Citrus Sinensis ID: 040109


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------60
MSSKCFLLLQYVSLISVILFQLEPTVANSNNIISCLDEEKEALLAFKQGLIDESGILSSWGREDEKRNCCKWRGVRCSNKTGHVLGLDLRALSDSPVDALKGTINPSLLKLQHLTYLDLSWNNFSGSPIPEFIGSLSKLSELALSSAQLAGPIPHQLGNLSRLQVLDLRFNNLFSSGNLDWLSYLSSLRYLDLGDCKLSKFSNWFQVLSNLRSLTTLYLGHCDLPPISTPSLLHLNYSKSLEVIDLSNNYLTNSIYPWLLNVSSNLVDHIDLGSNRLHGSIPVAFGHMASLRYLGLLSNRLREVPKFLGNMSSLKMLVLSYNELRGELSEFIQNVSSGSTKNSSLEWLYLASNEITGTIPNLGGFPGMLMPLIYFDKITVTWKGGQYEYKSILGLIKIIDLSSNKLGGEVPEEIMDLVGLVALNLSNNNLTGQITPRIGQLKSLDFLDLSINHFFGGIPSSLSRLRLLSVMDLSYNNFSGKIPKGTQLQRFGASTYAGNPELCGLPLPNKCLDEESAPSPSRDDAYNTPDDDGDQFITLGFYMSMILGFFVGFWGVCGTLLVKSSWRCGYYNFLTGVKDWLYVEAVVNIAKLQRRVRN
cccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHcccccccccccccccccccccccEEEcEEEccccccEEEEEccccccccccccEEEccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccccccHHHccccccccEEEccccccccccccccccccccccccEEEcccccccccccHHHHHHccccccEEEcccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccccHHHHccccccccccccEEEcccccccccccccccccccccccEEEEEEEEEEEEcccccccccccccEEEcccccccccccHHHHccccccEEccccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEHHHHHHHHHHHHHHHccccHHHHHHHHHHccccEEEEEEHHHHHHHHHHHcc
cccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccccccccccccccccccEEEEEcccccEEEEEEcccccccccccccccccHHHcccccccEEEccccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccccHHHcccccccEEEcccccccccccccHHHccccccEEEEcccccccccccHHHHHcccccccEEEEcccccccccccHHHHccccccEEEEEEccccccccccHHHccccccEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccHHHcccccccEEEccccccccccccHHcccccccEEEEHccccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccEEccccHHccccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHcccccEEEccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MSSKCFLLLQYVSLISVILFqleptvansnniISCLDEEKEALLAFKQGLidesgilsswgredekrncckwrgvrcsnktghvlgldlralsdspvdalkgtinpsllklqhltyldlswnnfsgspipeFIGSLSKLSELALSSaqlagpiphqlgnlsrlQVLDLRFNNlfssgnldwlSYLSSlryldlgdcklskfSNWFQVLSNLRSLTTLylghcdlppistpsllhlnysksLEVIdlsnnyltnsiypwLLNVSSnlvdhidlgsnrlhgsipvafGHMASLRYLGLLSNRLREVPKFLGNMSSLKMLVLSYNELRGELSEFIQNvssgstknssLEWLYLASNeitgtipnlggfpgmlmplIYFDKITvtwkggqyeYKSILGLIKIIdlssnklggevpEEIMDLVGLVALnlsnnnltgqitprigqlksldflDLSINhffggipssLSRLRLLSVMDLsynnfsgkipkgtqlqrfgastyagnpelcglplpnkcldeesapspsrddayntpdddgdqfiTLGFYMSMILGFFVGFWGVCGTLLvksswrcgyynFLTGVKDWLYVEAVVNIAKLQRRVRN
MSSKCFLLLQYVSLISVILFQLEPTVANSNNIISCLDEEKEALLAFKQGLIDesgilsswgredekrncckwrgvrcsnktghvLGLDLRALSDSPVDALKGTINPSLLKLQHLTYLDLSWNNFSGSPIPEFIGSLSKLSELALSSAQLAGPIPHQLGNLSRLQVLDLRFNNLFSSGNLDWLSYLSSLRYLDLGDCKLSKFSNWFQVLSNLRSLTTLYLGHCDLPPISTPSLLHLNYSKSLEVIDLSNNYLTNSIYPWLLNVSSNLVDHIDLGSNRLHGSIPVAFGHMASLRYLGLLSNRLREVPKFLGNMSSLKMLVLSYNELRGELSEFIQNVSSGSTKNSSLEWLYLASNEITGTIPNLGGFPGMLMPLIYFDKITVTWKGGQYEYKSILGLIKIIDLSSNKLGGEVPEEIMDLVGLVALNLSNNNLTGQITPRIGQLKSLDFLDLSINHFFGGIPSSLSRLRLLSVMDLSYNNFSGKIPKGTQLQRFGASTYAGNPELCGLPLPNKCLDEESAPspsrddayntpdDDGDQFITLGFYMSMILGFFVGFWGVCGTLLVKSSWRCGYYNFLTGVKDWLYVEAVVNiaklqrrvrn
MSSKCFLLLQYVSLISVILFQLEPTVANSNNIISCLDEEKEALLAFKQGLIDESGILSSWGREDEKRNCCKWRGVRCSNKTGHVLGLDLRALSDSPVDALKGTINPSLLKLQHLTYLDLSWNNFSGSPIPEFIGslsklselalssaqlaGPIPHQLGNLSRLQVLDLRFNNLFSSGNldwlsylsslryldlGDCKLSKFSNWFQVLSNLRSLTTLYLGHCDLPPISTPSLLHLNYSKSLEVIDLSNNYLTNSIYPWLLNVSSNLVDHIDLGSNRLHGSIPVAFGHMASLRYLGLLSNRLREVPKFLGNMSSLKMLVLSYNELRGELSEFIQNVSSGSTKNSSLEWLYLASNEITGTIPNLGGFPGMLMPLIYFDKITVTWKGGQYEYKSILGLIKIIDLSSNKLGGEVPEEIMDLVGLVALNLSNNNLTGQITPRIGQLKSLDFLDLSINHFFGGIPsslsrlrllsVMDLSYNNFSGKIPKGTQLQRFGASTYAGNPELCGLPLPNKCLDEESAPSPSRDDAYNTPDDDGDQFITLGFYMSMILGFFVGFWGVCGTLLVKSSWRCGYYNFLTGVKDWLYVEAVVNIAKLQRRVRN
****CFLLLQYVSLISVILFQLEPTVANSNNIISCLDEEKEALLAFKQGLIDESGILSSWGREDEKRNCCKWRGVRCSNKTGHVLGLDLRALSDSPVDALKGTINPSLLKLQHLTYLDLSWNNFSGSPIPEFIGSLSKLSELALSSAQLAGPIPHQLGNLSRLQVLDLRFNNLFSSGNLDWLSYLSSLRYLDLGDCKLSKFSNWFQVLSNLRSLTTLYLGHCDLPPISTPSLLHLNYSKSLEVIDLSNNYLTNSIYPWLLNVSSNLVDHIDLGSNRL***************YLGLLSNRLREVPKFLGNMSSLKMLVLSYNELRGELSEFIQNV*******SSLEWLYLASNEITGTIPNLGGFPGMLMPLIYFDKITVTWKGGQYEYKSILGLIKIIDLSSNKLGGEVPEEIMDLVGLVALNLSNNNLTGQITPRIGQLKSLDFLDLSINHFFGGIPSSLSRLRLLSVMDLSYNNFSGKIPKGTQLQRFGASTYAGNPELCGLPL***************************QFITLGFYMSMILGFFVGFWGVCGTLLVKSSWRCGYYNFLTGVKDWLYVEAVVNIAKL******
***KCFLLLQYVSLISVILFQLEPTV***********EEKEALLAFKQGLIDESGILSSWGREDEKRNCCKWRGVRCSNKTGHVLGLDLRALSDSPVDALKGTINPSLLKLQHLTYLDLSWNNFSGSPIPEFIGSLSKLSELALSSAQLAGPIPHQLGNLSRLQVLDLRFNNLFSSGNLDWLSYLSSLRYLDLGDCKLSKFSNWFQVLSNLRSLTTLYLGHCDLPPISTPSLLHLNYSKSLEVIDLSNNYLTNSIYPWLLNVSSNLVDHIDLGSNRLHGSIPVAFGHMASLRYLGLLSNRLREVPKFLGNMSSLKMLVLSYNELRGELSEFIQNVSSGSTKNSSLEWLYLASNEITGTIPNLGGFPGMLMPLIYFDKITVTWKGGQYEYKSILGLIKIIDLSSNKLGGEVPEEIMDLVGLVALNLSNNNLTGQITPRIGQLKSLDFLDLSINHFFGGIPSSLSRLRLLSVMDLSYNNFSGKIPKGTQLQRFGASTYAGNPELCGLPLPN*************************QFITLGFYMSMILGFFVGFWGVCGTLLVKSSWRCGYYNFLTGVKDWLYVEAVVNIAKLQRRV**
MSSKCFLLLQYVSLISVILFQLEPTVANSNNIISCLDEEKEALLAFKQGLIDESGILSSWGREDEKRNCCKWRGVRCSNKTGHVLGLDLRALSDSPVDALKGTINPSLLKLQHLTYLDLSWNNFSGSPIPEFIGSLSKLSELALSSAQLAGPIPHQLGNLSRLQVLDLRFNNLFSSGNLDWLSYLSSLRYLDLGDCKLSKFSNWFQVLSNLRSLTTLYLGHCDLPPISTPSLLHLNYSKSLEVIDLSNNYLTNSIYPWLLNVSSNLVDHIDLGSNRLHGSIPVAFGHMASLRYLGLLSNRLREVPKFLGNMSSLKMLVLSYNELRGELSEFIQNVSSGSTKNSSLEWLYLASNEITGTIPNLGGFPGMLMPLIYFDKITVTWKGGQYEYKSILGLIKIIDLSSNKLGGEVPEEIMDLVGLVALNLSNNNLTGQITPRIGQLKSLDFLDLSINHFFGGIPSSLSRLRLLSVMDLSYNNFSGKIPKGTQLQRFGASTYAGNPELCGLPLPNKCLD***********AYNTPDDDGDQFITLGFYMSMILGFFVGFWGVCGTLLVKSSWRCGYYNFLTGVKDWLYVEAVVNIAKLQRRVRN
*SSKCFLLLQYVSLISVILFQLEPTVANSNNIISCLDEEKEALLAFKQGLIDESGILSSWGREDEKRNCCKWRGVRCSNKTGHVLGLDLRALSDSPVDALKGTINPSLLKLQHLTYLDLSWNNFSGSPIPEFIGSLSKLSELALSSAQLAGPIPHQLGNLSRLQVLDLRFNNLFSSGNLDWLSYLSSLRYLDLGDCKLSKFSNWFQVLSNLRSLTTLYLGHCDLPPISTPSLLHLNYSKSLEVIDLSNNYLTNSIYPWLLNVSSNLVDHIDLGSNRLHGSIPVAFGHMASLRYLGLLSNRLREVPKFLGNMSSLKMLVLSYNELRGELSEFIQNVSSGSTKNSSLEWLYLASNEITGTIPNLGGFPGMLMPLIYFDKITVTWKGGQYEYKSILGLIKIIDLSSNKLGGEVPEEIMDLVGLVALNLSNNNLTGQITPRIGQLKSLDFLDLSINHFFGGIPSSLSRLRLLSVMDLSYNNFSGKIPKGTQLQRFGASTYAGNPELCGLPLPNKC********************DGDQFITLGFYMSMILGFFVGFWGVCGTLLVKSSWRCGYYNFLTGVKDWLYVEAVVNIAKLQ*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSKCFLLLQYVSLISVILFQLEPTVANSNNIISCLDEEKEALLAFKQGLIDESGILSSWGREDEKRNCCKWRGVRCSNKTGHVLGLDLRALSDSPVDALKGTINPSLLKLQHLTYLDLSWNNFSGSPIPEFIGSLSKLSELALSSAQLAGPIPHQLGNLSRLQVLDLRFNNLFSSGNLDWLSYLSSLRYLDLGDCKLSKFSNWFQVLSNLRSLTTLYLGHCDLPPISTPSLLHLNYSKSLEVIDLSNNYLTNSIYPWLLNVSSNLVDHIDLGSNRLHGSIPVAFGHMASLRYLGLLSNRLREVPKFLGNMSSLKMLVLSYNELRGELSEFIQNVSSGSTKNSSLEWLYLASNEITGTIPNLGGFPGMLMPLIYFDKITVTWKGGQYEYKSILGLIKIIDLSSNKLGGEVPEEIMDLVGLVALNLSNNNLTGQITPRIGQLKSLDFLDLSINHFFGGIPSSLSRLRLLSVMDLSYNNFSGKIPKGTQLQRFGASTYAGNPELCGLPLPNKCLDEESAPSPSRDDAYNTPDDDGDQFITLGFYMSMILGFFVGFWGVCGTLLVKSSWRCGYYNFLTGVKDWLYVEAVVNIAKLQRRVRN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query598 2.2.26 [Sep-21-2011]
Q42371 976 LRR receptor-like serine/ no no 0.775 0.475 0.300 8e-42
Q9ZPS9 1143 Serine/threonine-protein no no 0.627 0.328 0.326 3e-39
C0LGQ5 1249 LRR receptor-like serine/ no no 0.675 0.323 0.326 7e-39
C0LGE4 882 Probable LRR receptor-lik no no 0.772 0.523 0.287 1e-37
Q9SHI2 1101 Leucine-rich repeat recep no no 0.749 0.406 0.320 4e-37
C0LGW6 966 LRR receptor-like serine/ no no 0.765 0.474 0.295 4e-35
O82318 960 Probably inactive leucine no no 0.700 0.436 0.334 9e-35
Q9FL51 872 Probably inactive leucine no no 0.839 0.575 0.279 1e-34
Q6XAT2 967 LRR receptor-like serine/ no no 0.742 0.459 0.292 3e-34
Q9LVP0 1102 Probable leucine-rich rep no no 0.695 0.377 0.330 4e-34
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function desciption
 Score =  172 bits (435), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 171/569 (30%), Positives = 255/569 (44%), Gaps = 105/569 (18%)

Query: 32  IISCLDEEKEALLAFKQGLIDESGILSSWGREDEKRNCCKWRGVRCSNKTGHVLGLDLRA 91
           + +   EE   LL  K+   D + +L  W       + C WRGV C N T +V+ L+L  
Sbjct: 19  VATVTSEEGATLLEIKKSFKDVNNVLYDW-TTSPSSDYCVWRGVSCENVTFNVVALNLSD 77

Query: 92  LS------------------DSPVDALKGTINPSLLKLQHLTYLDLSWNNFSGSPIPEFI 133
           L+                  D   + L G I   +     L  LDLS+N  SG  IP  I
Sbjct: 78  LNLDGEISPAIGDLKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLDLSFNELSGD-IPFSI 136

Query: 134 GSLSKLSELALSSAQLAGPIPHQLGNLSRLQVLDLRFNNLFSSGNLDWLSY--------- 184
             L +L +L L + QL GPIP  L  +  L++LDL  N L  SG +  L Y         
Sbjct: 137 SKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKL--SGEIPRLIYWNEVLQYLG 194

Query: 185 ----------------LSSLRYLDLGDCKLSKF-------SNWFQVL----SNLRSLTTL 217
                           L+ L Y D+ +  L+            FQVL    + L      
Sbjct: 195 LRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSYNQLTGEIPF 254

Query: 218 YLGHCDLPPIS---------TPSLLHLNYSKSLEVIDLSNNYLTNSIYPWLLNVSSNLVD 268
            +G   +  +S          PS++ L   ++L V+DLS N L+ SI P L N++    +
Sbjct: 255 DIGFLQVATLSLQGNQLSGKIPSVIGL--MQALAVLDLSGNLLSGSIPPILGNLT--FTE 310

Query: 269 HIDLGSNRLHGSIPVAFGHMASLRYLGLLSNRLR-EVPKFLGNMSSLKMLVLSYNELRGE 327
            + L SN+L GSIP   G+M+ L YL L  N L   +P  LG ++ L  L ++ N+L G 
Sbjct: 311 KLYLHSNKLTGSIPPELGNMSKLHYLELNDNHLTGHIPPELGKLTDLFDLNVANNDLEGP 370

Query: 328 LSEFIQNVSSGSTKNSSLEWLYLASNEITGTIPNLGGFPGMLMPLIYFDKITVTWKGGQY 387
           + + + + ++       L  L +  N+ +GTIP    F   L  + Y +  +   KG   
Sbjct: 371 IPDHLSSCTN-------LNSLNVHGNKFSGTIPR--AF-QKLESMTYLNLSSNNIKGPIP 420

Query: 388 EYKSILGLIKIIDLSSNKLGGEVPEEIMDLVGLVALNLSNNNLTGQITPRIGQLKSLDFL 447
              S +G +  +DLS+NK+ G +P  + DL  L+ +NLS N++TG +    G L+S+  +
Sbjct: 421 VELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVVPGDFGNLRSIMEI 480

Query: 448 DLSINHFFGGIPSSLSR------LRL-----------------LSVMDLSYNNFSGKIPK 484
           DLS N   G IP  L++      LRL                 L+V+++S+NN  G IPK
Sbjct: 481 DLSNNDISGPIPEELNQLQNIILLRLENNNLTGNVGSLANCLSLTVLNVSHNNLVGDIPK 540

Query: 485 GTQLQRFGASTYAGNPELCGLPLPNKCLD 513
                RF   ++ GNP LCG  L + C D
Sbjct: 541 NNNFSRFSPDSFIGNPGLCGSWLNSPCHD 569




Receptor kinase that, together with ERL1 and ERL2, regulates aerial architecture, including inflorescence (e.g. shoot apical meristem-originating organ shape, elongation of the internode and pedicels, and adaxial-abaxial polarity), and stomatal patterning (e.g. density and clustering), probably by tuning cell division and expansion. Modulates plant transpiration efficiency by controlling stomatal density, leaf photosynthetic capacity, epidermal cell expansion, mesophyll cell proliferation and cell-cell contact. Probable major trait regulating canalization (maintenance of phenotype despite varying environment) in many aspect of the plant physiology (e.g. plant morphology, light-dependent leaves number, branch number, flowering time, phytate and mineral concentrations) by transducing microenvironmental variation into phenotypic differentiation (ecological amplifier). May maintain development integrity in heat stress conditions. Regulates cell wall composition and structure. Confers resistance to the pathogenic bacteria Ralstonia solanacearum and to the necrotrophic fungi Plectosphaerella cucumerina and Pythium irregulare, and required for callose deposition upon infection. Resistance to P.cucumerina seems cell wall-mediated.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|C0LGE4|Y1124_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g12460 OS=Arabidopsis thaliana GN=At1g12460 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=2 SV=1 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL51|Y5694_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940 OS=Arabidopsis thaliana GN=At5g06940 PE=3 SV=1 Back     alignment and function description
>sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query598
302143724546 unnamed protein product [Vitis vinifera] 0.866 0.948 0.408 4e-94
147843620 722 hypothetical protein VITISV_031344 [Viti 0.919 0.761 0.368 9e-91
225464712 1021 PREDICTED: receptor-like protein 12-like 0.740 0.433 0.421 4e-84
359490572 975 PREDICTED: probable LRR receptor-like se 0.719 0.441 0.439 3e-79
225466147 1024 PREDICTED: LRR receptor-like serine/thre 0.846 0.494 0.361 2e-78
147855809 1107 hypothetical protein VITISV_029207 [Viti 0.739 0.399 0.440 1e-77
359490164 1198 PREDICTED: LRR receptor-like serine/thre 0.851 0.424 0.362 9e-77
302143881691 unnamed protein product [Vitis vinifera] 0.886 0.767 0.366 1e-76
147834202 1270 hypothetical protein VITISV_011552 [Viti 0.816 0.384 0.381 2e-74
357451397614 Receptor protein kinase-like protein [Me 0.809 0.788 0.391 8e-73
>gi|302143724|emb|CBI22585.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  352 bits (902), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 240/588 (40%), Positives = 321/588 (54%), Gaps = 70/588 (11%)

Query: 33  ISCLDEEKEALLAFKQGLIDESGILSSWGREDEKRNCCKWRGVRCSNKTGHVLGLDLRAL 92
           + C + E++ALL FKQGL+ +  +LSSWG E++KR+CCKWRGV C+N+TGHV+ LDL   
Sbjct: 7   VGCTERERQALLHFKQGLVHDYRVLSSWGNEEDKRDCCKWRGVECNNQTGHVISLDLHG- 65

Query: 93  SDSPVDALKGTINPSLLKLQHLTYLDLSWNNFSGSPIPEFIGSLSKLSELALSSAQLAGP 152
               V  L G I+PSL +LQHL +L+LS+N F G                          
Sbjct: 66  -TDFVRYLGGKIDPSLAELQHLKHLNLSFNRFEGV------------------------- 99

Query: 153 IPHQLGNLSRLQVLDLRFNNLFSSGNLDWLSYLSSLRYLDLGDCKLSKFSNWFQVLSNLR 212
           +P QLGNLS LQ LDL +N   + GNLDWLS L  L +LDL    LSK  +W Q ++ + 
Sbjct: 100 LPTQLGNLSNLQSLDLAYNLGMTCGNLDWLSRLPLLTHLDLSGVDLSKAIHWPQAINKMP 159

Query: 213 SLTTLYLGHCDLP-PISTPSLLHLNYSKSLEVIDLSNNYLTNSIYPWLLNVSSNLVDHID 271
           SLT LYL H  LP  I T  + H N S SL V+DLS N LT+SIYPWL N SS+L+  +D
Sbjct: 160 SLTELYLSHTQLPWIIPTIFISHTNSSTSLAVLDLSRNGLTSSIYPWLFNFSSSLLH-LD 218

Query: 272 LGSNRLHGSIPVAFGHMASLRYLGLLSNRLR-EVPKFLGNMSSLKMLVLSYNELRGELSE 330
           L  N L+GS P AF +M  L    L  N L  E+PKF     S   L LS N+L G + +
Sbjct: 219 LSYNHLNGSFPDAFTNMVFLESFVLSRNELEGEIPKFFS--VSFVHLDLSGNQLHGLIPD 276

Query: 331 FIQNVSSGSTKNSSLEWLYLASNEITGTIPNLGGFPGMLMPLIYFDKITVTWKGGQYEYK 390
              N+       + L +L L+SN++ G IP       +   +++ D       G   +  
Sbjct: 277 AFGNM-------TILAYLDLSSNQLKGEIPK-----SLSTSVVHLDLSWNLLHGSIPDAF 324

Query: 391 SILGLIKIIDLSSNKLGGEVPEEIMDLVGLVALNLSNNNLTGQITPRIGQLKSLDFLDLS 450
             +  +  +DLSSN L GE+P+ +      V L+LS N L G I    G + +L +LDLS
Sbjct: 325 GNMTTLAYLDLSSNHLEGEIPKSLS--TSFVHLDLSWNQLHGSILDAFGNMTTLAYLDLS 382

Query: 451 INHFFGGIPSSLSRLRLLSVMDLSYNNFSGKIP-------------------KGTQLQRF 491
            N   G IP SLS       + LSYN+  G IP                   +GTQLQ F
Sbjct: 383 SNQLEGEIPKSLS--TSFVHLGLSYNHLQGSIPDAFGNMTALAYLHLSWNQLEGTQLQSF 440

Query: 492 GASTYAGNPELCGLPLPNKCLDEESAPSPSRDDAYNTPDDDGDQFITLGFYMSMILGFFV 551
            ASTY GNP LCG PL  KCL +E+  +   D +    D+  D    + F  S++LGF +
Sbjct: 441 SASTYQGNPRLCGPPLLKKCLGDETKEASFIDPS--NRDNIQDDANKIWFSGSIVLGFII 498

Query: 552 GFWGVCGTLLVKSSWRCGYYNFLTGVKDWLYV-EAVVNIAKLQRRVRN 598
           GFWGVCGTLL+ SSWR  Y+ FL  +KD LY+    + + +L+R  ++
Sbjct: 499 GFWGVCGTLLLNSSWRHAYFQFLNKIKDRLYMTTTTITMNRLRRSFQS 546




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147843620|emb|CAN79880.1| hypothetical protein VITISV_031344 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225464712|ref|XP_002276171.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490572|ref|XP_003634116.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225466147|ref|XP_002270042.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147855809|emb|CAN79130.1| hypothetical protein VITISV_029207 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490164|ref|XP_002268910.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143881|emb|CBI22742.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147834202|emb|CAN64227.1| hypothetical protein VITISV_011552 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357451397|ref|XP_003595975.1| Receptor protein kinase-like protein [Medicago truncatula] gi|355485023|gb|AES66226.1| Receptor protein kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query598
TAIR|locus:2044767 905 AT2G34930 "AT2G34930" [Arabido 0.714 0.471 0.334 2.2e-45
TAIR|locus:2155909908 RLP56 "AT5G49290" [Arabidopsis 0.752 0.495 0.279 7.6e-38
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.727 0.465 0.290 3.3e-35
TAIR|locus:2169384 872 AT5G06940 [Arabidopsis thalian 0.615 0.422 0.282 1.4e-34
TAIR|locus:2020382756 RLP3 "AT1G17250" [Arabidopsis 0.735 0.582 0.268 1.9e-34
TAIR|locus:20250121083 RLP1 "AT1G07390" [Arabidopsis 0.545 0.301 0.311 9.5e-34
TAIR|locus:2020457 1166 BRL1 "BRI1 like" [Arabidopsis 0.464 0.238 0.341 3.2e-33
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.749 0.502 0.314 3.3e-33
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.712 0.380 0.313 4.1e-33
TAIR|locus:2034725 882 AT1G12460 [Arabidopsis thalian 0.819 0.555 0.265 4.4e-33
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 485 (175.8 bits), Expect = 2.2e-45, P = 2.2e-45
 Identities = 153/458 (33%), Positives = 219/458 (47%)

Query:    11 YVSLISVILFQLEPTVANSNNIISCLDEEKEALLAFKQGLIDESGILSSWGREDEKRNCC 70
             ++S + +IL  L+     S     C+  E++ALL F+  L D S  L SW   D    CC
Sbjct:    10 FISFLILILL-LKNLNYGSAASPKCISTERQALLTFRAALTDLSSRLFSWSGPD----CC 64

Query:    71 KWRGVRCSNKTGHVLGLDLRALS-DSPVD-----ALKGTINPSLLKLQHLTYLDLSWNNF 124
              W GV C  +T HV+ +DLR  S D   D     +L+G I+PSL +L+ L+YLDLS N+F
Sbjct:    65 NWPGVLCDARTSHVVKIDLRNPSQDVRSDEYKRGSLRGKIHPSLTQLKFLSYLDLSSNDF 124

Query:   125 SGSPIPEFIGXXXXXXXXXXXXXXXXGPIPHQLGNLSRLQVLDLRFNNLFSSGNXXXXXX 184
             +   IPEFIG                G IP  LGNLS+L+ LDL   +   SG       
Sbjct:   125 NELEIPEFIGQIVSLRYLNLSSSSFSGEIPTSLGNLSKLESLDLYAESFGDSGTLSLRAS 184

Query:   185 XXXXXXXXXGDCKLSKFS---------NWFQVLSNLRSLTTLYLGHCDLPPISTPSLLHL 235
                         K               W Q  S + +L  L+L + +L  +  P+L   
Sbjct:   185 NLRWLSSLSSSLKYLNMGYVNLSGAGETWLQDFSRISALKELHLFNSELKNLP-PTLSSS 243

Query:   236 NYSKSLEVIDLSNNYLTNSIYPWLLNVSSNLVDHIDLGSNRLHGSIPVAFGHMASLRYLG 295
                K LEV+DLS N L + I  WL  ++ NL   + L  + L GSIP  F ++  L  L 
Sbjct:   244 ADLKLLEVLDLSENSLNSPIPNWLFGLT-NL-RKLFLRWDFLQGSIPTGFKNLKLLETLD 301

Query:   296 LLSN-RLR-EVPKFLGNMSSLKMLVLSYNELRGELSEFIQNVSSGSTKNSSLEWLYLASN 353
             L +N  L+ E+P  LG++  LK L LS NEL G++  F+   S    K +SL +L L+SN
Sbjct:   302 LSNNLALQGEIPSVLGDLPQLKFLDLSANELNGQIHGFLDAFSRN--KGNSLVFLDLSSN 359

Query:   354 EITGTIPNLGGFPGMLMPLIYFDKITVTWKGGQYEYKSILGLIKIIDLSSNKLGGEVPEE 413
             ++ GT+P      G L  L   D  + ++ G        +  +K +DLS+N + G + E 
Sbjct:   360 KLAGTLPES---LGSLRNLQTLDLSSNSFTGSVPSSIGNMASLKKLDLSNNAMNGTIAES 416

Query:   414 IMDLVGLVALNLSNNNLTGQITP-RIGQLKSLDFLDLS 450
             +  L  LV LNL  N   G +       L+SL  + L+
Sbjct:   417 LGQLAELVDLNLMANTWGGVLQKSHFVNLRSLKSIRLT 454


GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0005618 "cell wall" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IEP;IMP
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169384 AT5G06940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020382 RLP3 "AT1G17250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020457 BRL1 "BRI1 like" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034725 AT1G12460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query598
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-47
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-36
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-35
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-34
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-09
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 7e-08
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 1e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
COG5238388 COG5238, RNA1, Ran GTPase-activating protein (RanG 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  178 bits (453), Expect = 2e-47
 Identities = 149/449 (33%), Positives = 229/449 (51%), Gaps = 37/449 (8%)

Query: 38  EEKEALLAFKQGLIDESGILSSWGREDEKRNCCKWRGVRCSNKTGHVLGLDLRALSDSPV 97
           EE E LL+FK  + D    LS+W   +   + C W+G+ C+N +  V+ +DL   + S  
Sbjct: 29  EELELLLSFKSSINDPLKYLSNW---NSSADVCLWQGITCNNSS-RVVSIDLSGKNIS-- 82

Query: 98  DALKGTINPSLLKLQHLTYLDLSWNNFSGSPIPEFIGSLS-KLSELALSSAQLAGPIPHQ 156
               G I+ ++ +L ++  ++LS N  SG PIP+ I + S  L  L LS+    G IP  
Sbjct: 83  ----GKISSAIFRLPYIQTINLSNNQLSG-PIPDDIFTTSSSLRYLNLSNNNFTGSIPR- 136

Query: 157 LGNLSRLQVLDLRFNNLFSSGNLDWLSYLSSLRYLDLGDCKLS-KFSNWFQVLSNLRSLT 215
            G++  L+ LDL  NN+ S    + +   SSL+ LDLG   L  K  N    L+NL SL 
Sbjct: 137 -GSIPNLETLDLS-NNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNS---LTNLTSLE 191

Query: 216 TLYLGHCDLPPISTPSLLHLNYSKSLEVIDLSNNYLTNSIYPWLLNVSSNLVDHIDLGSN 275
            L L    L     P    L   KSL+ I L  N L+  I   +  ++S  ++H+DL  N
Sbjct: 192 FLTLASNQLVG-QIPR--ELGQMKSLKWIYLGYNNLSGEIPYEIGGLTS--LNHLDLVYN 246

Query: 276 RLHGSIPVAFGHMASLRYLGLLSNRLR-EVPKFLGNMSSLKMLVLSYNELRGELSEFIQN 334
            L G IP + G++ +L+YL L  N+L   +P  + ++  L  L LS N L GE+ E +  
Sbjct: 247 NLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELV-- 304

Query: 335 VSSGSTKNSSLEWLYLASNEITGTIP-NLGGFPGMLMPLIYFDKITVTWKGGQYEYKSIL 393
                 +  +LE L+L SN  TG IP  L   P + +  ++ +K +    G   +     
Sbjct: 305 -----IQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFS----GEIPKNLGKH 355

Query: 394 GLIKIIDLSSNKLGGEVPEEIMDLVGLVALNLSNNNLTGQITPRIGQLKSLDFLDLSINH 453
             + ++DLS+N L GE+PE +     L  L L +N+L G+I   +G  +SL  + L  N 
Sbjct: 356 NNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNS 415

Query: 454 FFGGIPSSLSRLRLLSVMDLSYNNFSGKI 482
           F G +PS  ++L L+  +D+S NN  G+I
Sbjct: 416 FSGELPSEFTKLPLVYFLDISNNNLQGRI 444


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 598
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.95
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.94
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.89
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.89
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
KOG4237498 consensus Extracellular matrix protein slit, conta 99.85
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.84
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
KOG0617264 consensus Ras suppressor protein (contains leucine 99.71
PLN03150623 hypothetical protein; Provisional 99.64
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
PLN03150623 hypothetical protein; Provisional 99.55
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.32
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.25
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.25
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.22
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.18
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.17
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.13
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.11
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.09
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.08
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.01
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.94
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.86
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.82
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.82
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.81
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.77
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.77
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.69
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.56
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.54
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.53
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.48
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.38
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.31
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.3
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.25
PRK15386426 type III secretion protein GogB; Provisional 98.13
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.11
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.04
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.99
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.91
KOG4341483 consensus F-box protein containing LRR [General fu 97.89
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.89
PRK15386426 type III secretion protein GogB; Provisional 97.81
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.75
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.71
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.62
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.58
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.29
KOG4341483 consensus F-box protein containing LRR [General fu 97.11
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.87
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.4
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.24
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.98
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.62
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.45
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.29
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.25
KOG4308478 consensus LRR-containing protein [Function unknown 94.46
KOG4308478 consensus LRR-containing protein [Function unknown 94.26
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.44
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.97
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.2
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.43
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.25
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 86.94
smart0037026 LRR Leucine-rich repeats, outliers. 86.82
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.82
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 85.61
smart0037026 LRR Leucine-rich repeats, outliers. 85.61
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 85.33
PF0717295 GRP: Glycine rich protein family; InterPro: IPR010 82.37
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 80.15
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.3e-52  Score=487.05  Aligned_cols=455  Identities=31%  Similarity=0.495  Sum_probs=284.2

Q ss_pred             cHHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCCCccCeeeCCCCCcEEEEEcCCCCCCCCCCCceecCccccCCCCCC
Q 040109           36 LDEEKEALLAFKQGLIDESGILSSWGREDEKRNCCKWRGVRCSNKTGHVLGLDLRALSDSPVDALKGTINPSLLKLQHLT  115 (598)
Q Consensus        36 ~~~~~~~l~~~k~~~~~~~~~l~~W~~~~~~~~~c~w~gv~C~~~~~~v~~l~l~~~~~~~~~~l~g~l~~~l~~l~~L~  115 (598)
                      .++|+.||++||+++.+|...+.+|.   ...+||.|.||+|++ .++|+.+++++      +.++|.+++.+..+++|+
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~---~~~~~c~w~gv~c~~-~~~v~~L~L~~------~~i~~~~~~~~~~l~~L~   96 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWN---SSADVCLWQGITCNN-SSRVVSIDLSG------KNISGKISSAIFRLPYIQ   96 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCC---CCCCCCcCcceecCC-CCcEEEEEecC------CCccccCChHHhCCCCCC
Confidence            56899999999999988888889997   467899999999974 57899999998      555666666666666666


Q ss_pred             EEECcCCCCCCCCcchhcC-CCCCCCEEECCCCCC----------------------CCCCccccCCCCCCCEEEccCCC
Q 040109          116 YLDLSWNNFSGSPIPEFIG-SLSKLSELALSSAQL----------------------AGPIPHQLGNLSRLQVLDLRFNN  172 (598)
Q Consensus       116 ~L~Ls~n~l~~~~~p~~l~-~l~~L~~L~Ls~n~l----------------------~~~~p~~l~~l~~L~~L~Ls~n~  172 (598)
                      +|+|++|.+.+. +|..+. .+++|++|+|++|.+                      ++.+|..++++++|++|++++|.
T Consensus        97 ~L~Ls~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~  175 (968)
T PLN00113         97 TINLSNNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNV  175 (968)
T ss_pred             EEECCCCccCCc-CChHHhccCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCc
Confidence            666666655543 444322 344444444444433                      33344444445555555555554


Q ss_pred             CCCCCCcccccCCCCCCEEEcCCCcCCCCCchhHhhcCCCCCcEEeccCcCCCCCCCChhhhc-----------------
Q 040109          173 LFSSGNLDWLSYLSSLRYLDLGDCKLSKFSNWFQVLSNLRSLTTLYLGHCDLPPISTPSLLHL-----------------  235 (598)
Q Consensus       173 l~~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~-----------------  235 (598)
                      + ....+..+.++++|++|++++|.+.+.  +|..+..+++|++|++++|.+.+..+..+..+                 
T Consensus       176 l-~~~~p~~~~~l~~L~~L~L~~n~l~~~--~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~  252 (968)
T PLN00113        176 L-VGKIPNSLTNLTSLEFLTLASNQLVGQ--IPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPI  252 (968)
T ss_pred             c-cccCChhhhhCcCCCeeeccCCCCcCc--CChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceecccc
Confidence            3 122223344444444444444444332  22334444444444444444433332211111                 


Q ss_pred             ----cccCCccEEEccCCCCCCCcchhhhhcCccCccEEEccCCccccccchhhcCCCCccEEeeccCCCCC-cchhhcC
Q 040109          236 ----NYSKSLEVIDLSNNYLTNSIYPWLLNVSSNLVDHIDLGSNRLHGSIPVAFGHMASLRYLGLLSNRLRE-VPKFLGN  310 (598)
Q Consensus       236 ----~~~~~L~~L~Ls~n~l~~~~~~~l~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~-lp~~l~~  310 (598)
                          ..+++|+.|++++|.+.+.+|..+..+++  |++|++++|.+.+.+|..+.++++|++|++++|.+.+ +|..+..
T Consensus       253 p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~--L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~  330 (968)
T PLN00113        253 PSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQK--LISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTS  330 (968)
T ss_pred             ChhHhCCCCCCEEECcCCeeeccCchhHhhccC--cCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhc
Confidence                00144555555555555555555555555  5566666666655566656666666666666666654 5555555


Q ss_pred             CCCCcEEEcccCcCccchhhhhhhcCC------------CC-----------------------------CCCCCCCEEE
Q 040109          311 MSSLKMLVLSYNELRGELSEFIQNVSS------------GS-----------------------------TKNSSLEWLY  349 (598)
Q Consensus       311 l~~L~~L~Ls~n~l~~~~~~~l~~l~~------------g~-----------------------------~~~~~L~~L~  349 (598)
                      +++|+.|++++|.+.+.+|..+..+..            +.                             ..+++|+.|+
T Consensus       331 l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~  410 (968)
T PLN00113        331 LPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVR  410 (968)
T ss_pred             CCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEE
Confidence            666666666666665555554443331            00                             0123344444


Q ss_pred             ccCccccccCCC-CCCC------------------------CcCccccccccceE--------------EE-----EcCC
Q 040109          350 LASNEITGTIPN-LGGF------------------------PGMLMPLIYFDKIT--------------VT-----WKGG  385 (598)
Q Consensus       350 Ls~N~l~~~~p~-l~~l------------------------~~l~~~~~~~~~~~--------------~~-----~~~~  385 (598)
                      +++|++++.+|. +.++                        ++|.......+.+.              ..     ..+.
T Consensus       411 L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~  490 (968)
T PLN00113        411 LQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGA  490 (968)
T ss_pred             CcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccccccceEEECcCCccCCc
Confidence            444444433332 1111                        12211111111110              00     1233


Q ss_pred             cccccccccccceEeccCCcCCCcCchhhhcccCCcEEECcCCcCcccCCcccCCCCCCCeeeCCCCccCCCCcccccCC
Q 040109          386 QYEYKSILGLIKIIDLSSNKLGGEVPEEIMDLVGLVALNLSNNNLTGQITPRIGQLKSLDFLDLSINHFFGGIPSSLSRL  465 (598)
Q Consensus       386 ~~~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l  465 (598)
                      .+..+..+++|+.|+|++|++.+.+|..+.++++|++|+|++|.+++.+|..+..+++|+.|||++|++++.+|..+.++
T Consensus       491 ~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l  570 (968)
T PLN00113        491 VPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNV  570 (968)
T ss_pred             cChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcC
Confidence            44456678889999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCEEeCCCCcceecCCCCCccCccCCCccCCCCCCCCCC
Q 040109          466 RLLSVMDLSYNNFSGKIPKGTQLQRFGASTYAGNPELCGLP  506 (598)
Q Consensus       466 ~~L~~L~ls~N~l~~~~p~~~~~~~l~~~~~~gnp~lC~~~  506 (598)
                      ++|+.|++++|++.|.+|...++..+...++.|||.+|+.+
T Consensus       571 ~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        571 ESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             cccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            99999999999999999999999999999999999999854



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF07172 GRP: Glycine rich protein family; InterPro: IPR010800 This family consists of glycine rich proteins Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query598
3rgx_A768 Structural Insight Into Brassinosteroid Perception 4e-24
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-24
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-17
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 6e-04
2z7x_B520 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 7e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 109 bits (273), Expect = 4e-24, Method: Compositional matrix adjust. Identities = 133/457 (29%), Positives = 187/457 (40%), Gaps = 57/457 (12%) Query: 87 LDLRALS--DSPVDALKGTINPSLLKLQ-HLTYLDLSWNNFSGSPIPEFI-GXXXXXXXX 142 L +R L D + G + SL L L LDLS NNFSG +P Sbjct: 340 LKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQEL 399 Query: 143 XXXXXXXXGPIPHQLGNLSRLQVLDLRFNNLFSSGNXXXXXXXXXXXXXXXGDCKLSKFS 202 G IP L N S L L L FN L SG KL Sbjct: 400 YLQNNGFTGKIPPTLSNCSELVSLHLSFNYL--SGTIPSSLGSLS---------KLRDLK 448 Query: 203 NWFQVLSNLRSLTTLYLGHCDLPPISTPSLLHLNYSKSLEVIDLSNNYLTNSIYPWLLNV 262 W +L ++P L Y K+LE + L N LT I L N Sbjct: 449 LWLNMLEG------------EIPQ-------ELMYVKTLETLILDFNDLTGEIPSGLSNC 489 Query: 263 SSNLVDHIDLGSNRLHGSIPVAFGHMASLRYLGLLSNRLR-EVPKFLGNMSSLKMLVLSY 321 ++ ++ I L +NRL G IP G + +L L L +N +P LG+ SL L L+ Sbjct: 490 TN--LNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNT 547 Query: 322 NELRGEL--SEFIQNVSSGSTKNSSLEWLYLASNEITGTIPNLGG---FPGM----LMPL 372 N G + + F Q+ + + ++Y+ ++ + G F G+ L L Sbjct: 548 NLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRL 607 Query: 373 IYFDKITVT---WKGGQYEYKSILGLIKIIDLSSNKLGGEVPEEIMDLVGLVALNLSNNN 429 + +T + G G + +D+S N L G +P+EI + L LNL +N+ Sbjct: 608 STRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHND 667 Query: 430 LTGQITPRIGQLKSLDFLDLSINHFFGGIPXXXXXXXXXXVMDLSYNNFSGKIPKGTQLQ 489 ++G I +G L+ L+ LDLS N G IP +DLS NN SG IP+ Q + Sbjct: 668 ISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFE 727 Query: 490 RFGASTYAGNPELCGLPLPNKCLDEESAPSPSRDDAY 526 F + + NP LCG PLP +C PS D Y Sbjct: 728 TFPPAKFLNNPGLCGYPLP-RC-------DPSNADGY 756
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|2Z7X|B Chain B, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 520 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query598
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-95
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-89
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-79
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-56
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-56
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-22
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-15
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-56
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-52
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-49
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-47
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-47
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-46
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-25
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-51
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-49
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-39
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-47
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-47
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-44
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-23
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-16
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-46
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-44
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-43
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-41
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-39
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-33
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-46
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-42
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-41
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-40
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-39
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-38
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-38
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-38
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-42
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-42
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-36
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-34
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-39
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-38
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-37
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-26
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-30
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-28
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-23
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-32
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-31
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-29
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-24
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-29
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-28
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-31
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-31
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-30
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-31
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-30
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-30
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-29
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-28
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-26
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-13
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-24
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-14
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-13
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-10
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-23
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-18
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-20
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-19
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-16
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 8e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-15
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-14
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-09
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-09
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 8e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  307 bits (789), Expect = 2e-95
 Identities = 125/460 (27%), Positives = 197/460 (42%), Gaps = 66/460 (14%)

Query: 34  SCLDEEKEALLAFKQGLIDESGILSSWGREDEKRNCCKWRGVRCSNKTGHVLGLDLRALS 93
             L  E   L++FK  L D   +L  W       N C + GV C +    V  +DL   S
Sbjct: 8   QSLYREIHQLISFKDVLPD-KNLLPDWSSNK---NPCTFDGVTCRD--DKVTSIDL---S 58

Query: 94  DSPVDALKGTINPSLLKLQHLTYLDLSWNNFSGSPIPEFIGSLSKLSELALSSAQLAGPI 153
             P++     ++ SLL L  L  L LS ++ +GS +  F    + L+ L LS   L+GP+
Sbjct: 59  SKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGS-VSGF-KCSASLTSLDLSRNSLSGPV 116

Query: 154 P--HQLGNLSRLQVLDLRFNNLFSSGNLDWLSYLSSLRYLDLGDCKLS-KFSNWFQVLSN 210
                LG+ S L+ L++  N L   G +     L+SL  LDL    +S      + +   
Sbjct: 117 TTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDG 176

Query: 211 LRSLTTLYLGHCDL-PPISTPSLLHLNYSKSLEVIDLSNNYLTNSIYPWLLNVSSNLVDH 269
              L  L +    +   +            +LE +D+S+N  +  I P+L +  S L  H
Sbjct: 177 CGELKHLAISGNKISGDVDVSRC------VNLEFLDVSSNNFSTGI-PFLGD-CSALQ-H 227

Query: 270 IDLGSNRLHGSIPVAFGHMASLRYLGLLSNRLR-EVPKFLGNMSSLKMLVLSYNELRGEL 328
           +D+  N+L G    A      L+ L + SN+    +P     + SL+ L L+ N+  GE+
Sbjct: 228 LDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEI 285

Query: 329 SEFIQNVSSGSTKNSSLEWLYLASNEITGTIPN-LGGFPGMLMPLIYFDKITVTWKGGQY 387
            +F+           +L  L L+ N   G +P   G                        
Sbjct: 286 PDFLSG------ACDTLTGLDLSGNHFYGAVPPFFGS----------------------- 316

Query: 388 EYKSILGLIKIIDLSSNKLGGEVPEE-IMDLVGLVALNLSNNNLTGQITPRIGQLK-SLD 445
                  L++ + LSSN   GE+P + ++ + GL  L+LS N  +G++   +  L  SL 
Sbjct: 317 -----CSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLL 371

Query: 446 FLDLSINHFFGGIPSSLSRLRL--LSVMDLSYNNFSGKIP 483
            LDLS N+F G I  +L +     L  + L  N F+GKIP
Sbjct: 372 TLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIP 411


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query598
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.79
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.74
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.69
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.68
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.68
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.66
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.51
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.47
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.47
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.44
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.44
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.44
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.41
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.41
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.39
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.34
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.33
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.32
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.23
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.21
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.21
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.03
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.98
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.94
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.84
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.66
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.59
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.58
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.56
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.38
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.31
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.09
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.95
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.43
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.3
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.29
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.03
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2.6e-58  Score=520.48  Aligned_cols=463  Identities=32%  Similarity=0.488  Sum_probs=291.8

Q ss_pred             CCcHHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCCCccCeeeCCCCCcEEEEEcCCCCCCCCCCCcee---c------
Q 040109           34 SCLDEEKEALLAFKQGLIDESGILSSWGREDEKRNCCKWRGVRCSNKTGHVLGLDLRALSDSPVDALKGT---I------  104 (598)
Q Consensus        34 ~~~~~~~~~l~~~k~~~~~~~~~l~~W~~~~~~~~~c~w~gv~C~~~~~~v~~l~l~~~~~~~~~~l~g~---l------  104 (598)
                      .+.++|++||++||+++.||. .+++|.   .+.+||.|.||+|+  .++|++++|++      ..+.|.   +      
T Consensus         8 ~~~~~~~~all~~k~~~~~~~-~l~~W~---~~~~~C~w~gv~C~--~~~v~~L~L~~------~~l~g~~~~l~~~l~~   75 (768)
T 3rgz_A            8 QSLYREIHQLISFKDVLPDKN-LLPDWS---SNKNPCTFDGVTCR--DDKVTSIDLSS------KPLNVGFSAVSSSLLS   75 (768)
T ss_dssp             CCHHHHHHHHHHHHTTCSCTT-SSTTCC---TTSCGGGSTTEEEE--TTEEEEEECTT------SCCCEEHHHHHHHTTT
T ss_pred             cCCHHHHHHHHHHHhhCCCcc-cccCCC---CCCCCcCCcceEEC--CCcEEEEECCC------CCcCCccCccChhHhc
Confidence            347899999999999999888 899997   46789999999997  68999999987      344443   2      


Q ss_pred             -----------------CccccCCCCCCEEECcCCCCCCCCcch--hcCCCCCCCEEECCCCCCCCCCcccc-CCC----
Q 040109          105 -----------------NPSLLKLQHLTYLDLSWNNFSGSPIPE--FIGSLSKLSELALSSAQLAGPIPHQL-GNL----  160 (598)
Q Consensus       105 -----------------~~~l~~l~~L~~L~Ls~n~l~~~~~p~--~l~~l~~L~~L~Ls~n~l~~~~p~~l-~~l----  160 (598)
                                       |+.++++++|++|+|++|.+++. +|.  .++.+++|++|+|++|.+.+.+|..+ .++    
T Consensus        76 L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~-~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~  154 (768)
T 3rgz_A           76 LTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGP-VTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLE  154 (768)
T ss_dssp             CTTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEE-GGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCS
T ss_pred             cCcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCc-CCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCC
Confidence                             24566666667777776666653 555  56566666666666555554444332 222    


Q ss_pred             ---------------------------------------------CCCCEEEccCCCCCCCCCcccccCCCCCCEEEcCC
Q 040109          161 ---------------------------------------------SRLQVLDLRFNNLFSSGNLDWLSYLSSLRYLDLGD  195 (598)
Q Consensus       161 ---------------------------------------------~~L~~L~Ls~n~l~~~~~~~~l~~l~~L~~L~L~~  195 (598)
                                                                   ++|++|++++|.+..  ..+.+.++++|++|++++
T Consensus       155 ~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~--~~~~l~~l~~L~~L~Ls~  232 (768)
T 3rgz_A          155 VLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFST--GIPFLGDCSALQHLDISG  232 (768)
T ss_dssp             EEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBCTTCTTCCEEECCSSCCCS--CCCBCTTCCSCCEEECCS
T ss_pred             EEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCCcccCCcCCEEECcCCcCCC--CCcccccCCCCCEEECcC
Confidence                                                         333333333333211  112255555566666655


Q ss_pred             CcCCCCCchhHhhcCCCCCcEEeccCcCCCC-----------------------------------------------CC
Q 040109          196 CKLSKFSNWFQVLSNLRSLTTLYLGHCDLPP-----------------------------------------------IS  228 (598)
Q Consensus       196 n~l~~~~~~~~~l~~l~~L~~L~l~~n~l~~-----------------------------------------------~~  228 (598)
                      |.+++.  ++..+..+++|++|++++|.+.+                                               ..
T Consensus       233 n~l~~~--~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~  310 (768)
T 3rgz_A          233 NKLSGD--FSRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAV  310 (768)
T ss_dssp             SCCCSC--HHHHTTTCSSCCEEECCSSCCEESCCCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECC
T ss_pred             CcCCCc--ccHHHhcCCCCCEEECCCCcccCccCccccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCcc
Confidence            555532  23334444433333333333221                                               11


Q ss_pred             CChhhh----------------------ccccC-----------------------------------------------
Q 040109          229 TPSLLH----------------------LNYSK-----------------------------------------------  239 (598)
Q Consensus       229 ~~~~~~----------------------~~~~~-----------------------------------------------  239 (598)
                      +..+..                      +..++                                               
T Consensus       311 p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~  390 (768)
T 3rgz_A          311 PPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQ  390 (768)
T ss_dssp             CGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTC
T ss_pred             chHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhh
Confidence            100000                      00001                                               


Q ss_pred             ----CccEEEccCCCCCCCcchhhhhcCccCccEEEccCCccccccchhhcCCCCccEEeeccCCCCC-cchhhcCCCCC
Q 040109          240 ----SLEVIDLSNNYLTNSIYPWLLNVSSNLVDHIDLGSNRLHGSIPVAFGHMASLRYLGLLSNRLRE-VPKFLGNMSSL  314 (598)
Q Consensus       240 ----~L~~L~Ls~n~l~~~~~~~l~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~-lp~~l~~l~~L  314 (598)
                          +|++|++++|.+++.+|..+..++.  |++|++++|.+++.+|..+..+++|++|++++|.+.+ +|..+..+++|
T Consensus       391 ~~~~~L~~L~L~~n~l~~~~p~~l~~l~~--L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L  468 (768)
T 3rgz_A          391 NPKNTLQELYLQNNGFTGKIPPTLSNCSE--LVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL  468 (768)
T ss_dssp             STTCCCCEEECCSSEEEEECCGGGGGCTT--CCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTC
T ss_pred             cccCCccEEECCCCccccccCHHHhcCCC--CCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCc
Confidence                2222222222222233444444445  6666666666666666666655555555555555554 45555555555


Q ss_pred             cEEEcccCcCccchhhhhhhcCC------------CC-----CCCCCCCEEEccCccccccCCC-CCCCCcCcccccccc
Q 040109          315 KMLVLSYNELRGELSEFIQNVSS------------GS-----TKNSSLEWLYLASNEITGTIPN-LGGFPGMLMPLIYFD  376 (598)
Q Consensus       315 ~~L~Ls~n~l~~~~~~~l~~l~~------------g~-----~~~~~L~~L~Ls~N~l~~~~p~-l~~l~~l~~~~~~~~  376 (598)
                      ++|++++|++.+.+|..+..++.            +.     ..+++|+.|++++|+++|.+|. +.+++++.......+
T Consensus       469 ~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N  548 (768)
T 3rgz_A          469 ETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTN  548 (768)
T ss_dssp             CEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSS
T ss_pred             eEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCC
Confidence            55555555555444444444431            00     0112555555555555555543 333333332211111


Q ss_pred             ceE------------------------------------------------------------------EEEcCCccccc
Q 040109          377 KIT------------------------------------------------------------------VTWKGGQYEYK  390 (598)
Q Consensus       377 ~~~------------------------------------------------------------------~~~~~~~~~~~  390 (598)
                      .+.                                                                  ....|..+..+
T Consensus       549 ~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~  628 (768)
T 3rgz_A          549 LFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTF  628 (768)
T ss_dssp             EEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSC
T ss_pred             ccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhh
Confidence            110                                                                  11123334455


Q ss_pred             ccccccceEeccCCcCCCcCchhhhcccCCcEEECcCCcCcccCCcccCCCCCCCeeeCCCCccCCCCcccccCCCCCCE
Q 040109          391 SILGLIKIIDLSSNKLGGEVPEEIMDLVGLVALNLSNNNLTGQITPRIGQLKSLDFLDLSINHFFGGIPSSLSRLRLLSV  470 (598)
Q Consensus       391 ~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~  470 (598)
                      +.+++|+.|||++|+++|.+|..++++++|+.|+|++|+++|.+|..++++++|++|||++|+++|.+|+.+.++++|++
T Consensus       629 ~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~  708 (768)
T 3rgz_A          629 DNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTE  708 (768)
T ss_dssp             SSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSE
T ss_pred             hccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCE
Confidence            66789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeCCCCcceecCCCCCccCccCCCccCCCCCCCCCCCCCCCCCCCC
Q 040109          471 MDLSYNNFSGKIPKGTQLQRFGASTYAGNPELCGLPLPNKCLDEES  516 (598)
Q Consensus       471 L~ls~N~l~~~~p~~~~~~~l~~~~~~gnp~lC~~~~~~~c~~~~~  516 (598)
                      ||+++|+++|.+|...++.++...++.|||.+||.|+. .|.....
T Consensus       709 L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~~~  753 (768)
T 3rgz_A          709 IDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDPSNA  753 (768)
T ss_dssp             EECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCSCC-
T ss_pred             EECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-CCCCCcc
Confidence            99999999999999999999999999999999999987 8965444



>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 598
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-20
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-17
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-19
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.002
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.003
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-10
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 3e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 9e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 88.7 bits (218), Expect = 7e-20
 Identities = 65/307 (21%), Positives = 107/307 (34%), Gaps = 27/307 (8%)

Query: 35  CLDEEKEALLAFKQGLIDESGILSSWGREDEKRNCC--KWRGVRCSNKTG--HVLGLDLR 90
           C  ++K+ALL  K+ L +    LSSW       +CC   W GV C   T    V  LDL 
Sbjct: 3   CNPQDKQALLQIKKDLGN-PTTLSSW---LPTTDCCNRTWLGVLCDTDTQTYRVNNLDLS 58

Query: 91  ALSDSPVDALKGTINPSLLKLQHLTYLDLSWNNFSGSPIPEFIGSLSKLSELALSSAQLA 150
            L+          I  SL  L +L +L +   N    PIP  I  L++L  L ++   ++
Sbjct: 59  GLNLP----KPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVS 114

Query: 151 GPIPHQLGNLSRLQVLDLRFNNLFSSGNLDWLSYLSSLRYLDLGDCKLSKFSNWFQVLSN 210
           G IP  L  +  L  LD  +N L  +      S  + +     G+       + +   S 
Sbjct: 115 GAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSK 174

Query: 211 L---------------RSLTTLYLGHCDLPPISTPSLLHLNYSKSLEVIDLSNNYLTNSI 255
           L                               +           S +     +    +  
Sbjct: 175 LFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLA 234

Query: 256 YPWLLNVSSNLVDHIDLGSNRLHGSIPVAFGHMASLRYLGLLSNRLREVPKFLGNMSSLK 315
           +       S  ++ +DL +NR++G++P     +  L  L +  N L       GN+    
Sbjct: 235 FDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFD 294

Query: 316 MLVLSYN 322
           +   + N
Sbjct: 295 VSAYANN 301


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query598
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.84
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.8
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.66
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.6
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.57
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.53
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.52
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.51
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.45
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.45
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.42
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.32
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.11
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.2
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.16
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.83
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.75
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.27
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.92
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=1.3e-41  Score=340.76  Aligned_cols=302  Identities=34%  Similarity=0.616  Sum_probs=203.4

Q ss_pred             CCcHHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCCC--ccCeeeCCCC--CcEEEEEcCCCCCCCCCCCce--ecCcc
Q 040109           34 SCLDEEKEALLAFKQGLIDESGILSSWGREDEKRNCCK--WRGVRCSNKT--GHVLGLDLRALSDSPVDALKG--TINPS  107 (598)
Q Consensus        34 ~~~~~~~~~l~~~k~~~~~~~~~l~~W~~~~~~~~~c~--w~gv~C~~~~--~~v~~l~l~~~~~~~~~~l~g--~l~~~  107 (598)
                      -|.++|++||++||+++.+|. .+++|.   .+.|||.  |.||+|+...  +||++|||++      +.+.|  .+|++
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~-~l~sW~---~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~------~~l~g~~~lp~~   71 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT-TLSSWL---PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSG------LNLPKPYPIPSS   71 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCC---TTSCTTTTCSTTEEECCSSSCCCEEEEEEEC------CCCSSCEECCGG
T ss_pred             CCCHHHHHHHHHHHHHCCCCC-cCCCCC---CCCCCCCCcCCCeEEeCCCCcEEEEEEECCC------CCCCCCCCCChH
Confidence            399999999999999999875 689997   4779994  9999998643  3788888887      55655  35555


Q ss_pred             ccCCCCCCEEECcC-CCCCCCCcchhcCCCCCCCEEECCCCCCCCCCccccCCCCCCCEEEccCCCCCCCCCcccccCCC
Q 040109          108 LLKLQHLTYLDLSW-NNFSGSPIPEFIGSLSKLSELALSSAQLAGPIPHQLGNLSRLQVLDLRFNNLFSSGNLDWLSYLS  186 (598)
Q Consensus       108 l~~l~~L~~L~Ls~-n~l~~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~~~~~l~~l~  186 (598)
                      ++++++|++|+|++ |.+++. +|..|+++++|++|+|++|++.+..+..+..+.+|+++++++|               
T Consensus        72 l~~L~~L~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N---------------  135 (313)
T d1ogqa_          72 LANLPYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYN---------------  135 (313)
T ss_dssp             GGGCTTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSS---------------
T ss_pred             HhcCccccccccccccccccc-cccccccccccchhhhccccccccccccccchhhhcccccccc---------------
Confidence            55555555555553 444442 4444444444444444444444333333322222222222222               


Q ss_pred             CCCEEEcCCCcCCCCCchhHhhcCCCCCcEEeccCcCCCCCCCChhhhccccCCccEEEccCCCCCCCcchhhhhcCccC
Q 040109          187 SLRYLDLGDCKLSKFSNWFQVLSNLRSLTTLYLGHCDLPPISTPSLLHLNYSKSLEVIDLSNNYLTNSIYPWLLNVSSNL  266 (598)
Q Consensus       187 ~L~~L~L~~n~l~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~l~~~~~~~  266 (598)
                                                                                                      
T Consensus       136 --------------------------------------------------------------------------------  135 (313)
T d1ogqa_         136 --------------------------------------------------------------------------------  135 (313)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             ccEEEccCCccccccchhhcCCCCccEEeeccCCCCC-cchhhcCCCCC-cEEEcccCcCccchhhhhhhcCCCCCCCCC
Q 040109          267 VDHIDLGSNRLHGSIPVAFGHMASLRYLGLLSNRLRE-VPKFLGNMSSL-KMLVLSYNELRGELSEFIQNVSSGSTKNSS  344 (598)
Q Consensus       267 L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~-lp~~l~~l~~L-~~L~Ls~n~l~~~~~~~l~~l~~g~~~~~~  344 (598)
                               .+.+.+|..+.++++++++++++|.+.+ +|..+..+.++ +.+++++|++++..|..+..+.        
T Consensus       136 ---------~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~--------  198 (313)
T d1ogqa_         136 ---------ALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN--------  198 (313)
T ss_dssp             ---------EEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCC--------
T ss_pred             ---------cccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccc--------
Confidence                     2222233333333333444444444333 44444444443 5566666666665555544432        


Q ss_pred             CCEEEccCccccccCCCCCCCCcCccccccccceEEEEcCCcccccccccccceEeccCCcCCCcCchhhhcccCCcEEE
Q 040109          345 LEWLYLASNEITGTIPNLGGFPGMLMPLIYFDKITVTWKGGQYEYKSILGLIKIIDLSSNKLGGEVPEEIMDLVGLVALN  424 (598)
Q Consensus       345 L~~L~Ls~N~l~~~~p~l~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~  424 (598)
                                                                         ...++++++...+.+|..+..+++++.++
T Consensus       199 ---------------------------------------------------~~~l~l~~~~~~~~~~~~~~~~~~l~~l~  227 (313)
T d1ogqa_         199 ---------------------------------------------------LAFVDLSRNMLEGDASVLFGSDKNTQKIH  227 (313)
T ss_dssp             ---------------------------------------------------CSEEECCSSEEEECCGGGCCTTSCCSEEE
T ss_pred             ---------------------------------------------------ccccccccccccccccccccccccccccc
Confidence                                                               23455555666667777888889999999


Q ss_pred             CcCCcCcccCCcccCCCCCCCeeeCCCCccCCCCcccccCCCCCCEEeCCCCcceecCCCCCccCccCCCccCCCCCCCC
Q 040109          425 LSNNNLTGQITPRIGQLKSLDFLDLSINHFFGGIPSSLSRLRLLSVMDLSYNNFSGKIPKGTQLQRFGASTYAGNPELCG  504 (598)
Q Consensus       425 Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~ls~N~l~~~~p~~~~~~~l~~~~~~gnp~lC~  504 (598)
                      +++|.+.+.+| .++.+++|+.|+|++|+++|.+|+.|.++++|++|+|++|+++|.+|....+++++.+++.||+.+||
T Consensus       228 ~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~~l~g  306 (313)
T d1ogqa_         228 LAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCG  306 (313)
T ss_dssp             CCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSSEEES
T ss_pred             ccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHhCCCccccC
Confidence            99999987655 68889999999999999999999999999999999999999999999988899999999999999999


Q ss_pred             CCCCCCC
Q 040109          505 LPLPNKC  511 (598)
Q Consensus       505 ~~~~~~c  511 (598)
                      .|++ .|
T Consensus       307 ~plp-~c  312 (313)
T d1ogqa_         307 SPLP-AC  312 (313)
T ss_dssp             TTSS-CC
T ss_pred             CCCC-CC
Confidence            9875 66



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure