Citrus Sinensis ID: 040113


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------
MGSSQCLFSIFMQLFVPLIFFNFTTATFSTASSVLRLCHDDECSALLQFKESLIINDTIEESYHYYPWSSGCRPKAASWKPEEGNIDCCSWDGVECSENTGHVMKLDLSNSCLYGSINSSSSLFKLVHLEWLNLAFNDFKSSEIPSEIINLSRLSYLNLSHSSFFGQIPSEILELVNLVSLDLSLNSGYGLELQKPNFANLVEKLSNLETLDLGYVSIRSTIPHNLANLSSLTFLSLHSCGLQGRIQSSLGNLSKLLHLDLSLNELLGELPVSIGNLHSLKKLDLSINNLSGELPTSIQNLVSLEELDLSFNKLSGEFPWSIVIGNFTQLQSLDFTSNKFSGELHASIGNLRSLEVLAIGRCNFSGRIPSSLRNLTQLITLDLSQNSYRGTMELDFLLVSLKNLEVLSLSSNWLSLLTKVTSNTTSQKFTVVGLRSCNLIEFPNFLKNQHHLMLLDLSSNRIHGKIPSWLLDPSTQNLSALNLSHNLLTGFDQQLVVLPGGKRFLLTLDLSSNNLQGPLPVPPSRTVNYLVSNNSFIGEIPSWLCKLDSLEILVLSHNNLSGLLPRCLGSFSDKLSILDLRANNFFGTIPNTFMKESRLGMIDLSHNLFQGRIPRSLINCSKLEFLDIGDNQIRDIFPSWLGTLPNLTVLILQSNKFYGIIREPRIDCGFSKLRIIDLSNNRFTGKLPSKSFLCWNAMKIVNTSDLKYLQDVISPKEWLLSDEVATYDYSLKMNNKGQIMTYDKVPDILTSIILSSNRFDGMIPTSIANLKGLQVLNLDNNNLQGHIPSCLGNLTNLESLDLSNNNFLGQIPQQLVELTFLEFFNVSDNYLTGPIPQGRQFATFDNSSFESNSGLCGRPLSRECESDEAPTNEDHSKGAEESIFRRI
cccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccEEEccccccEEEEEcccccccEEEcccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccHHHHHcccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccccEEEcccccccEEccccccccccccEEEcccccccccccccccccccccEEEccccccEEEEcccccccccccccEEEccccEEEEEEccccccccccccEEEccccccccccHHHcccccccEEEcccccccccccccccccccccccEEEccccccccccccccccccccccccEEEccccccccccccccccccEEEccccccEEEccccccccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEccccEEEEcccHHHHHcccccEEEcccccccccccHHHHccccccEEEccccccEEEccccccccccccccEEEcccccccccccHHHHcccHHHHHccccccccccccccccccccccccEEEEEEEEEEEEcccccccccccccEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEc
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEEEccccccEEEEEEEcccccccEEccHHHHHcccccEEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEccccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEcccccccccccccHHHcccccccEEEcccccccccccHcHccccHHHHHHHHcccccccccHHHcccccccEEEcccccccccccHHHHHcccccccEEEccccccccccccccccccccccEEEEEcccccccccccccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHHccccccEEEEccccccccccccHHcccccEEEEEcccccccccccHHHHcccccEEEEcccccccccccHHHccccccEEEEEcccccccccccccccccccccEEEEEccccccccccHHHHHHHHHHHHccccccccccccccccccccccccEEEHHHHEEccccccHHHHccccEEEEEEcccccccccccHHHHHHccccEEEccccccEEcccHHccccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccccccHHHccHHHcccccEEEccccccccccccccccccccccccccccccc
MGSSQCLFSIFMQLFVpliffnfttatfstaSSVLRLCHDDECSALLQFKESLIINdtieesyhyypwssgcrpkaaswkpeegnidccswdgvecsentghvmkldlsnsclygsinsssslFKLVHLEWLNLAfndfksseipseIINLSRLsylnlshssffgqiPSEILELVNLVSLdlslnsgyglelqkpnFANLVEKLSNLETLDLGYVSIRStiphnlanlssltflslhscglqgRIQSSLGNLSKLLHLDLSLNELLGELPVSIGNLHSLKKLDLSInnlsgelptsIQNLVSLEEldlsfnklsgefpwsivignftqlqsldftsnkfsGELHASIGNLRSLEVLAIGrcnfsgripsslrNLTQLITLdlsqnsyrgtMELDFLLVSLKNLEVLSLSSNWLSLLTKVTsnttsqkfTVVGlrscnliefpnflkNQHHLMLLDlssnrihgkipswlldpstqnlsALNLSHnlltgfdqqlvvlpggkRFLLTLDlssnnlqgplpvppsrtvnylvsnnsfigeipswlckldslEILVLSHNnlsgllprclgsfsdkLSILDLRannffgtipntfmkESRLGMIdlshnlfqgriprslincsklefldigdnqirdifpswlgtlpnltvlilqsnkfygiirepridcgfsKLRIIDlsnnrftgklpsksflCWNAMKIVNTSDLKYLqdvispkewllsdevaTYDYSlkmnnkgqimtydkvPDILTSIILssnrfdgmiptsianlkglqvlnldnnnlqghipsclgnltnlesldlsnnnflgqipQQLVELTFLEFfnvsdnyltgpipqgrqfatfdnssfesnsglcgrplsrecesdeaptnedhskgaeESIFRRI
MGSSQCLFSIFMQLFVPLIFFNFTTATFSTASSVLRLCHDDECSALLQFKESLIINDTIEESYHYYPWSSGCRPKAASWKPEEGNIDCCSWDGVECSENTGHVMKLDLSNSCLYGSINSSSSLFKLVHLEWLNLAFNDFKSSEIPSEIINLSRLSYLNLSHSSFFGQIPSEILELVNLVSLDLSLNSGYGLELQKPNFANLVEKLSNLETLDLGYVSIRSTIPHNLANLSSLTFLSLHSCGLQGRIQSSLGNLSKLLHLDLSLNELLGELPVSIGNLHSLKKLDLSINNLSGELPTSIQNLVSLEELDLSFNKLSGEFPWSIVIGNFTQLQSLDFTSNKFSGELHASIGNLRSLEVLAIGRCNFSGRIPSSLRNLTQLITLDLSQNSYRGTMELDFLLVSLKNLEVLSLSSNWLSLLTKVTSNTTSQKFTVVGLRSCNLIEFPNFLKNQHHLMLLDLSSNRIHGKIPSWLLDPSTQNLSALNLSHNLLTGFDQQLVVLPGGKRFLLTLDLSSNNLQGPLPVPPSRTVNYLVSNNSFIGEIPSWLCKLDSLEILVLSHNNLSGLLPRCLGSFSDKLSILDLRANNFFGTIPNTFMKESRLGMIDLSHNLFQGRIPRSLINCSKLEFLDIGDNQIRDIFPSWLGTLPNLTVLILQSNKFYGIIREPRIDCGFSKLRIIDLsnnrftgklpsksFLCWNAMKIVNTSDLKYLQDVISPKEWLLSDEVATYDYSLKMNNKGQIMTYDKVPDILTSIILSSNRFDGMIPTSIANLKGLQVLNLDNNNLQGHIPSCLGNLTNLESLDLSNNNFLGQIPQQLVELTFLEFFNVSDNYLTGPIPQGRQFATFDNSSFESNSGLCGRPLSREcesdeaptnedhskgaeesifrri
MGSSQCLFSIFMQLFVPLIffnfttatfstassVLRLCHDDECSALLQFKESLIINDTIEESYHYYPWSSGCRPKAASWKPEEGNIDCCSWDGVECSENTGHVMKLDLSNSCLYGSINSSSSLFKLVHLEWLNLAFNDFKSSEIPSEIINLSRLSYLNLSHSSFFGQIPSEIlelvnlvsldlslnsGYGLELQKPNFANLVEKLSNLETLDLGYVSIRSTIPHNLANLSSLTFLSLHSCGLQGRIQsslgnlskllhldlslnellgelPVSIGNLHSLKKLDLSINNLSGELPTSIQNLVSLEELDLSFNKLSGEFPWSIVIGNFTQLQSLDFTSNKFSGELHASIGNLRSLEVLAIGRCNFSGRIPSSLRNLTQLITLDLSQNSYRGTMELDFLLVSLKNlevlslssnwlsllTKVTSNTTSQKFTVVGLRSCNLIEFPNFLKNQHHLMLLDLSSNRIHGKIPSWLLDPSTQnlsalnlshnllTGFDQQLVVLPGGKRFLLTLDLSSNNLQGPLPVPPSRTVNYLVSNNSFIGEIPSWLCKLDSLEILVLSHNNLSGLLPRCLGSFSDKLSILDLRANNFFGTIPNTFMKESRLGMIDLSHNLFQGRIPRSLINCSKLEFLDIGDNQIRDIFPSWLGTLPNLTVLILQSNKFYGIIREPRIDCGFSKLRIIDLSNNRFTGKLPSKSFLCWNAMKIVNTSDLKYLQDVISPKEWLLSDEVATYDYSLKMNNKGQIMTYDKVPDILTSIILSSNRFDGMIPTSIANLKGlqvlnldnnnlqGHIPSCLGNLTNLESLDLSNNNFLGQIPQQLVELTFLEFFNVSDNYLTGPIPQGRQFATFDNSSFESNSGLCGRPLSRECESDEAPTNEDHSKGAEESIFRRI
*****CLFSIFMQLFVPLIFFNFTTATFSTASSVLRLCHDDECSALLQFKESLIINDTIEESYHYYPWSSGCRPKAASWKPEEGNIDCCSWDGVECSENTGHVMKLDLSNSCLY*********FKLVHLEWLNLAFNDFKSSEIPSEIINLSRLSYLNLSHSSFFGQIPSEILELVNLVSLDLSLNSGYGLELQKPNFANLVEKLSNLETLDLGYVSIRSTIPHNLANLSSLTFLSLHSCGLQGRIQSSLGNLSKLLHLDLSLNELLGELPVSIGNLHSLKKLDLSINNLSGELPTSIQNLVSLEELDLSFNKLSGEFPWSIVIGNFTQLQSLDFTSNKFSGELHASIGNLRSLEVLAIGRCNFSGRIPSSLRNLTQLITLDLSQNSYRGTMELDFLLVSLKNLEVLSLSSNWLSLLTKVTSNTTSQKFTVVGLRSCNLIEFPNFLKNQHHLMLLDLSSNRIHGKIPSWLLDPSTQNLSALNLSHNLLTGFDQQLVVLPGGKRFLLTLDLSSNNLQGPLPVPPSRTVNYLVSNNSFIGEIPSWLCKLDSLEILVLSHNNLSGLLPRCLGSFSDKLSILDLRANNFFGTIPNTFMKESRLGMIDLSHNLFQGRIPRSLINCSKLEFLDIGDNQIRDIFPSWLGTLPNLTVLILQSNKFYGIIREPRIDCGFSKLRIIDLSNNRFTGKLPSKSFLCWNAMKIVNTSDLKYLQDVISPKEWLLSDEVATYDYSLKMNNKGQIMTYDKVPDILTSIILSSNRFDGMIPTSIANLKGLQVLNLDNNNLQGHIPSCLGNLTNLESLDLSNNNFLGQIPQQLVELTFLEFFNVSDNYLTGPIPQGRQFAT********************************************
*****CL*SIFMQLFVPLIFFNFTTATFSTASS****CHDDECSALLQFKESLIINDTIEESYHYYPWSSGCRPKAASWKPEEGNIDCCSWDGVECSENTGHVMKLDLSNSCLYGSINSSSSLFKLVHLEWLNLAFNDFKSSEIPSEIINLSRLSYLNLSHSSFFGQIPSEILELVNLVSLDLSLNSGYGLELQKPNFANLVEKLSNLETLDLGYVSIRSTIPHNLANLSSLTFLSLHSCGLQGRIQSSLGNLSKLLHLDLSLNELLGELPVSIGNLHSLKKLDLSINNLSGELPTSIQNLVSLEELDLSFNKLSGEFPWSIVIGNFTQLQSLDFTSNKFSGELHASIGNLRSLEVLAIGRCNFSGRIPSSLRNLTQLITLDLSQNSYRGTMELDFLLVSLKNLEVLSLSSNWLSLLTKVTSNTTSQKFTVVGLRSCNLIEFPNFLKNQHHLMLLDLSSNRIHGKIPSWLLDPSTQNLSALNLSHNLLTGFDQQLVVLPGGKRFLLTLDLSSNNLQGPLPVPPSRTVNYLVSNNSFIGEIPSWLCKLDSLEILVLSHNNLSGLLPRCLGSFSDKLSILDLRANNFFGTIPNTFMKESRLGMIDLSHNLFQGRIPRSLINCSKLEFLDIGDNQIRDIFPSWLGTLPNLTVLILQSNKFYGIIREPRIDCGFSKLRIIDLSNNRFTGKLPSKSFLCWNAMK***********DVISPKEWLLSDEVATYDYSLKMNNKGQIMTYDKVPDILTSIILSSNRFDGMIPTSIANLKGLQVLNLDNNNLQGHIPSCLGNLTNLESLDLSNNNFLGQIPQQLVELTFLEFFNVSDNYLTGPIPQGRQFATFDNSSFESNSGLCGR***********************SIFRRI
MGSSQCLFSIFMQLFVPLIFFNFTTATFSTASSVLRLCHDDECSALLQFKESLIINDTIEESYHYYPWSSGCRPKAASWKPEEGNIDCCSWDGVECSENTGHVMKLDLSNSCLYGSINSSSSLFKLVHLEWLNLAFNDFKSSEIPSEIINLSRLSYLNLSHSSFFGQIPSEILELVNLVSLDLSLNSGYGLELQKPNFANLVEKLSNLETLDLGYVSIRSTIPHNLANLSSLTFLSLHSCGLQGRIQSSLGNLSKLLHLDLSLNELLGELPVSIGNLHSLKKLDLSINNLSGELPTSIQNLVSLEELDLSFNKLSGEFPWSIVIGNFTQLQSLDFTSNKFSGELHASIGNLRSLEVLAIGRCNFSGRIPSSLRNLTQLITLDLSQNSYRGTMELDFLLVSLKNLEVLSLSSNWLSLLTKVTSNTTSQKFTVVGLRSCNLIEFPNFLKNQHHLMLLDLSSNRIHGKIPSWLLDPSTQNLSALNLSHNLLTGFDQQLVVLPGGKRFLLTLDLSSNNLQGPLPVPPSRTVNYLVSNNSFIGEIPSWLCKLDSLEILVLSHNNLSGLLPRCLGSFSDKLSILDLRANNFFGTIPNTFMKESRLGMIDLSHNLFQGRIPRSLINCSKLEFLDIGDNQIRDIFPSWLGTLPNLTVLILQSNKFYGIIREPRIDCGFSKLRIIDLSNNRFTGKLPSKSFLCWNAMKIVNTSDLKYLQDVISPKEWLLSDEVATYDYSLKMNNKGQIMTYDKVPDILTSIILSSNRFDGMIPTSIANLKGLQVLNLDNNNLQGHIPSCLGNLTNLESLDLSNNNFLGQIPQQLVELTFLEFFNVSDNYLTGPIPQGRQFATFDNSSFESNSGLCGRPLS**************************
***SQCLFSIFMQLFVPLIFFNFTTATFSTASSVLRLCHDDECSALLQFKESLIINDTIEESYHYYPWS****PKAASWKPEEGNIDCCSWDGVECSENTGHVMKLDLSNSCLYGSINSSSSLFKLVHLEWLNLAFNDFKSSEIPSEIINLSRLSYLNLSHSSFFGQIPSEILELVNLVSLDLSLNSGYGLELQKPNFANLVEKLSNLETLDLGYVSIRSTIPHNLANLSSLTFLSLHSCGLQGRIQSSLGNLSKLLHLDLSLNELLGELPVSIGNLHSLKKLDLSINNLSGELPTSIQNLVSLEELDLSFNKLSGEFPWSIVIGNFTQLQSLDFTSNKFSGELHASIGNLRSLEVLAIGRCNFSGRIPSSLRNLTQLITLDLSQNSYRGTMELDFLLVSLKNLEVLSLSSNWLSLLTKVTSNTTSQKFTVVGLRSCNLIEFPNFLKNQHHLMLLDLSSNRIHGKIPSWLLDPSTQNLSALNLSHNLLTGFDQQLVVLPGGKRFLLTLDLSSNNLQGPLPVPPSRTVNYLVSNNSFIGEIPSWLCKLDSLEILVLSHNNLSGLLPRCLGSFSDKLSILDLRANNFFGTIPNTFMKESRLGMIDLSHNLFQGRIPRSLINCSKLEFLDIGDNQIRDIFPSWLGTLPNLTVLILQSNKFYGIIREPRIDCGFSKLRIIDLSNNRFTGKLPSKSFLCWNAMKIVNTSDLKYLQDVISPKEWLLSDEVATYDYSLKMNNKGQIMTYDKVPDILTSIILSSNRFDGMIPTSIANLKGLQVLNLDNNNLQGHIPSCLGNLTNLESLDLSNNNFLGQIPQQLVELTFLEFFNVSDNYLTGPIPQGRQFATFDNSSFESNSGLCGRPLSR*************************
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSSQCLFSIFMQLFVPLIFFNFTTATFSTASSVLRLCHDDECSALLQFKESLIINDTIEESYHYYPWSSGCRPKAASWKPEEGNIDCCSWDGVECSENTGHVMKLDLSNSCLYGSINSSSSLFKLVHLEWLNLAFNDFKSSEIPSEIINLSRLSYLNLSHSSFFGQIPSEILELVNLVSLDLSLNSGYGLELQKPNFANLVEKLSNLETLDLGYVSIRSTIPHNLANLSSLTFLSLHSCGLQGRIQSSLGNLSKLLHLDLSLNELLGELPVSIGNLHSLKKLDLSINNLSGELPTSIQNLVSLEELDLSFNKLSGEFPWSIVIGNFTQLQSLDFTSNKFSGELHASIGNLRSLEVLAIGRCNFSGRIPSSLRNLTQLITLDLSQNSYRGTMELDFLLVSLKNLEVLSLSSNWLSLLTKVTSNTTSQKFTVVGLRSCNLIEFPNFLKNQHHLMLLDLSSNRIHGKIPSWLLDPSTQNLSALNLSHNLLTGFDQQLVVLPGGKRFLLTLDLSSNNLQGPLPVPPSRTVNYLVSNNSFIGEIPSWLCKLDSLEILVLSHNNLSGLLPRCLGSFSDKLSILDLRANNFFGTIPNTFMKESRLGMIDLSHNLFQGRIPRSLINCSKLEFLDIGDNQIRDIFPSWLGTLPNLTVLILQSNKFYGIIREPRIDCGFSKLRIIDLSNNRFTGKLPSKSFLCWNAMKIVNTSDLKYLQDVISPKEWLLSDEVATYDYSLKMNNKGQIMTYDKVPDILTSIILSSNRFDGMIPTSIANLKGLQVLNLDNNNLQGHIPSCLGNLTNLESLDLSNNNFLGQIPQQLVELTFLEFFNVSDNYLTGPIPQGRQFATFDNSSFESNSGLCGRPLSRECESDEAPTNEDHSKGAEESIFRRI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query887 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.866 0.907 0.369 1e-119
Q9FL28 1173 LRR receptor-like serine/ no no 0.789 0.596 0.321 2e-74
Q9LVP0 1102 Probable leucine-rich rep no no 0.751 0.605 0.322 9e-70
C0LGQ5 1249 LRR receptor-like serine/ no no 0.852 0.605 0.297 1e-65
Q9LP24 1120 Probable leucine-rich rep no no 0.756 0.599 0.290 3e-65
C0LGS2 1136 Probable LRR receptor-lik no no 0.702 0.548 0.316 2e-63
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.862 0.611 0.301 9e-63
Q9FZ59 1088 Leucine-rich repeat recep no no 0.703 0.573 0.327 3e-62
O49318 1124 Probable leucine-rich rep no no 0.710 0.560 0.299 2e-61
Q9LYN8 1192 Leucine-rich repeat recep no no 0.807 0.600 0.312 2e-60
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  430 bits (1106), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 320/866 (36%), Positives = 453/866 (52%), Gaps = 97/866 (11%)

Query: 29  STASSVLRLCHDDECSALLQFKESLIINDTIEESYHYYPWSSGCRPKAASWK-PEEGNID 87
           S ASS    C DD+  ALL+F+    IN     S+H              W+ P   + D
Sbjct: 25  SLASSSPHFCRDDQRDALLEFRGEFPIN----ASWHI----------MNQWRGPWNKSTD 70

Query: 88  CCSWDGVECSENTGHVMKLDLSNSCLYGSINSSSSLFKLVHLEWLNLAFNDFKSSEIPSE 147
           CC W+GV C++ +G V+ LD+ N+ L   + ++SSLFKL +L  L+L  N     EIPS 
Sbjct: 71  CCLWNGVTCNDKSGQVISLDIPNTFLNNYLKTNSSLFKLQYLRHLDLT-NCNLYGEIPSS 129

Query: 148 IINLSRLSYLNLSHSSFFGQIPSEILELVNLVSLDLSLNSGYGLELQKPNFANLVEKLSN 207
           + NLS L+ +NL  + F G+IP+ I  L  L  L L+ N   G   + P+    + +L N
Sbjct: 130 LGNLSHLTLVNLYFNKFVGEIPASIGNLNQLRHLILANNVLTG---EIPSSLGNLSRLVN 186

Query: 208 LETLDLGYVSIRSTIPHNLANLSSLTFLSLHSCGLQGRIQSSLGNLSKLLHLDLSLNELL 267
           LE      V     IP ++ +L  L  LSL S  L G I SSLGNLS L+HL L+ N+L+
Sbjct: 187 LELFSNRLV---GKIPDSIGDLKQLRNLSLASNNLIGEIPSSLGNLSNLVHLVLTHNQLV 243

Query: 268 GELPVSIGNLHSLKKLDLSINNLSGELPTSIQNLVSLEELDLSFNKLSGEFPWSIVIGNF 327
           GE+P SIGNL  L+ +    N+LSG +P S  NL  L    LS N  +  FP+ + I  F
Sbjct: 244 GEVPASIGNLIELRVMSFENNSLSGNIPISFANLTKLSIFVLSSNNFTSTFPFDMSI--F 301

Query: 328 TQLQSLDFTSNKFSGELHASIGNLRSLEVLAIGRCNFSGRIP-SSLRNLTQLITLDLSQN 386
             L+  D + N FSG    S+  + SLE + +    F+G I  ++  + T+L  L L +N
Sbjct: 302 HNLEYFDVSYNSFSGPFPKSLLLIPSLESIYLQENQFTGPIEFANTSSSTKLQDLILGRN 361

Query: 387 SYRGTMELDFLLVSLKNLEVLSLSSNWLSLLTKVTSNTTSQKFTVVGLRSCNLIEFPNFL 446
              G +     +  L NLE L +S N                FT            P  +
Sbjct: 362 RLHGPIPES--ISRLLNLEELDISHN---------------NFTGA---------IPPTI 395

Query: 447 KNQHHLMLLDLSSNRIHGKIPSWLLDPSTQNLSALNLSHNLLTGFDQQLVVLPGGKRFLL 506
               +L+ LDLS N + G++P+ L       L+ + LSHN  + F+         +  + 
Sbjct: 396 SKLVNLLHLDLSKNNLEGEVPACLW-----RLNTMVLSHNSFSSFENT----SQEEALIE 446

Query: 507 TLDLSSNNLQGPLPVPPSRTVNYLVSNNSFIGEIPSWLCKLDSLEILVLSHNNLSGLLPR 566
            LDL+SN+ QGP+P        Y++             CKL SL  L LS+N  SG +P 
Sbjct: 447 ELDLNSNSFQGPIP--------YMI-------------CKLSSLGFLDLSNNLFSGSIPS 485

Query: 567 CLGSFSDKLSILDLRANNFFGTIPNTFMKESRLGMIDLSHNLFQGRIPRSLINCSKLEFL 626
           C+ +FS  +  L+L  NNF GT+P+ F K + L  +D+SHN  +G+ P+SLINC  LE +
Sbjct: 486 CIRNFSGSIKELNLGDNNFSGTLPDIFSKATELVSLDVSHNQLEGKFPKSLINCKALELV 545

Query: 627 DIGDNQIRDIFPSWLGTLPNLTVLILQSNKFYGIIREPRIDCGFSKLRIIDLSNNRFTGK 686
           ++  N+I+DIFPSWL +LP+L VL L+SNKFYG +       GF  LRIID+S+N F+G 
Sbjct: 546 NVESNKIKDIFPSWLESLPSLHVLNLRSNKFYGPLYHRHASIGFQSLRIIDISHNNFSGT 605

Query: 687 LPSKSFLCWNAMKIVNTSDLKYLQDVISPKEWLLSDEVATYDYSLKMNNKGQIMTYDKVP 746
           LP   F  W  M  +     +Y+ +      W  +D   +Y + ++M NKG  M+++++ 
Sbjct: 606 LPPYYFSNWKDMTTLTEEMDQYMTEF-----WRYAD---SYYHEMEMVNKGVDMSFERIR 657

Query: 747 DILTSIILSSNRFDGMIPTSIANLKGLQVLNLDNNNLQGHIPSCLGNLTNLESLDLSNNN 806
               +I  S N+ +G IP S+  LK L+VLNL  N     IP  L NLT LE+LD+S N 
Sbjct: 658 RDFRAIDFSGNKINGNIPESLGYLKELRVLNLSGNAFTSVIPRFLANLTKLETLDISRNK 717

Query: 807 FLGQIPQQLVELTFLEFFNVSDNYLTGPIPQGRQFATFDNSSFESNSGLCGRPLSRECES 866
             GQIPQ L  L+FL + N S N L GP+P+G QF     SSF  N GL G  L   C  
Sbjct: 718 LSGQIPQDLAALSFLSYMNFSHNLLQGPVPRGTQFQRQKCSSFLDNPGLYG--LEDICRD 775

Query: 867 DEA--PTN---EDHSKGAEESIFRRI 887
             A  PT+   ED S+ AEE++F  +
Sbjct: 776 TGALNPTSQLPEDLSE-AEENMFNWV 800




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query887
359485824973 PREDICTED: receptor-like protein 12-like 0.963 0.878 0.491 0.0
359490156886 PREDICTED: receptor-like protein 12-like 0.900 0.901 0.507 0.0
359485822 993 PREDICTED: receptor-like protein 12-like 0.978 0.874 0.478 0.0
224140505 993 predicted protein [Populus trichocarpa] 0.970 0.867 0.451 0.0
147782974 1719 hypothetical protein VITISV_036826 [Viti 0.939 0.484 0.468 0.0
224140509961 predicted protein [Populus trichocarpa] 0.934 0.862 0.451 0.0
147804670 1004 hypothetical protein VITISV_022039 [Viti 0.932 0.823 0.463 0.0
224140517979 predicted protein [Populus trichocarpa] 0.969 0.878 0.452 0.0
224128143923 predicted protein [Populus trichocarpa] 0.956 0.918 0.464 0.0
224140513947 predicted protein [Populus trichocarpa] 0.971 0.910 0.458 0.0
>gi|359485824|ref|XP_003633343.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/930 (49%), Positives = 572/930 (61%), Gaps = 75/930 (8%)

Query: 9   SIFMQLFVPLIFF--NFTTATFSTASSVLR-LCHDDECSALLQFKESLIINDTIEESYHY 65
           ++++ +FV  + F  +F     +++SS+ R LCHD E SALLQFK+S +I++    +   
Sbjct: 4   ALYVFMFVRFLLFLSSFYLMVTNSSSSMHRPLCHDSEGSALLQFKQSFLIDEHASGNPSA 63

Query: 66  YPWSSGCRPKAASWKP----EEGNIDCCSWDGVECSENTGHVMKLDLSNSCLYGSINSSS 121
           YP       K A WK     E    DCCSWDGVEC   TGHV+ L L++SCLYGSINSSS
Sbjct: 64  YP-------KVAMWKSHGEGEREGSDCCSWDGVECDRETGHVIGLHLASSCLYGSINSSS 116

Query: 122 SLFKLVHLEWLNLAFNDFKSSEIPSEIINLSRLSYLNLSHSSFFGQIPSEILELVNLVSL 181
           +LF LVHL+ L+L+ NDF  SEIP  +  LSRL  L+LS S F GQIPSE+L L  LV L
Sbjct: 117 TLFSLVHLQRLDLSDNDFNYSEIPFGVGQLSRLRSLDLSFSGFSGQIPSELLALSKLVFL 176

Query: 182 DLSLNSGYGLELQKPNFANLVEKLSNLETLDLGYVSIRSTIPHNLANLSSLTFLSLHSCG 241
           DLS N    L+LQKP   NLV+ L++L+ L L  V+I STIP+ LA+LSSLT L L  CG
Sbjct: 177 DLSANPK--LQLQKPGLRNLVQNLTHLKKLHLSQVNISSTIPYELASLSSLTSLFLGECG 234

Query: 242 LQGRIQSSLGNL------------------------SKLLHLDLSLNELLGELPVSIGNL 277
           L G     +  L                        S L  LDL+     GELP SIG L
Sbjct: 235 LHGEFPMKIFQLPSLQYLTVRDNLDLISYLPEFQETSPLKMLDLAGTSFSGELPTSIGRL 294

Query: 278 HSLKKLDLSINNLSGELPTSIQNLVSLEELDLSFNKLSGEFPWSIVIGNFTQLQSLDFTS 337
            SL +LD+S  N +G +P+S+ +L  L  LDLS N  SG+ P S+   N TQL  L  + 
Sbjct: 295 GSLTELDISSCNFTGSVPSSLGHLTQLYYLDLSNNHFSGQIPSSMA--NLTQLIYLSLSW 352

Query: 338 NKFS------------------------GELHASIGNLRSLEVLAIGRCNFSGRIPSSLR 373
           N F+                        GE+  S+ N+  L +L++     SG+IPSSL 
Sbjct: 353 NDFNVGTLSWLGQQTKLTYLYLNQINLIGEIPFSLVNMSQLNILSLSDNQLSGQIPSSLF 412

Query: 374 NLTQLITLDLSQNSYRGTMELDFLLVSLKNLEVLSLSSNWLSLLTKVTSNTTSQKFTVVG 433
            L  L  L L  N   GT+EL  LL  LKNL  L LS N LS L+   +N T  KF  +G
Sbjct: 413 ELVNLQGLYLLSNYLNGTVELQ-LLSKLKNLIYLQLSDNRLSFLSYTRTNATLPKFKHLG 471

Query: 434 LRSCNLIEFPNFLKNQHHLMLLDLSSNRIHGKIPSWLLDPSTQNLSALNLSHNLLTGFDQ 493
           L SCNL EFP+FL+NQH L ++ LS N+IHG IP W+ + S + L  L LS N LTGFDQ
Sbjct: 472 LGSCNLTEFPDFLQNQHELEIITLSENKIHGPIPKWVWNISKETLVTLELSENFLTGFDQ 531

Query: 494 QLVVLPGGKRFLLTLDLSSNNLQGPLPVPPSRTVNYLVSNNSFIGEIPSWLCKLDSLEIL 553
           +  VLP  K  L TL L SN LQGPLPVPP  TV YLVS N   GEI   +C + SLE+L
Sbjct: 532 RPFVLPWSK--LHTLRLDSNMLQGPLPVPPPSTVEYLVSGNKLTGEISPLICNMTSLELL 589

Query: 554 VLSHNNLSGLLPRCLGSFSDKLSILDLRANNFFGTIPNTFMKESRLGMIDLSHNLFQGRI 613
            LS NNLSG +P+CL +FS  L +LDL +N+  G IP        L +IDL  N FQG+I
Sbjct: 590 DLSSNNLSGRIPQCLANFSRSLFVLDLGSNSLDGPIPEICTVSHNLNVIDLGDNQFQGQI 649

Query: 614 PRSLINCSKLEFLDIGDNQIRDIFPSWLGTLPNLTVLILQSNKFYGIIREPRIDCGFSKL 673
           PRSL+NC+ LE L +G+N+I DIFP WLG LP L VLIL+SN+F+G I     +  F KL
Sbjct: 650 PRSLVNCTMLEHLVLGNNKINDIFPFWLGALPQLQVLILRSNRFHGAIGSWHTNFRFPKL 709

Query: 674 RIIDLSNNRFTGKLPSKSFLCWNAMKIVN-TSDLKYLQDVISPKEWLLSDEVAT-YDYSL 731
           RIIDLS+N F G LPS+ F  W+AMK+ +  S L+Y+Q  ISP   L ++ + T Y YS+
Sbjct: 710 RIIDLSDNEFIGDLPSEYFQNWDAMKLTDIASGLRYMQ--ISPMIDLKNNVMITGYMYSM 767

Query: 732 KMNNKGQIMTYDKVPDILTSIILSSNRFDGMIPTSIANLKGLQVLNLDNNNLQGHIPSCL 791
            M NKG    Y+++ D   +I  S N F G IPTSI +LKG+ +LNL  N+L GHIPS L
Sbjct: 768 TMTNKGMQRFYERILDTFMAIDFSGNNFKGQIPTSIGSLKGIHLLNLGGNDLTGHIPSSL 827

Query: 792 GNLTNLESLDLSNNNFLGQIPQQLVELTFLEFFNVSDNYLTGPIPQGRQFATFDNSSFES 851
           GNLT LESLDLS N   G+IP QL  LTFLEFFNVS N+LTG IPQG+QFATF+N+SF+ 
Sbjct: 828 GNLTQLESLDLSQNKLSGEIPWQLTRLTFLEFFNVSHNHLTGHIPQGKQFATFENASFDG 887

Query: 852 NSGLCGRPLSRECESDEA--PTNEDHSKGA 879
           N GLCG PLSREC S EA  PT+    +G+
Sbjct: 888 NLGLCGSPLSRECGSSEALPPTSSSSKQGS 917




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359490156|ref|XP_003634044.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485822|ref|XP_003633342.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140505|ref|XP_002323623.1| predicted protein [Populus trichocarpa] gi|222868253|gb|EEF05384.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147782974|emb|CAN66148.1| hypothetical protein VITISV_036826 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140509|ref|XP_002323625.1| predicted protein [Populus trichocarpa] gi|222868255|gb|EEF05386.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147804670|emb|CAN66864.1| hypothetical protein VITISV_022039 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140517|ref|XP_002323629.1| predicted protein [Populus trichocarpa] gi|222868259|gb|EEF05390.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224128143|ref|XP_002329092.1| predicted protein [Populus trichocarpa] gi|222869761|gb|EEF06892.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224140513|ref|XP_002323627.1| predicted protein [Populus trichocarpa] gi|222868257|gb|EEF05388.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query887
TAIR|locus:2144392957 RLP53 "receptor like protein 5 0.408 0.378 0.417 1.4e-111
TAIR|locus:2119430741 RLP47 "receptor like protein 4 0.740 0.886 0.384 5.7e-107
TAIR|locus:2825762994 RLP6 "AT1G45616" [Arabidopsis 0.832 0.742 0.358 2.5e-106
TAIR|locus:2085537894 RLP34 "AT3G11010" [Arabidopsis 0.397 0.394 0.416 1.7e-105
TAIR|locus:22050051019 RLP7 "AT1G47890" [Arabidopsis 0.852 0.741 0.350 4.2e-102
TAIR|locus:2129246891 RLP50 "receptor like protein 5 0.861 0.857 0.339 1.9e-99
TAIR|locus:2046357890 RLP23 "receptor like protein 2 0.732 0.730 0.369 4.2e-95
TAIR|locus:2046585808 RLP27 "receptor like protein 2 0.666 0.731 0.379 1.1e-94
TAIR|locus:2829370915 RLP40 "receptor like protein 4 0.842 0.816 0.338 2.7e-93
TAIR|locus:2046515864 RLP24 "receptor like protein 2 0.809 0.831 0.334 1.3e-91
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 680 (244.4 bits), Expect = 1.4e-111, Sum P(2) = 1.4e-111
 Identities = 158/378 (41%), Positives = 220/378 (58%)

Query:   505 LLTLDLSSNNLQG-PLPVPPSRTVNYLV-SNNSFIGEIPSWLCKLDSLEILVLSHNNLSG 562
             L  ++LS+N L G   P  P  ++ YL+ SNN+FIG+IPS++C L SL  L LS NN +G
Sbjct:   536 LYYVNLSNNTLIGFQRPSKPEPSLLYLLGSNNNFIGKIPSFICGLRSLNTLDLSDNNFNG 595

Query:   563 LLPRCLGSFSDKLSILDLRANNFFGTIPNTFMKESRLGMIDLSHNLFQGRIPRSLINCSK 622
              +PRC+G     LS+L+LR N+  G +P    +  R   +D+ HN   G++PRSL   S 
Sbjct:   596 SIPRCMGHLKSTLSVLNLRQNHLSGGLPKQIFEILR--SLDVGHNQLVGKLPRSLSFFST 653

Query:   623 LEFLDIGDNQIRDIFPSWLGTLPNLTVLILQSNKFYGIIREPRIDCGFSKLRIIDLSNNR 682
             LE L++  N+I D FP WL +LP L VL+L+SN F+G I E      F +LRIID+S+NR
Sbjct:   654 LEVLNVESNRINDTFPFWLSSLPKLQVLVLRSNAFHGPIHEAT----FPELRIIDISHNR 709

Query:   683 FTGKLPSKSFLCWNAMKIVNTSDLKYLQDVISPKEWLLSDEVATYDYSLKMNNKGQIMTY 742
             F G LP++ F+ W+AM     S L   +D  S ++++ S     Y  S+ + NKG  M  
Sbjct:   710 FNGTLPTEYFVKWSAM-----SSLGKNEDQ-SNEKYMGSG--LYYQDSMVLMNKGVAMEL 761

Query:   743 DKVPDILTSIILSSNRFDGMIPTSIANLKGXXXXXXXXXXXXGHIPSCLGNLTNLESLDL 802
              ++  I T++  S NRF+G IP SI  LK             GH+PS +GNLT LESLD+
Sbjct:   762 VRILTIYTAVDFSGNRFEGEIPKSIGLLKELLVLSLSNNAFSGHMPSSMGNLTALESLDV 821

Query:   803 SNNNFLGQIPQQLVELTFLEFFNVSDNYLTGPIPQGRQFATFDNSSFESNSGLCGRPLSR 862
             S N   G+IPQ+L +L+FL + N S N L G +P G+QF T + S+FE N GL G  L  
Sbjct:   822 SKNKLTGEIPQELGDLSFLAYMNFSHNQLAGLVPGGQQFLTQNCSAFEDNLGLFGSSLEE 881

Query:   863 ECESDEAPTNEDHSKGAE 880
              C     P +    +  E
Sbjct:   882 VCRDIHTPASHQQFETPE 899


GO:0005576 "extracellular region" evidence=ISM
GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2119430 RLP47 "receptor like protein 47" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825762 RLP6 "AT1G45616" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129246 RLP50 "receptor like protein 50" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046357 RLP23 "receptor like protein 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046585 RLP27 "receptor like protein 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2829370 RLP40 "receptor like protein 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046515 RLP24 "receptor like protein 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query887
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-80
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-58
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-20
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-11
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-07
PLN032101153 PLN03210, PLN03210, Resistant to P 6e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 2e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 9e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 0.002
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  280 bits (717), Expect = 1e-80
 Identities = 235/712 (33%), Positives = 339/712 (47%), Gaps = 116/712 (16%)

Query: 2   GSSQCLFSIFMQLFVPLIFFNFTTATFSTASSVLRLCHDDECSALLQFKESLIINDTIEE 61
           G   C + IFM  F   +F NF             + H +E   LL FK S  IND ++ 
Sbjct: 5   GPQHCPYLIFMLFF---LFLNF------------SMLHAEELELLLSFKSS--INDPLK- 46

Query: 62  SYHYYPWSSGCRPKAASWKPEEGNIDCCSWDGVECSENTGHVMKLDLSNSCLYGSINSSS 121
             +   W+S              + D C W G+ C+ N+  V+ +DLS   + G I  SS
Sbjct: 47  --YLSNWNS--------------SADVCLWQGITCN-NSSRVVSIDLSGKNISGKI--SS 87

Query: 122 SLFKLVHLEWLNLAFNDFKSSEIPSEIINLS-RLSYLNLSHSSFFGQIPSEILELVNLVS 180
           ++F+L +++ +NL+ N   S  IP +I   S  L YLNLS+++F G IP           
Sbjct: 88  AIFRLPYIQTINLSNNQL-SGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRG--------- 137

Query: 181 LDLSLNSGYGLELQKPNFANLVEKLSNLETLDLGYVSIRSTIPHNLANLSSLTFLSLHSC 240
                                   + NLETLDL    +   IP+++ + SSL  L L   
Sbjct: 138 -----------------------SIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGN 174

Query: 241 GLQGRIQSSLGNLSKLLHLDLSLNELLGELPVSIGNLHSLKKLDLSINNLSGELPTSIQN 300
            L G+I +SL NL+ L  L L+ N+L+G++P  +G + SLK + L  NNLSGE+P  I  
Sbjct: 175 VLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGG 234

Query: 301 LVSLEELDLSFNKLSGEFPWSIVIGNFTQLQSLDFTSNKFSGELHASIGNLRSLEVLAIG 360
           L SL  LDL +N L+G  P                          +S+GNL++L+ L + 
Sbjct: 235 LTSLNHLDLVYNNLTGPIP--------------------------SSLGNLKNLQYLFLY 268

Query: 361 RCNFSGRIPSSLRNLTQLITLDLSQNSYRGTMELDFLLVSLKNLEVLSLSSNWLSLLTKV 420
           +   SG IP S+ +L +LI+LDLS NS  G  E+  L++ L+NLE+L L SN  +   K+
Sbjct: 269 QNKLSGPIPPSIFSLQKLISLDLSDNSLSG--EIPELVIQLQNLEILHLFSN--NFTGKI 324

Query: 421 TSNTTS-QKFTVVGLRSCNLI-EFPNFLKNQHHLMLLDLSSNRIHGKIPSWLLDPSTQNL 478
               TS  +  V+ L S     E P  L   ++L +LDLS+N + G+IP  L    + NL
Sbjct: 325 PVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCS--SGNL 382

Query: 479 SALNLSHNLLTGFDQQLVVLPGGKRFLLTLDLSSNNLQGPLPVPPSR--TVNYL-VSNNS 535
             L L  N L G   ++    G  R L  + L  N+  G LP   ++   V +L +SNN+
Sbjct: 383 FKLILFSNSLEG---EIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNN 439

Query: 536 FIGEIPSWLCKLDSLEILVLSHNNLSGLLPRCLGSFSDKLSILDLRANNFFGTIPNTFMK 595
             G I S    + SL++L L+ N   G LP   G  S +L  LDL  N F G +P     
Sbjct: 440 LQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFG--SKRLENLDLSRNQFSGAVPRKLGS 497

Query: 596 ESRLGMIDLSHNLFQGRIPRSLINCSKLEFLDIGDNQIRDIFPSWLGTLPNLTVLILQSN 655
            S L  + LS N   G IP  L +C KL  LD+  NQ+    P+    +P L+ L L  N
Sbjct: 498 LSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQN 557

Query: 656 KFYGIIREPRIDCGFSKLRIIDLSNNRFTGKLPSK-SFLCWNAMKIVNTSDL 706
           +  G I  P+       L  +++S+N   G LPS  +FL  NA  +    DL
Sbjct: 558 QLSGEI--PKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDL 607


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 887
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.98
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG4237498 consensus Extracellular matrix protein slit, conta 99.9
PLN032101153 Resistant to P. syringae 6; Provisional 99.89
PLN032101153 Resistant to P. syringae 6; Provisional 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
KOG0617264 consensus Ras suppressor protein (contains leucine 99.54
PLN03150623 hypothetical protein; Provisional 99.4
PLN03150623 hypothetical protein; Provisional 99.39
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.12
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.03
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.02
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.02
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.99
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.97
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.96
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.95
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.89
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.87
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.86
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.85
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.8
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.78
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.75
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.71
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.67
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.66
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.59
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.53
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.37
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.24
KOG4341483 consensus F-box protein containing LRR [General fu 98.22
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.21
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.19
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.13
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.12
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.06
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.04
KOG4341483 consensus F-box protein containing LRR [General fu 98.02
PRK15386426 type III secretion protein GogB; Provisional 97.82
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.74
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.69
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.62
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.54
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.52
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.51
PRK15386426 type III secretion protein GogB; Provisional 97.5
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.26
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.61
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.58
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.5
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.45
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.3
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.29
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.95
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.74
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.37
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.24
KOG4308478 consensus LRR-containing protein [Function unknown 93.13
KOG4308478 consensus LRR-containing protein [Function unknown 91.2
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.47
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.82
smart0037026 LRR Leucine-rich repeats, outliers. 86.82
KOG0473 326 consensus Leucine-rich repeat protein [Function un 86.8
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 86.4
KOG0473326 consensus Leucine-rich repeat protein [Function un 85.4
smart0037026 LRR Leucine-rich repeats, outliers. 83.92
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 83.92
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 82.64
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.5e-70  Score=678.90  Aligned_cols=584  Identities=36%  Similarity=0.582  Sum_probs=423.0

Q ss_pred             CHHHHHHHHHhhhcCCCCCCcccccccCCCCCCCCCCCCCCCCCCCCCCCccccceEecCCCCcEEEEEcCCCccccccc
Q 040113           39 HDDECSALLQFKESLIINDTIEESYHYYPWSSGCRPKAASWKPEEGNIDCCSWDGVECSENTGHVMKLDLSNSCLYGSIN  118 (887)
Q Consensus        39 ~~~~~~~ll~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~c~w~gv~c~~~~~~v~~L~L~~~~l~~~~~  118 (887)
                      .++|++||++||+++.++.+                .+.+|..   ..+||.|.||+|+.. ++|+.|+|+++.+.|.++
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~----------------~~~~w~~---~~~~c~w~gv~c~~~-~~v~~L~L~~~~i~~~~~   86 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLK----------------YLSNWNS---SADVCLWQGITCNNS-SRVVSIDLSGKNISGKIS   86 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcc----------------cCCCCCC---CCCCCcCcceecCCC-CcEEEEEecCCCccccCC
Confidence            35789999999999865433                5789975   578999999999864 699999999999988876


Q ss_pred             CCcccccCCCCCeEECCCCCCCCCCCCcccc-CCCCCCEEECCCCCCCccCCccccCCCCCcEEEccCCCCCCccccCCC
Q 040113          119 SSSSLFKLVHLEWLNLAFNDFKSSEIPSEII-NLSRLSYLNLSHSSFFGQIPSEILELVNLVSLDLSLNSGYGLELQKPN  197 (887)
Q Consensus       119 ~~~~l~~l~~L~~L~L~~n~~~~~~lp~~~~-~l~~L~~L~Ls~n~~~~~~p~~l~~l~~L~~L~l~~n~~~~l~~~~~~  197 (887)
                      .  .+..+++|++|+|++|++.+. +|..+. .+++|++|+|++|.+.+.+|.  +.+++|++|++++|.          
T Consensus        87 ~--~~~~l~~L~~L~Ls~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~----------  151 (968)
T PLN00113         87 S--AIFRLPYIQTINLSNNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNM----------  151 (968)
T ss_pred             h--HHhCCCCCCEEECCCCccCCc-CChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCc----------
Confidence            5  788889999999999888765 776654 888888888888888877774  345566666666554          


Q ss_pred             hHHHhhcCCCCCEEEccCCCCCCCchhhhcCCCCCCEEEcccCCCCCccccccCCCCCCcEEeCcCCCCCCcchhhccCC
Q 040113          198 FANLVEKLSNLETLDLGYVSIRSTIPHNLANLSSLTFLSLHSCGLQGRIQSSLGNLSKLLHLDLSLNELLGELPVSIGNL  277 (887)
Q Consensus       198 ~~~~~~~l~~L~~L~L~~n~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l  277 (887)
                                          +.+.+|..++.+++|++|++++|.+.+.+|..+.++++|++|++++|.+.+.+|..++++
T Consensus       152 --------------------~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l  211 (968)
T PLN00113        152 --------------------LSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQM  211 (968)
T ss_pred             --------------------ccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCc
Confidence                                444445555555555555555555555555555555566666666665555555566666


Q ss_pred             CCCCEEEccCCCCCCccchhhhCCCCCCEEEccCCcCCCCCCchhhccCCCCccEEEccCCCCCCccccccCCCCCccEE
Q 040113          278 HSLKKLDLSINNLSGELPTSIQNLVSLEELDLSFNKLSGEFPWSIVIGNFTQLQSLDFTSNKFSGELHASIGNLRSLEVL  357 (887)
Q Consensus       278 ~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L  357 (887)
                      ++|++|++++|.+.+.+|..++++++|++|++++|.+.+.+|..  ++++++|+.|++++|.+.+.+|..+..+++|++|
T Consensus       212 ~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~--l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L  289 (968)
T PLN00113        212 KSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSS--LGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISL  289 (968)
T ss_pred             CCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChh--HhCCCCCCEEECcCCeeeccCchhHhhccCcCEE
Confidence            66666666666666556666666666666666666666555555  5566666666666666666666666666666666


Q ss_pred             EccCCcCCccCCccccCCCCCCEEEcCCCCCccccchhhhhcCCCCCCEEEccCCcccccccccCCCCCCCeeEEeeCCC
Q 040113          358 AIGRCNFSGRIPSSLRNLTQLITLDLSQNSYRGTMELDFLLVSLKNLEVLSLSSNWLSLLTKVTSNTTSQKFTVVGLRSC  437 (887)
Q Consensus       358 ~L~~n~i~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~l~~l~~L~~L~L~~n~i~~~~~~~~~~~~~~L~~l~l~~~  437 (887)
                      ++++|.+.+.+|..+..+++|++|++++|.+.+..+..                                          
T Consensus       290 ~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~------------------------------------------  327 (968)
T PLN00113        290 DLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVA------------------------------------------  327 (968)
T ss_pred             ECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChh------------------------------------------
Confidence            66666666666666667777777777777665443322                                          


Q ss_pred             CCcccChhhhcCCcccEEecccCcccCCCCccccccCCCCCcEEEccCCcccCccccccccCCccccccEEeCCCccccc
Q 040113          438 NLIEFPNFLKNQHHLMLLDLSSNRIHGKIPSWLLDPSTQNLSALNLSHNLLTGFDQQLVVLPGGKRFLLTLDLSSNNLQG  517 (887)
Q Consensus       438 ~l~~~~~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~~~~~~~L~~L~ls~n~l~~  517 (887)
                              +..+++|+.|++++|.+.+.+|..                                                
T Consensus       328 --------~~~l~~L~~L~L~~n~l~~~~p~~------------------------------------------------  351 (968)
T PLN00113        328 --------LTSLPRLQVLQLWSNKFSGEIPKN------------------------------------------------  351 (968)
T ss_pred             --------HhcCCCCCEEECcCCCCcCcCChH------------------------------------------------
Confidence                    223333444444444433333322                                                


Q ss_pred             CCCCCCCCCcEEEccCccccccCChhhhCcCCCCeEEcCCCccCCCCCCcccccCCcceEEecCCCcccccCCccccCCC
Q 040113          518 PLPVPPSRTVNYLVSNNSFIGEIPSWLCKLDSLEILVLSHNNLSGLLPRCLGSFSDKLSILDLRANNFFGTIPNTFMKES  597 (887)
Q Consensus       518 ~~~~~~~~l~~l~l~~n~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~~~~~~l~  597 (887)
                                                +..+++|+.|++++|.+++.+|..+.... +|+.|++++|++.+.+|..+..++
T Consensus       352 --------------------------l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~-~L~~L~l~~n~l~~~~p~~~~~~~  404 (968)
T PLN00113        352 --------------------------LGKHNNLTVLDLSTNNLTGEIPEGLCSSG-NLFKLILFSNSLEGEIPKSLGACR  404 (968)
T ss_pred             --------------------------HhCCCCCcEEECCCCeeEeeCChhHhCcC-CCCEEECcCCEecccCCHHHhCCC
Confidence                                      33344455555555555555555555544 466666666666666666666666


Q ss_pred             cccEEEccCCeeeeeCCccccCCCCCcEEeCCCCcCCCCCCccccCCCCCCEEEccCCcccccCCCCccccCCCCCCEEE
Q 040113          598 RLGMIDLSHNLFQGRIPRSLINCSKLEFLDIGDNQIRDIFPSWLGTLPNLTVLILQSNKFYGIIREPRIDCGFSKLRIID  677 (887)
Q Consensus       598 ~L~~L~Ls~N~l~~~~~~~l~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~~~l~~L~~L~  677 (887)
                      +|+.|++++|++++..|..+.+++.|+.|++++|++++.+|..+..+++|+.|++++|++.+.+|...   ..++|+.|+
T Consensus       405 ~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~---~~~~L~~L~  481 (968)
T PLN00113        405 SLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF---GSKRLENLD  481 (968)
T ss_pred             CCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc---ccccceEEE
Confidence            77777777777777777777777777777777777777777777777778888888887777766543   357889999


Q ss_pred             cCCCcCcccCChhhhhccccchhcccCCccccccccCCccccccccccccccceeeeeccccccccccCCceeEEEeecC
Q 040113          678 LSNNRFTGKLPSKSFLCWNAMKIVNTSDLKYLQDVISPKEWLLSDEVATYDYSLKMNNKGQIMTYDKVPDILTSIILSSN  757 (887)
Q Consensus       678 Ls~N~l~~~ip~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~N  757 (887)
                      +++|++++.+|.. +..                                                   .+.|+.|+|++|
T Consensus       482 ls~n~l~~~~~~~-~~~---------------------------------------------------l~~L~~L~Ls~N  509 (968)
T PLN00113        482 LSRNQFSGAVPRK-LGS---------------------------------------------------LSELMQLKLSEN  509 (968)
T ss_pred             CcCCccCCccChh-hhh---------------------------------------------------hhccCEEECcCC
Confidence            9999998888754 111                                                   356889999999


Q ss_pred             cCCccChhhhhcccCCCEEeCCCCcccccCCccccCCCCCCEEeCCCCcccccCCccccCCCCCCeeecccCcccccCCC
Q 040113          758 RFDGMIPTSIANLKGLQVLNLDNNNLQGHIPSCLGNLTNLESLDLSNNNFLGQIPQQLVELTFLEFFNVSDNYLTGPIPQ  837 (887)
Q Consensus       758 ~l~~~ip~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~L~~L~~L~Ls~N~l~~~~p~~l~~L~~L~~L~ls~N~l~g~iP~  837 (887)
                      ++++.+|..++++++|++|+|++|.+++.+|..|+++++|+.|||++|+++|.+|..+..+++|++|++++|+++|.+|.
T Consensus       510 ~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~  589 (968)
T PLN00113        510 KLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPS  589 (968)
T ss_pred             cceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcCccccccccCCCcCCCCCC
Q 040113          838 GRQFATFDNSSFESNSGLCGRP  859 (887)
Q Consensus       838 ~~~~~~~~~~~~~~n~~lcg~~  859 (887)
                      .++|.++...+|.||+++||.+
T Consensus       590 ~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        590 TGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             cchhcccChhhhcCCccccCCc
Confidence            9999999999999999999865



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query887
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-49
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-48
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-13
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 195 bits (495), Expect = 1e-49, Method: Compositional matrix adjust. Identities = 198/652 (30%), Positives = 281/652 (43%), Gaps = 114/652 (17%) Query: 272 VSIGNLHSLKKLDLSINNLSGELPTSIQNLVSLEELDLSFNKLSGEFPWSIVIGNFTQLQ 331 V + +L+ LD+S NN S +P + + +L+ LD+S NKLSG+F S I T+L+ Sbjct: 191 VDVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDF--SRAISTCTELK 247 Query: 332 SLDFTSNKFSGELHASIGNLRSLEVLAIGRCNFSGRIPSSLRNLTQLIT-LDLSQNSYRG 390 L+ +SN+F G + L+SL+ L++ F+G IP L +T LDLS N + G Sbjct: 248 LLNISSNQFVGPIPPLP--LKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYG 305 Query: 391 TMELDFLLVSLKNXXXXXXXXXXXXXXTKVTSNTTSQKFTVVGLRSCNLIEFP-NFLKNQ 449 + F + +S F+ E P + L Sbjct: 306 AVPPFF-----------------GSCSLLESLALSSNNFSG---------ELPMDTLLKM 339 Query: 450 HHLMLLDLSSNRIHGKIPSWLLDPSTQXXXXXXXXXXXXTGFDQQLVVLPGGKRFLLTLD 509 L +LDLS N G++P L + S LLTLD Sbjct: 340 RGLKVLDLSFNEFSGELPESLTNLSAS----------------------------LLTLD 371 Query: 510 LSSNNLQGPLPVP-----PSRTVNYL-VSNNSFIGEIPSWLCKLDSLEILVLSHNNLSGL 563 LSSNN GP+ +P P T+ L + NN F G+IP L L L LS N LSG Sbjct: 372 LSSNNFSGPI-LPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGT 430 Query: 564 LPRCLGSFSDKLSILDLRANNFFGTIPNTFMKESRLGMIDLSHNLFQGRIPRSLINCSKL 623 +P LGS S KL L L N G IP M L + L N G IP L NC+ L Sbjct: 431 IPSSLGSLS-KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNL 489 Query: 624 EFLDIGDNQIRDIFPSWLGTLPNLTVLILQSNKFYGIIREPRIDCGFSKLRIIDLSNNRF 683 ++ + +N++ P W+G L NL +L L +N F G I DC L +DL+ N F Sbjct: 490 NWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDC--RSLIWLDLNTNLF 547 Query: 684 TGKLPSKSFL--------------------------CWNAMKIVNTSDLK--YLQDVISP 715 G +P+ F C A ++ ++ L + + Sbjct: 548 NGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTR 607 Query: 716 KEWLLSDEVATYDYSLKMNNKGQIMTYDKVPDILTSIILSSNRFDGMIPTSIANLKGXXX 775 ++ V S +N G +M D +S N G IP I ++ Sbjct: 608 NPCNITSRVYGGHTSPTFDNNGSMMFLD----------MSYNMLSGYIPKEIGSMPYLFI 657 Query: 776 XXXXXXXXXGHIPSCLGNLTNLESLDLSNNNFLGQIPQQLVELTFLEFFNVSDNYLTGPI 835 G IP +G+L L LDLS+N G+IPQ + LT L ++S+N L+GPI Sbjct: 658 LNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPI 717 Query: 836 PQGRQFATFDNSSFESNSGLCGRPLSRECESDEAPTNEDHSKGAEESIFRRI 887 P+ QF TF + F +N GLCG PL R C+ P+N D + S RR+ Sbjct: 718 PEMGQFETFPPAKFLNNPGLCGYPLPR-CD----PSNADGYAHHQRSHGRRL 764
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query887
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 0.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-98
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-85
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-79
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-77
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-66
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-60
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-44
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-39
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-18
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-76
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-74
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-67
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-66
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-57
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-47
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-38
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-71
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-63
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-47
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-37
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-20
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-19
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-66
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-65
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-59
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-56
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-49
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-29
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-24
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-11
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-63
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-57
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-56
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-41
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-16
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-61
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-60
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-60
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-45
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-35
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-30
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-52
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-43
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-43
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-24
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-49
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-46
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-45
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-41
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-42
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-38
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-30
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-39
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-38
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-35
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-31
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-24
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-18
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-39
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-32
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-18
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-13
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-38
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-36
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-34
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-32
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-20
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-33
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-26
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-21
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-31
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-28
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-16
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-30
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-30
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-18
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-08
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-30
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-27
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-30
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-28
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-27
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-26
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-24
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 8e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-26
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-25
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-25
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-25
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-21
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-14
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-26
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-24
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-24
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-21
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-15
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-26
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-17
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-07
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-08
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-26
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-26
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-13
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-10
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-23
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-18
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-18
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-18
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-10
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 8e-20
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-19
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-12
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-15
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-15
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-19
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-06
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 5e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-19
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-08
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-07
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 6e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-11
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-07
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 6e-08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 8e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  584 bits (1509), Expect = 0.0
 Identities = 234/875 (26%), Positives = 347/875 (39%), Gaps = 141/875 (16%)

Query: 27  TFSTASSVLRLCHDDECSALLQFKESLIINDTIEESYHYYPWSSGCRPKAASWKPEEGNI 86
           +F  + S        E   L+ FK+ L   +                     W     N 
Sbjct: 1   SFQASPS---QSLYREIHQLISFKDVLPDKN-----------------LLPDWSS---NK 37

Query: 87  DCCSWDGVECSENTGHVMKLDLSNSCLYGSINS-SSSLFKLVHLEWLNLAFNDFKSSEIP 145
           + C++DGV C      V  +DLS+  L    ++ SSSL  L  LE L L+ +   +  + 
Sbjct: 38  NPCTFDGVTC--RDDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHI-NGSVS 94

Query: 146 SEIINLSRLSYLNLSHSSFFGQIPS--EILELVNLVSLDLSLNSGYGLELQKPNFANLVE 203
                 + L+ L+LS +S  G + +   +     L  L++S N+     L  P   +   
Sbjct: 95  -GFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNT-----LDFPGKVSGGL 148

Query: 204 KLSNLETLDLGYVSIRSTIPHNLA---NLSSLTFLSLHSCGLQGRIQSSLGNLSKLLHLD 260
           KL++LE LDL   SI                L  L++    + G +   +     L  LD
Sbjct: 149 KLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDV--DVSRCVNLEFLD 206

Query: 261 LSLNELLGELPVSIGNLHSLKKLDLSINNLSGELPTSIQNLVSLEELDLSFNKLSGEFPW 320
           +S N     +P  +G+  +L+ LD+S N LSG+   +I     L+ L++S N+  G  P 
Sbjct: 207 VSSNNFSTGIP-FLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPP 265

Query: 321 SIVIGNFTQLQSLDFTSNKFSGELHASI-GNLRSLEVLAIGRCNFSGRIPSSLRNLTQLI 379
                    LQ L    NKF+GE+   + G   +L  L +   +F G +P    + + L 
Sbjct: 266 L----PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLE 321

Query: 380 TLDLSQNSYRGTMELDFLLVSLKNLEVLSLSSNWLSLLTKVTSNTTSQKFTVVGLRSCNL 439
           +L LS N++ G + +D LL  ++ L+VL LS N  S                 G      
Sbjct: 322 SLALSSNNFSGELPMDTLL-KMRGLKVLDLSFNEFS-----------------G------ 357

Query: 440 IEFPNFLKN-QHHLMLLDLSSNRIHGKIPSWLLDPSTQNLSALNLSHNLLTGFDQQLVVL 498
            E P  L N    L+ LDLSSN   G I   L       L  L L +N  TG        
Sbjct: 358 -ELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTG-------- 408

Query: 499 PGGKRFLLTLDLSSNNLQGPLPVPPSRTVNYLVSNNSFIGEIPSWLCKLDSLEILVLSHN 558
                                                   +IP  L     L  L LS N
Sbjct: 409 ----------------------------------------KIPPTLSNCSELVSLHLSFN 428

Query: 559 NLSGLLPRCLGSFSDKLSILDLRANNFFGTIPNTFMKESRLGMIDLSHNLFQGRIPRSLI 618
            LSG +P  LGS S KL  L L  N   G IP   M    L  + L  N   G IP  L 
Sbjct: 429 YLSGTIPSSLGSLS-KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLS 487

Query: 619 NCSKLEFLDIGDNQIRDIFPSWLGTLPNLTVLILQSNKFYGIIREPRIDCGFSKLRIIDL 678
           NC+ L ++ + +N++    P W+G L NL +L L +N F G I  P        L  +DL
Sbjct: 488 NCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNI--PAELGDCRSLIWLDL 545

Query: 679 SNNRFTGKLPSKSFLCWNAMKIVNTSDLKYLQDVISPKEWLLSDEVATYDYS-------- 730
           + N F G +P+  F     +     +  +Y+       +          ++         
Sbjct: 546 NTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLN 605

Query: 731 ---------LKMNN-KGQIMTYDKVPDILTSIILSSNRFDGMIPTSIANLKGLQVLNLDN 780
                    +      G           +  + +S N   G IP  I ++  L +LNL +
Sbjct: 606 RLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGH 665

Query: 781 NNLQGHIPSCLGNLTNLESLDLSNNNFLGQIPQQLVELTFLEFFNVSDNYLTGPIPQGRQ 840
           N++ G IP  +G+L  L  LDLS+N   G+IPQ +  LT L   ++S+N L+GPIP+  Q
Sbjct: 666 NDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQ 725

Query: 841 FATFDNSSFESNSGLCGRPLSRECESDEAPTNEDH 875
           F TF  + F +N GLCG PL R   S+        
Sbjct: 726 FETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQ 760


>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query887
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.84
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.83
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.72
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.72
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.71
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.71
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.71
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.71
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.7
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.7
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.68
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.68
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.67
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.66
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.66
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.66
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.66
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.65
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.64
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.55
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.52
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.51
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.51
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.51
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.51
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.51
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.49
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.45
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.44
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.39
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.39
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.39
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.36
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.35
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.35
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.34
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.33
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.32
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.31
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.29
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.27
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.15
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.11
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.03
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.02
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.97
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.72
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.66
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.6
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.54
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.48
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.39
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.26
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.24
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.79
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.65
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.17
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.68
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.61
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.27
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=5.6e-89  Score=824.95  Aligned_cols=718  Identities=31%  Similarity=0.415  Sum_probs=562.0

Q ss_pred             CCHHHHHHHHHhhhcCCCCCCcccccccCCCCCCCCCCCCCCCCCCCCCCCccccceEecCCCCcEEEEEcCCCccccc-
Q 040113           38 CHDDECSALLQFKESLIINDTIEESYHYYPWSSGCRPKAASWKPEEGNIDCCSWDGVECSENTGHVMKLDLSNSCLYGS-  116 (887)
Q Consensus        38 ~~~~~~~~ll~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~c~w~gv~c~~~~~~v~~L~L~~~~l~~~-  116 (887)
                      +.++|++||++||+++.++.                 .+++|+.   +.+||+|+||+|+  .++|++|+|+++.+.|. 
T Consensus         9 ~~~~~~~all~~k~~~~~~~-----------------~l~~W~~---~~~~C~w~gv~C~--~~~v~~L~L~~~~l~g~~   66 (768)
T 3rgz_A            9 SLYREIHQLISFKDVLPDKN-----------------LLPDWSS---NKNPCTFDGVTCR--DDKVTSIDLSSKPLNVGF   66 (768)
T ss_dssp             CHHHHHHHHHHHHTTCSCTT-----------------SSTTCCT---TSCGGGSTTEEEE--TTEEEEEECTTSCCCEEH
T ss_pred             CCHHHHHHHHHHHhhCCCcc-----------------cccCCCC---CCCCcCCcceEEC--CCcEEEEECCCCCcCCcc
Confidence            35789999999999997432                 5889985   6799999999998  58999999999999987 


Q ss_pred             --ccCCcccccCCCCCeEECCCCCCCCCCCCccccCCCCCCEEECCCCCCCccCCc--cccCCCCCcEEEccCCCCCCcc
Q 040113          117 --INSSSSLFKLVHLEWLNLAFNDFKSSEIPSEIINLSRLSYLNLSHSSFFGQIPS--EILELVNLVSLDLSLNSGYGLE  192 (887)
Q Consensus       117 --~~~~~~l~~l~~L~~L~L~~n~~~~~~lp~~~~~l~~L~~L~Ls~n~~~~~~p~--~l~~l~~L~~L~l~~n~~~~l~  192 (887)
                        +++  .+.++++|++++++.+.+..  +|+.|+++++|++|+|++|.+.|.+|.  .++++++|++|++++|.+.   
T Consensus        67 ~~l~~--~l~~L~~L~~l~~~~~~~~~--l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~---  139 (768)
T 3rgz_A           67 SAVSS--SLLSLTGLESLFLSNSHING--SVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLD---  139 (768)
T ss_dssp             HHHHH--HTTTCTTCCEEECTTSCEEE--CCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEE---
T ss_pred             CccCh--hHhccCcccccCCcCCCcCC--CchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccC---
Confidence              765  89999999999999998753  678899999999999999999999998  9999999999999999732   


Q ss_pred             ccCCChHHH-hhcCCCCCEEEccCCCCCCCchhh---hcCCCCCCEEEcccCCCCCccccccCCCCCCcEEeCcCCCCCC
Q 040113          193 LQKPNFANL-VEKLSNLETLDLGYVSIRSTIPHN---LANLSSLTFLSLHSCGLQGRIQSSLGNLSKLLHLDLSLNELLG  268 (887)
Q Consensus       193 ~~~~~~~~~-~~~l~~L~~L~L~~n~~~~~~~~~---l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~  268 (887)
                         +.+|.. +.++++|++|++++|.+++..+..   +.++++|++|++++|.+.+..+.  ..+++|++|++++|.+.+
T Consensus       140 ---~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~--~~l~~L~~L~Ls~n~l~~  214 (768)
T 3rgz_A          140 ---FPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDV--SRCVNLEFLDVSSNNFST  214 (768)
T ss_dssp             ---CCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBC--TTCTTCCEEECCSSCCCS
T ss_pred             ---CcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCCc--ccCCcCCEEECcCCcCCC
Confidence               223333 378999999999999999988877   88999999999999999876653  889999999999999998


Q ss_pred             cchhhccCCCCCCEEEccCCCCCCccchhhhCCCCCCEEEccCCcCCCCCCchhhccCCCCccEEEccCCCCCCcccccc
Q 040113          269 ELPVSIGNLHSLKKLDLSINNLSGELPTSIQNLVSLEELDLSFNKLSGEFPWSIVIGNFTQLQSLDFTSNKFSGELHASI  348 (887)
Q Consensus       269 ~~p~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l  348 (887)
                      .+|. ++++++|++|++++|.+++.+|..++.+++|++|++++|++++.+|..    .+++|++|++++|.+++.+|..+
T Consensus       215 ~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~----~l~~L~~L~L~~n~l~~~ip~~~  289 (768)
T 3rgz_A          215 GIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL----PLKSLQYLSLAENKFTGEIPDFL  289 (768)
T ss_dssp             CCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC----CCTTCCEEECCSSEEEESCCCCS
T ss_pred             CCcc-cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc----ccCCCCEEECcCCccCCccCHHH
Confidence            8887 999999999999999999999999999999999999999999888743    78999999999999999999988


Q ss_pred             CCC-CCccEEEccCCcCCccCCccccCCCCCCEEEcCCCCCccccchhhhhcCCCCCCEEEccCCcccccccccCCCCCC
Q 040113          349 GNL-RSLEVLAIGRCNFSGRIPSSLRNLTQLITLDLSQNSYRGTMELDFLLVSLKNLEVLSLSSNWLSLLTKVTSNTTSQ  427 (887)
Q Consensus       349 ~~l-~~L~~L~L~~n~i~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~l~~l~~L~~L~L~~n~i~~~~~~~~~~~~~  427 (887)
                      ... ++|++|++++|.+++.+|..++.+++|++|++++|.+.+..+.. .+..+++|++|++++|.+..           
T Consensus       290 ~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~-~l~~l~~L~~L~Ls~n~l~~-----------  357 (768)
T 3rgz_A          290 SGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMD-TLLKMRGLKVLDLSFNEFSG-----------  357 (768)
T ss_dssp             CTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHH-HHTTCTTCCEEECCSSEEEE-----------
T ss_pred             HhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHH-HHhcCCCCCEEeCcCCccCc-----------
Confidence            775 99999999999999999999999999999999999998777754 37788889999888885431           


Q ss_pred             CeeEEeeCCCCCcccChhhhcCC-cccEEecccCcccCCCCccccccCCCCCcEEEccCCcccCccccccccCCcccccc
Q 040113          428 KFTVVGLRSCNLIEFPNFLKNQH-HLMLLDLSSNRIHGKIPSWLLDPSTQNLSALNLSHNLLTGFDQQLVVLPGGKRFLL  506 (887)
Q Consensus       428 ~L~~l~l~~~~l~~~~~~l~~~~-~L~~L~Ls~n~l~~~~p~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~~~~~~~L~  506 (887)
                                   .+|..+..++ +|+.|++++|.+++.+|..+....+++|++|++++|.+++..+..+.   .     
T Consensus       358 -------------~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~---~-----  416 (768)
T 3rgz_A          358 -------------ELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLS---N-----  416 (768)
T ss_dssp             -------------CCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGG---G-----
T ss_pred             -------------cccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHh---c-----
Confidence                         3455666665 78888888888887777766554456677777777776654433221   1     


Q ss_pred             EEeCCCcccccCCCCCCCCCcEEEccCccccccCChhhhCcCCCCeEEcCCCccCCCCCCcccccCCcceEEecCCCccc
Q 040113          507 TLDLSSNNLQGPLPVPPSRTVNYLVSNNSFIGEIPSWLCKLDSLEILVLSHNNLSGLLPRCLGSFSDKLSILDLRANNFF  586 (887)
Q Consensus       507 ~L~ls~n~l~~~~~~~~~~l~~l~l~~n~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~L~~N~l~  586 (887)
                                      .++++++++++|++.+.+|..++.+++|++|++++|.+++.+|..+..++ +|++|++++|+++
T Consensus       417 ----------------l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~-~L~~L~L~~N~l~  479 (768)
T 3rgz_A          417 ----------------CSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK-TLETLILDFNDLT  479 (768)
T ss_dssp             ----------------CTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCT-TCCEEECCSSCCC
T ss_pred             ----------------CCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCC-CceEEEecCCccc
Confidence                            23444555555555556666667777777777777777777777776666 5777777777777


Q ss_pred             ccCCccccCCCcccEEEccCCeeeeeCCccccCCCCCcEEeCCCCcCCCCCCccccCCCCCCEEEccCCcccccCCCCcc
Q 040113          587 GTIPNTFMKESRLGMIDLSHNLFQGRIPRSLINCSKLEFLDIGDNQIRDIFPSWLGTLPNLTVLILQSNKFYGIIREPRI  666 (887)
Q Consensus       587 ~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~l~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~  666 (887)
                      +.+|..+..+++|++|++++|++++.+|..+..+++|++|+|++|++++.+|..++.+++|++|++++|+++|.+|... 
T Consensus       480 ~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~-  558 (768)
T 3rgz_A          480 GEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAM-  558 (768)
T ss_dssp             SCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGG-
T ss_pred             CcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHH-
Confidence            7777777777777777777777777777777777777777777777777777777777777777777777776666544 


Q ss_pred             ccCCCCCCEEEcC---------CCcC-------------cccCChhhhhccccchhcccCCccccccccCCccccccccc
Q 040113          667 DCGFSKLRIIDLS---------NNRF-------------TGKLPSKSFLCWNAMKIVNTSDLKYLQDVISPKEWLLSDEV  724 (887)
Q Consensus       667 ~~~l~~L~~L~Ls---------~N~l-------------~~~ip~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~  724 (887)
                       .....+..+++.         ++..             .+..|.. +..+..+...+...                   
T Consensus       559 -~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~l~~~~~~~l~~-------------------  617 (768)
T 3rgz_A          559 -FKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQ-LNRLSTRNPCNITS-------------------  617 (768)
T ss_dssp             -GTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGG-GGGGGGTCCSCTTS-------------------
T ss_pred             -hcccchhhhhccccccccccccccccccccccccccccccccchh-hhcccccccccccc-------------------
Confidence             222222222222         1111             1111111 11111100000000                   


Q ss_pred             cccccceeeeeccccccccccCCceeEEEeecCcCCccChhhhhcccCCCEEeCCCCcccccCCccccCCCCCCEEeCCC
Q 040113          725 ATYDYSLKMNNKGQIMTYDKVPDILTSIILSSNRFDGMIPTSIANLKGLQVLNLDNNNLQGHIPSCLGNLTNLESLDLSN  804 (887)
Q Consensus       725 ~~~~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~N~l~~~ip~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~L~~L~~L~Ls~  804 (887)
                              ....|.........+.|+.|||++|+++|.+|.+++++++|+.|+|++|+++|.+|..|+++++|++|||++
T Consensus       618 --------~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~  689 (768)
T 3rgz_A          618 --------RVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSS  689 (768)
T ss_dssp             --------CEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCS
T ss_pred             --------ceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCC
Confidence                    000111111122357799999999999999999999999999999999999999999999999999999999


Q ss_pred             CcccccCCccccCCCCCCeeecccCcccccCCCCCcCccccccccCCCcCCCCCCCCCCCCCCCCCCCCCC
Q 040113          805 NNFLGQIPQQLVELTFLEFFNVSDNYLTGPIPQGRQFATFDNSSFESNSGLCGRPLSRECESDEAPTNEDH  875 (887)
Q Consensus       805 N~l~~~~p~~l~~L~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~~n~~lcg~~~~~~c~~~~~~~~~~~  875 (887)
                      |+++|.+|..++++++|++||+++|+|+|.||+++||.+|+..+|.||++|||.|+. .|....+...+..
T Consensus       690 N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~~~~~~~~~  759 (768)
T 3rgz_A          690 NKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDPSNADGYAHH  759 (768)
T ss_dssp             SCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCSCC-------
T ss_pred             CcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-CCCCCccCCCCCC
Confidence            999999999999999999999999999999999999999999999999999999987 8987666655443



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 887
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-21
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-17
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.003
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-10
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-04
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-07
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 8e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.004
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 8e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.001
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 93.3 bits (230), Expect = 3e-21
 Identities = 81/325 (24%), Positives = 121/325 (37%), Gaps = 44/325 (13%)

Query: 37  LCHDDECSALLQFKESLIINDTIEESYHYYPWSSGCRPKAASWKPEEGNIDCC--SWDGV 94
           LC+  +  ALLQ K+ L    T+                 +SW P     DCC  +W GV
Sbjct: 2   LCNPQDKQALLQIKKDLGNPTTL-----------------SSWLP---TTDCCNRTWLGV 41

Query: 95  ECSENTG--HVMKLDLSNSCLYGSINSSSSLFKLVHLEWLNLAFNDFKSSEIPSEIINLS 152
            C  +T    V  LDLS   L       SSL  L +L +L +   +     IP  I  L+
Sbjct: 42  LCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLT 101

Query: 153 RLSYLNLSHSSFFGQIPSEILELVNLVSLDLSLNSGYGLELQKPNFANLVEKLSNLETLD 212
           +L YL ++H++  G IP  + ++  LV+LD S N+  G      +    +  ++      
Sbjct: 102 QLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRI 161

Query: 213 LGYVSIRSTIPHNLANLSSLTFLSLH-----------------SCGLQGRIQSSLGNLSK 255
            G +         L    +++   L                  S  +     S L    K
Sbjct: 162 SGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDK 221

Query: 256 LLHLDLSLNELLGELPVSIGNLHSLKKLDLSINNLSGELPTSIQNLVSLEELDLSFNKLS 315
                      L      +G   +L  LDL  N + G LP  +  L  L  L++SFN L 
Sbjct: 222 NTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLC 281

Query: 316 GEFPWSIVIGNFTQLQSLDFTSNKF 340
           GE P     GN  +     + +NK 
Sbjct: 282 GEIPQ---GGNLQRFDVSAYANNKC 303


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query887
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.82
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.75
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.61
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.6
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.54
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.5
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.43
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.43
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.36
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.34
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.34
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.28
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.1
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.09
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.04
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.03
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.1
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.95
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.69
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.44
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.04
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.69
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=1.5e-38  Score=339.78  Aligned_cols=295  Identities=32%  Similarity=0.505  Sum_probs=189.8

Q ss_pred             CCCHHHHHHHHHhhhcCCCCCCcccccccCCCCCCCCCCCCCCCCCCCCCCCcc--ccceEecCC--CCcEEEEEcCCCc
Q 040113           37 LCHDDECSALLQFKESLIINDTIEESYHYYPWSSGCRPKAASWKPEEGNIDCCS--WDGVECSEN--TGHVMKLDLSNSC  112 (887)
Q Consensus        37 ~~~~~~~~~ll~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~c~--w~gv~c~~~--~~~v~~L~L~~~~  112 (887)
                      .|.++||+||++||+++.++.                 .+++|..   +.|||.  |.||+|+..  .+||++|+|+++.
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~-----------------~l~sW~~---~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~   61 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT-----------------TLSSWLP---TTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLN   61 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-----------------GGTTCCT---TSCTTTTCSTTEEECCSSSCCCEEEEEEECCC
T ss_pred             CCCHHHHHHHHHHHHHCCCCC-----------------cCCCCCC---CCCCCCCcCCCeEEeCCCCcEEEEEEECCCCC
Confidence            499999999999999997653                 5889986   679995  999999865  3489999999999


Q ss_pred             ccccccCCcccccCCCCCeEECCC-CCCCCCCCCccccCCCCCCEEECCCCCCCccCCccccCCCCCcEEEccCCCCCCc
Q 040113          113 LYGSINSSSSLFKLVHLEWLNLAF-NDFKSSEIPSEIINLSRLSYLNLSHSSFFGQIPSEILELVNLVSLDLSLNSGYGL  191 (887)
Q Consensus       113 l~~~~~~~~~l~~l~~L~~L~L~~-n~~~~~~lp~~~~~l~~L~~L~Ls~n~~~~~~p~~l~~l~~L~~L~l~~n~~~~l  191 (887)
                      +.|..+-+.+++++++|++|+|++ |++.+. +|+.|+++++|++|+|++|++.+..|..+..+.+|++++++.|     
T Consensus        62 l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N-----  135 (313)
T d1ogqa_          62 LPKPYPIPSSLANLPYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYN-----  135 (313)
T ss_dssp             CSSCEECCGGGGGCTTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSS-----
T ss_pred             CCCCCCCChHHhcCccccccccccccccccc-cccccccccccchhhhccccccccccccccchhhhcccccccc-----
Confidence            887532222566666666666654 455543 5656666666666666666655555555555555555555544     


Q ss_pred             cccCCChHHHhhcCCCCCEEEccCCCCCCCchhhhcCCCCCCEEEcccCCCCCccccccCCCCCC-cEEeCcCCCCCCcc
Q 040113          192 ELQKPNFANLVEKLSNLETLDLGYVSIRSTIPHNLANLSSLTFLSLHSCGLQGRIQSSLGNLSKL-LHLDLSLNELLGEL  270 (887)
Q Consensus       192 ~~~~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L-~~L~Ls~n~l~~~~  270 (887)
                                               .+.+.+|..+++++.|+++++++|.+.+.+|..+..+..+ +.+++++|++++..
T Consensus       136 -------------------------~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~  190 (313)
T d1ogqa_         136 -------------------------ALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKI  190 (313)
T ss_dssp             -------------------------EEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEEC
T ss_pred             -------------------------cccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccc
Confidence                                     4445555556666666666666666665566555555554 55666666666555


Q ss_pred             hhhccCCCCCCEEEccCCCCCCccchhhhCCCCCCEEEccCCcCCCCCCchhhccCCCCccEEEccCCCCCCccccccCC
Q 040113          271 PVSIGNLHSLKKLDLSINNLSGELPTSIQNLVSLEELDLSFNKLSGEFPWSIVIGNFTQLQSLDFTSNKFSGELHASIGN  350 (887)
Q Consensus       271 p~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~  350 (887)
                      |..+..+..+ ++++..+...+.+|..+..+++|+.+++++|.+.+.++ .  ++.+++|+.|++++|+++|.+|..+++
T Consensus       191 ~~~~~~l~~~-~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~--~~~~~~L~~L~Ls~N~l~g~iP~~l~~  266 (313)
T d1ogqa_         191 PPTFANLNLA-FVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-K--VGLSKNLNGLDLRNNRIYGTLPQGLTQ  266 (313)
T ss_dssp             CGGGGGCCCS-EEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-G--CCCCTTCCEEECCSSCCEECCCGGGGG
T ss_pred             cccccccccc-cccccccccccccccccccccccccccccccccccccc-c--cccccccccccCccCeecccCChHHhC
Confidence            5555554333 56666666666666666666666666666666655443 2  455666666666666666666666666


Q ss_pred             CCCccEEEccCCcCCccCCccccCCCCCCEEEcCCCC
Q 040113          351 LRSLEVLAIGRCNFSGRIPSSLRNLTQLITLDLSQNS  387 (887)
Q Consensus       351 l~~L~~L~L~~n~i~~~~~~~l~~l~~L~~L~L~~n~  387 (887)
                      +++|++|+|++|+++|.+|. ++++++|+.+++++|+
T Consensus       267 L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         267 LKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNK  302 (313)
T ss_dssp             CTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSS
T ss_pred             CCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCc
Confidence            66666666666666666653 4556666666666665



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure