGAVPVPPASSSPGQYMRLWPDG  222 (274)
Q Consensus       144 l~~d~~g~~~~~~~~~~~~Yw~sg~~~~~~~~~~~~~~~~-~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~rl~Ld~dG  222 (274)
                      ++||++|...++ .+...+||++++++...    .++.+. .|.+.++...    ...+..+.....  ..+|++|+.||
T Consensus       168 l~l~~dGnlvLy-~~~~~~yW~Sgt~~~~~----~~l~l~~dGnLvl~d~~----~~~vWsS~t~~~--~~~rl~Ld~dG  236 (276)
T 3m7h_A          168 LVFQGDGNLVAY-GPNGAATWNAGTQGKGA----VRAVFQGDGNLVVYGAG----NAVLWHSHTGGH--ASAVLRLQANG  236 (276)
T ss_dssp             EEECTTSCEEEE-CTTSSEEEECCCTTTTC----CEEEECTTSCEEEECTT----SCEEEECSCTTC--TTCEEEECTTS
T ss_pred             EeecCCceEEEE-eCCCeEEEECCCCCCcc----EEEEEcCCCeEEEEeCC----CcEEEEecCCCC--CCEEEEEcCCc
Confidence            999999864442 34468999999886421    233333 5667664321    122323332222  25799999999


Q ss_pred             CeEEEEEcCCCCeEE
Q 040039          223 HLRVYEWQASIGWTE  237 (274)
Q Consensus       223 ~lr~y~w~~~~~W~~  237 (274)
                      ++++|.|  ...|..
T Consensus       237 nLvly~~--~~~Wqs  249 (276)
T 3m7h_A          237 SIAILDE--KPVWAR  249 (276)
T ss_dssp             CEEEEEE--EEEEES
T ss_pred             cEEEEcC--CCeEEc
Confidence            9999998  234554
>1dlp_A Lectin scafet precursor; two-domain lectin, beta prism II fold, native, sugar binding protein; 3.30A {Hyacinthoides hispanica} SCOP: b.78.1.1 b.78.1.1 Back     alignment and structure
>4h3o_A Lectin; cadmium, plant protein; 2.17A {Allium sativum} PDB: 1kj1_A* 1bwu_P* 1kj1_D* 1bwu_Q* 1bwu_A* 1bwu_D* Back     alignment and structure
>1xd5_A Gastrodianin-1, antifungal protein GAFP-1; monocot mannose binding lectin, monomer, homogeneous beta- sheet; 2.00A {Gastrodia elata} SCOP: b.78.1.1 PDB: 1xd6_A Back     alignment and structure
>3a0c_A Mannose/sialic acid-binding lectin; beta-prism II, sugar binding protein; 2.00A {Polygonatum cyrtonema} PDB: 3a0d_A* 3a0e_A* Back     alignment and structure
>3a0c_A Mannose/sialic acid-binding lectin; beta-prism II, sugar binding protein; 2.00A {Polygonatum cyrtonema} PDB: 3a0d_A* 3a0e_A* Back     alignment and structure
>1b2p_A Protein (lectin); mannose-binding lectin, monocot, aglutinin, bluebell bulbs, carbohydrate interactions, sugar binding protein; 1.70A {Hyacinthoides hispanica} SCOP: b.78.1.1 Back     alignment and structure
>2dpf_A Curculin; sweet taste, taste modifying, plant protein; 1.50A {Curculigo latifolia} PDB: 2d04_B* 2d04_A* Back     alignment and structure
>2dpf_A Curculin; sweet taste, taste modifying, plant protein; 1.50A {Curculigo latifolia} PDB: 2d04_B* 2d04_A* Back     alignment and structure
>1xd5_A Gastrodianin-1, antifungal protein GAFP-1; monocot mannose binding lectin, monomer, homogeneous beta- sheet; 2.00A {Gastrodia elata} SCOP: b.78.1.1 PDB: 1xd6_A Back     alignment and structure
>1b2p_A Protein (lectin); mannose-binding lectin, monocot, aglutinin, bluebell bulbs, carbohydrate interactions, sugar binding protein; 1.70A {Hyacinthoides hispanica} SCOP: b.78.1.1 Back     alignment and structure
>3dzw_A Agglutinin; lectin, mannobiose, mannose-alpha1, 3-mannose, D sugar binding protein; HET: MAN; 1.70A {Narcissus pseudonarcissus} SCOP: b.78.1.1 PDB: 1npl_A* 1jpc_A* 1msa_A* 1niv_A* Back     alignment and structure
>3mez_B Mannose-specific lectin 3 chain 2; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} SCOP: b.78.1.0 Back     alignment and structure
>3mez_A Mannose-specific lectin 3 chain 1; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} SCOP: b.78.1.0 Back     alignment and structure
>3mez_B Mannose-specific lectin 3 chain 2; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} SCOP: b.78.1.0 Back     alignment and structure
>3r0e_B Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} Back     alignment and structure
>3dzw_A Agglutinin; lectin, mannobiose, mannose-alpha1, 3-mannose, D sugar binding protein; HET: MAN; 1.70A {Narcissus pseudonarcissus} SCOP: b.78.1.1 PDB: 1npl_A* 1jpc_A* 1msa_A* 1niv_A* Back     alignment and structure
>3r0e_B Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} Back     alignment and structure
>3r0e_A Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} Back     alignment and structure
>3r0e_A Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} Back     alignment and structure
>4h3o_A Lectin; cadmium, plant protein; 2.17A {Allium sativum} PDB: 1kj1_A* 1bwu_P* 1kj1_D* 1bwu_Q* 1bwu_A* 1bwu_D* Back     alignment and structure
>3m7h_A Putidacin L1; monocot mannose-binding lectin, bacteriocin, LLPA, pseudomon bacterial toxin, siras, antimicrobial protein; 2.20A {Pseudomonas SP} PDB: 3m7j_A* Back     alignment and structure
>1dlp_A Lectin scafet precursor; two-domain lectin, beta prism II fold, native, sugar binding protein; 3.30A {Hyacinthoides hispanica} SCOP: b.78.1.1 b.78.1.1 Back     alignment and structure
>3mez_A Mannose-specific lectin 3 chain 1; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} SCOP: b.78.1.0 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1as5_A Conotoxin Y-PIIIE; neurotoxin, acetylcholine; HET: HYP; NMR {Conus purpurascens} SCOP: j.30.1.4 PDB: 1jlo_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 274
d1kj1a_109 b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium 6e-18
d1kj1a_109 b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium 3e-08
d1dlpa2120 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet 8e-16
d1dlpa2120 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet 2e-07
d1dlpa1115 b.78.1.1 (A:1-115) Fetuin-binding protein Scafet p 5e-14
d1dlpa1115 b.78.1.1 (A:1-115) Fetuin-binding protein Scafet p 8e-06
d1xd5a_112 b.78.1.1 (A:) Gastrodianin (antifungal protein) {G 6e-14
d1jpca_108 b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galan 2e-11
d1jpca_108 b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galan 4e-07
d1b2pa_119 b.78.1.1 (A:) Lectin (agglutinin) {Bluebell (Scill 9e-11
d1b2pa_119 b.78.1.1 (A:) Lectin (agglutinin) {Bluebell (Scill 2e-10
>d1kj1a_ b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium sativum) [TaxId: 4682]} Length = 109 Back     information, alignment and structure

class: All beta proteins
fold: beta-Prism II
superfamily: alpha-D-mannose-specific plant lectins
family: alpha-D-mannose-specific plant lectins
domain: Lectin (agglutinin)
species: Garlic (Allium sativum) [TaxId: 4682]

 Score = 75.0 bits (184), Expect = 6e-18
 Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 4/73 (5%)

Query: 39  VVWSANRNNPVRINATLELTSDGNLVLQDADGAIAWSTNTS-GKSVVGLNLTDMGNLVLF 97
            VW++N     +      L SDGN V+ DA+G   W++++  G     L L + GN+V++
Sbjct: 39  SVWASNTGILGKKGCKAVLQSDGNFVVYDAEGRSLWASHSVRGNGNYVLVLQEDGNVVIY 98

Query: 98  DKNNAAVWQSFDH 110
               + +W +  +
Sbjct: 99  G---SDIWSTGTY 108
>d1kj1a_ b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium sativum) [TaxId: 4682]} Length = 109 Back     information, alignment and structure
>d1dlpa2 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Length = 120 Back     information, alignment and structure
>d1dlpa2 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Length = 120 Back     information, alignment and structure
>d1dlpa1 b.78.1.1 (A:1-115) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Length = 115 Back     information, alignment and structure
>d1dlpa1 b.78.1.1 (A:1-115) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Length = 115 Back     information, alignment and structure
>d1xd5a_ b.78.1.1 (A:) Gastrodianin (antifungal protein) {Gastrodia elata [TaxId: 91201]} Length = 112 Back     information, alignment and structure
>d1jpca_ b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galanthus nivalis) [TaxId: 4670]} Length = 108 Back     information, alignment and structure
>d1jpca_ b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galanthus nivalis) [TaxId: 4670]} Length = 108 Back     information, alignment and structure
>d1b2pa_ b.78.1.1 (A:) Lectin (agglutinin) {Bluebell (Scilla campanulata) [TaxId: 81759]} Length = 119 Back     information, alignment and structure
>d1b2pa_ b.78.1.1 (A:) Lectin (agglutinin) {Bluebell (Scilla campanulata) [TaxId: 81759]} Length = 119 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query274
d1dlpa2120 Fetuin-binding protein Scafet precursor {Bluebell 99.77
d1kj1a_109 Lectin (agglutinin) {Garlic (Allium sativum) [TaxI 99.72
d1dlpa1115 Fetuin-binding protein Scafet precursor {Bluebell 99.72
d1xd5a_112 Gastrodianin (antifungal protein) {Gastrodia elata 99.71
d1jpca_108 Lectin (agglutinin) {Snowdrop (Galanthus nivalis) 99.67
d1b2pa_119 Lectin (agglutinin) {Bluebell (Scilla campanulata) 99.42
d1b2pa_119 Lectin (agglutinin) {Bluebell (Scilla campanulata) 99.3
d1kj1a_109 Lectin (agglutinin) {Garlic (Allium sativum) [TaxI 99.24
d1jpca_108 Lectin (agglutinin) {Snowdrop (Galanthus nivalis) 99.24
d1dlpa1115 Fetuin-binding protein Scafet precursor {Bluebell 99.06
d1dlpa2120 Fetuin-binding protein Scafet precursor {Bluebell 99.03
d1xd5a_112 Gastrodianin (antifungal protein) {Gastrodia elata 99.03
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 95.2
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 95.08
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 94.51
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 94.27
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 93.64
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 92.64
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 92.56
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 91.52
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 91.14
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 90.59
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 90.0
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 89.52
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 88.45
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 88.34
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 87.12
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 85.99
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 85.82
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 85.64
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 85.52
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 83.05
d1i0ua241 Low density lipoprotein (LDL) receptor, different 83.04
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 82.9
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 80.45
>d1dlpa2 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Back     information, alignment and structure
class: All beta proteins
fold: beta-Prism II
superfamily: alpha-D-mannose-specific plant lectins
family: alpha-D-mannose-specific plant lectins
domain: Fetuin-binding protein Scafet precursor
species: Bluebell (Scilla campanulata) [TaxId: 81759]

Probab=99.77  E-value=2.4e-19  Score=138.00  Aligned_cols=101  Identities=25%  Similarity=0.345  Sum_probs=84.6

Q ss_pred             ccccccCCCCcEEEEcCCCCCCCCC-cEEEEecCCcEEEEcCCCCEEEeecCCCCc-eeEEEEeeCCCeeEecCCCceEE
Q 040039           28 LIDYQHIEFPQVVWSANRNNPVRIN-ATLELTSDGNLVLQDADGAIAWSTNTSGKS-VVGLNLTDMGNLVLFDKNNAAVW  105 (274)
Q Consensus        28 ~~~~~~~~~~~vVWvANr~~Pv~~~-~~l~~~~~G~L~l~~~~~~~~Wss~~~~~~-~~~~~l~d~GNlvl~~~~~~~lW  105 (274)
                      .|+|+++++++++|++|+++|+... .+|.|+.||||+|++. +.++|++++.+.+ ...++|+++|||||+|.++.++|
T Consensus        11 ~il~~~~~~~~~~~~l~~~q~l~~g~y~L~~q~DGNLvL~~~-~~~vW~s~t~~~~~~~~~~l~~~GnLvl~d~~~~~lW   89 (120)
T d1dlpa2          11 SILYSTQGNDNHPQTLHATQSLQLSPYRLSMETDCNLVLFDR-DDRVWSTNTAGKGTGCRAVLQPNGRMDVLTNQNIAVW   89 (120)
T ss_dssp             EECCCC--CCCCCCEECSSCCCBCSSCEEEEETTTEEEEEBT-TBCCSCCCCCSSCSSCEEEEETTTEEEEEETTTEEEE
T ss_pred             eEEEcCCCCCCcccEEcCCCeeEcCCEEEEEcCCCcEEEecC-CcEEEEEccccCCCcEEEEEeCCeeEEEEcCCCCEEE
Confidence            3667778999999999999999887 6999999999999985 6789999986543 46789999999999999999999


Q ss_pred             eecCCCCCcccCCCcccCCceEeeecCCCCCCCCcceEEEecCCCceEEE
Q 040039          106 QSFDHPTDSLVPGQKLLEGKKLTASVSTTNWTDGGLFSLSVTNEGLFAFI  155 (274)
Q Consensus       106 qSFd~PtDTlLpgq~l~~~~~L~Sw~s~~dps~~G~ysl~~d~~g~~~~~  155 (274)
                      ||+.                         +..+ |.|.|.||++|.+.++
T Consensus        90 ~S~t-------------------------~~~~-~~~~l~Lq~DGnlvlY  113 (120)
T d1dlpa2          90 TSGN-------------------------SRSA-GRYVFVLQPDRNLAIY  113 (120)
T ss_dssp             ECCC-------------------------CCSS-SCCEEEECSSSCEEEE
T ss_pred             EeCC-------------------------CCCC-CcEEEEECCCCcEEEe
Confidence            9973                         2335 8999999999987665
>d1kj1a_ b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d1dlpa1 b.78.1.1 (A:1-115) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Back     information, alignment and structure
>d1xd5a_ b.78.1.1 (A:) Gastrodianin (antifungal protein) {Gastrodia elata [TaxId: 91201]} Back     information, alignment and structure
>d1jpca_ b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galanthus nivalis) [TaxId: 4670]} Back     information, alignment and structure
>d1b2pa_ b.78.1.1 (A:) Lectin (agglutinin) {Bluebell (Scilla campanulata) [TaxId: 81759]} Back     information, alignment and structure
>d1b2pa_ b.78.1.1 (A:) Lectin (agglutinin) {Bluebell (Scilla campanulata) [TaxId: 81759]} Back     information, alignment and structure
>d1kj1a_ b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d1jpca_ b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galanthus nivalis) [TaxId: 4670]} Back     information, alignment and structure
>d1dlpa1 b.78.1.1 (A:1-115) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Back     information, alignment and structure
>d1dlpa2 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Back     information, alignment and structure
>d1xd5a_ b.78.1.1 (A:) Gastrodianin (antifungal protein) {Gastrodia elata [TaxId: 91201]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure