Citrus Sinensis ID: 040129

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330---

RLATNVTKDHIHDAIIRKLDVKSLADSSSNTIRLADCGCAVGPNTFNAMQDLIEIVKHKYKSQCPNSQNPEFHVSFNDQSSNDFNTLFTSLPQEIHFFVAGVPGSFHKRLFPEKFLHLVHVSYALHWLSKVPEGLLDKNSPAWNKGRIHYAFAPEVVVKAYANQFAKDLERFLNNRAKEIVPGGMIIITNPSIPDGMPFSEIANGLMYNCMGTILYDMVKVGLLSEAQVDSFNLPIYACPPGEFGAVVERNGNFRIEVMGLTNPSPWLKGRINMPEYIKHVRAATESMFNKHFSYEVTEEMFRQLLERLEEINDKMVSCYRDGVQLFAVLQRL

cHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEccccccccHHHHHHHHHHHHHHHHHcccccccccEEEEEcccccccHHHHHHccccccccEEEEEccccccccccccEEEEEEEEEHHHHccccccccccccccccccccEEEcccHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHccccccccccHHHHHHHHHHcccEEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEc

cHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccccHHHHHHHccccccEEEEEccccccccccccccEEEEEcHHHHHHHHccccccccccccccccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccHHHHHHHHHHHHHHHcccccHHHHcccccccccccHHHHHHHHHHcccEEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEc

RLATNVTKDHIHDAIIRKLDVksladsssntirladcgcavgpntFNAMQDLIEIVKHKyksqcpnsqnpefhvsfndqssndfntlftslpqEIHFFvagvpgsfhkrlfpekFLHLVHVSYALHWLskvpeglldknspawnkgrihyafAPEVVVKAYANQFAKDLERFLNNRakeivpggmiiitnpsipdgmpfseianglmyncMGTILYDMVKVGLLSeaqvdsfnlpiyacppgefgavverNGNFRIEVmgltnpspwlkgrinmpeYIKHVRAATESMFNKHFSYEVTEEMFRQLLERLEEINDKMVSCYRDGVQLFAVLQRL

rlatnvtkdhihdaiirkldvksLADSSSNTIRLADCGCAVGPNTFNAMQDLIEIVKHKYKSQCPNSQNPEFHVSFNDQSSNDFNTLFTSLPQEIHFFVAGVPGSFHKRLFPEKFLHLVHVSYALHWLSKVPEGLLDKNSPAWNKGRIHYAFAPEVVVKAYANQFAKDLERFLNNRAKEIVPGGMIIITNPSIPDGMPFSEIANGLMYNCMGTILYDMVKVGLLSEAQVDSFNLPIYACPPGEFGAVVERNGNFRIEVMgltnpspwlkgriNMPEYIKHVRAATESMFNKHFSYEVTEEMFRQLLERLEEINDKMVSCYRDGVQLFAVLQRL

*********HIHDAIIRKLDVKSLADSSSNTIRLADCGCAVGPNTFNAMQDLIEIVKHKYK*********************DFNTLFTSLPQEIHFFVAGVPGSFHKRLFPEKFLHLVHVSYALHWLSKVPEGLLDKNSPAWNKGRIHYAFAPEVVVKAYANQFAKDLERFLNNRAKEIVPGGMIIITNPSIPDGMPFSEIANGLMYNCMGTILYDMVKVGLLSEAQVDSFNLPIYACPPGEFGAVVERNGNFRIEVMGLTNPSPWLKGRINMPEYIKHVRAATESMFNKHFSYEVTEEMFRQLLERLEEINDKMVSCYRDGVQLFAVL***

R****VTKDHIHDAIIRKLDVKSLADSSSNTIRLADCGCAVGPNTFNAMQDLIEIVKHKY*********PEFHVSFNDQSSNDFNTLFTSLPQEIHFFVAGVPGSFHKRLFPEKFLHLVHVSYALHWLSKVPEGLLDKNSPAWNKGRIHYAFAPEVVVKAYANQFAKDLERFLNNRAKEIVPGGMIIITNPSIPDGMPFSEIANGLMYNCMGTILYDMVKVGLLSEAQVDSFNLPIYACPPGEFGAVVERNGNFRIEVMGLTNPSPWLKGRINMPEYIKHVRAATESMFNKHFSYEVTEEMFRQLLERLEEINDKMVSCYRDGVQLFAVLQRL

********DHIHDAIIRKLDVKSLADSSSNTIRLADCGCAVGPNTFNAMQDLIEIVKHKYKSQCPNSQNPEFHVSFNDQSSNDFNTLFTSLPQEIHFFVAGVPGSFHKRLFPEKFLHLVHVSYALHWLSKVPEGLLDKNSPAWNKGRIHYAFAPEVVVKAYANQFAKDLERFLNNRAKEIVPGGMIIITNPSIPDGMPFSEIANGLMYNCMGTILYDMVKVGLLSEAQVDSFNLPIYACPPGEFGAVVERNGNFRIEVMGLTNPSPWLKGRINMPEYIKHVRAATESMFNKHFSYEVTEEMFRQLLERLEEINDKMVSCYRDGVQLFAVLQRL

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		333	2.2.26 [Sep-21-2011]
Q9LS10		359	Probable S-adenosylmethio	no	no	0.876	0.813	0.428	3e-60
Q9FKD0		362	Probable S-adenosylmethio	no	no	0.975	0.897	0.380	1e-58
Q9FKC8		362	Probable S-adenosylmethio	no	no	0.984	0.906	0.389	3e-58
Q9FKR0		361	Probable S-adenosylmethio	no	no	0.885	0.817	0.397	3e-56
Q68CM3		365	Probable caffeine synthas	N/A	no	0.786	0.717	0.358	1e-45
Q9FZN8		369	Caffeine synthase 1 OS=Ca	N/A	no	0.777	0.701	0.355	2e-44
Q0J998		404	Indole-3-acetate O-methyl	no	no	0.870	0.717	0.328	3e-38
Q9FYZ9		364	Benzoate carboxyl methylt	N/A	no	0.810	0.741	0.348	4e-38
Q9SPV4		359	Salicylate O-methyltransf	N/A	no	0.855	0.793	0.329	1e-37
Q9FLN8		386	Indole-3-acetate O-methyl	no	no	0.804	0.694	0.312	1e-37

>sp\|Q9LS10\|MT810_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g38100 OS=Arabidopsis thaliana GN=At5g38100 PE=2 SV=1	Back alignment and function desciption

 Score =  232 bits (591), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 129/301 (42%), Positives = 180/301 (59%), Gaps = 9/301 (2%)

Query: 14  AIIRKLDVKSLADSSSNTIRLADCGCAVGPNTFNAMQDLIEIVKHK-YKSQCPNSQNP-E 71
            I  KLD++  +D    T R+AD GC++GPNTF+  Q +I+ VK K  +    NS  P E
Sbjct: 40  CIFEKLDLQLSSDF--GTFRIADFGCSIGPNTFHVAQSIIDTVKSKRLEESTENSLVPLE 97

Query: 72  FHVSFNDQSSNDFNTLFTSLP--QEIHFFVAGVPGSFHKRLFPEKFLHLVHVSYALHWLS 129
           F V FNDQ +NDFNTLF + P   E  +F  GVPGSF+ R+ P   +H+ H SY  HWLS
Sbjct: 98  FQVFFNDQPTNDFNTLFRTQPLSPEREYFSVGVPGSFYGRVLPRNSIHIGHTSYTTHWLS 157

Query: 130 KVPEGLLDKNSPAWNKGRIHYAFAPEVVVKAYANQFAKDLERFLNNRAKEIVPGGMIIIT 189
           KVP+ + DK S AWNK  I      E V KAY  QF KD+E FL+ RA+E+VPGG++I+ 
Sbjct: 158 KVPDNVCDKKSMAWNKNYIQCNNLLEEVTKAYKVQFIKDMEIFLDARAEELVPGGLMIVI 217

Query: 190 NPSIPDGMPFSEIANGLMYNCMGTILYDMVKVGLLSEAQVDSFNLPIYACPPGEFGAVVE 249
              +PDG+   E   G + + +G  L DM K G+ SE ++D F+LP+Y     E    +E
Sbjct: 218 GECLPDGVSLYETWQGYVMDTIGDCLMDMAKSGITSEEKIDLFSLPVYFPQFSELKGEIE 277

Query: 250 RNGNFRIEVMGLTNPSPWLKGRINMPEYIKHV-RAATESMFNKHFSYEVTEEMFRQLLER 308
           +NG+F IE+M  T  S  L+G+    ++I    RA   ++  KHF   V +E+F +L ++
Sbjct: 278 KNGSFTIELMETT--SHPLEGKPLTNDFITSTFRAFLTTIIEKHFGDGVVDELFYRLAKK 335

Query: 309 L 309
           L
Sbjct: 336 L 336

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -

>sp\|Q9FKD0\|MT797_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g37970 OS=Arabidopsis thaliana GN=At5g37970 PE=1 SV=1	Back alignment and function description

>sp\|Q9FKC8\|MT799_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g37990 OS=Arabidopsis thaliana GN=At5g37990 PE=2 SV=2	Back alignment and function description

>sp\|Q9FKR0\|MT878_ARATH Probable S-adenosylmethionine-dependent methyltransferase At5g38780 OS=Arabidopsis thaliana GN=At5g38780 PE=2 SV=1	Back alignment and function description

>sp\|Q68CM3\|TCS2_CAMSI Probable caffeine synthase 2 OS=Camellia sinensis GN=TCS2 PE=2 SV=1	Back alignment and function description

>sp\|Q9FZN8\|TCS1_CAMSI Caffeine synthase 1 OS=Camellia sinensis GN=TCS1 PE=1 SV=1	Back alignment and function description

>sp\|Q0J998\|IAMT1_ORYSJ Indole-3-acetate O-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=IAMT1 PE=1 SV=1	Back alignment and function description

>sp\|Q9FYZ9\|BAMT_ANTMA Benzoate carboxyl methyltransferase OS=Antirrhinum majus GN=BAMT PE=1 SV=1	Back alignment and function description

>sp\|Q9SPV4\|SAMT_CLABR Salicylate O-methyltransferase OS=Clarkia breweri GN=SAMT PE=1 SV=1	Back alignment and function description

>sp\|Q9FLN8\|IAMT1_ARATH Indole-3-acetate O-methyltransferase 1 OS=Arabidopsis thaliana GN=IAMT1 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		333
255570083		377	Benzoate carboxyl methyltransferase, put	0.996	0.880	0.6	1e-118
224101905		373	predicted protein [Populus trichocarpa]	0.993	0.887	0.616	1e-117
224101907		359	predicted protein [Populus trichocarpa]	0.993	0.922	0.578	1e-108
449457458		376	PREDICTED: probable S-adenosylmethionine	0.987	0.875	0.511	2e-93
225424399		360	PREDICTED: probable S-adenosylmethionine	0.984	0.911	0.518	8e-92
297737614		347	unnamed protein product [Vitis vinifera]	0.987	0.948	0.515	1e-90
225424405		361	PREDICTED: probable S-adenosylmethionine	0.987	0.911	0.515	1e-90
225424403		353	PREDICTED: probable S-adenosylmethionine	0.987	0.932	0.515	7e-90
225466372		353	PREDICTED: probable S-adenosylmethionine	0.987	0.932	0.506	1e-88
297737616		402	unnamed protein product [Vitis vinifera]	0.987	0.818	0.506	1e-88

>gi\|255570083\|ref\|XP_002526004.1\| Benzoate carboxyl methyltransferase, putative [Ricinus communis] gi\|223534736\|gb\|EEF36428.1\| Benzoate carboxyl methyltransferase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  429 bits (1104), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 201/335 (60%), Positives = 259/335 (77%), Gaps = 3/335 (0%)

Query: 1   RLATNVTKDHIHDAIIRKLDVKSLADSSSNTIRLADCGCAVGPNTFNAMQDLIEIVKHKY 60
           +LATNV KD I +AI +KLDV+SL  +SSNTIR+AD GCAVGPNTF  MQ+++ +VK KY
Sbjct: 37  KLATNVVKDKIEEAITKKLDVRSLLATSSNTIRVADLGCAVGPNTFTCMQNIVNVVKEKY 96

Query: 61  KSQCPNSQN-PEFHVSFNDQSSNDFNTLFTSLPQEIHFFVAGVPGSFHKRLFPEKFLHLV 119
           +SQCP S+  P+F V FND++SNDFNTLFTSLP E  +F AGVPGSF++RLFPE  LH+V
Sbjct: 97  RSQCPTSEILPDFQVFFNDKTSNDFNTLFTSLPLEREYFAAGVPGSFYQRLFPESSLHVV 156

Query: 120 HVSYALHWLSKVPEGLLDKNSPAWNKGRIHYAFAPEVVVKAYANQFAKDLERFLNNRAKE 179
              YA+ WLSKVP+ L DK+SPAWNKG+IHYA AP+ V++AYANQ+A D + FLN RAKE
Sbjct: 157 QCHYAIFWLSKVPDELQDKDSPAWNKGKIHYASAPDEVLRAYANQWAHDFDSFLNARAKE 216

Query: 180 IVPGGMIIITNPSIPDGMPFSEIANGLMYNCMGTILYDMVKVGLLSEAQVDSFNLPIYAC 239
           IVPGG++I+  PS+PDGMP+SE+ANG+ +N + +IL DM K GL+ E +VD FN+PIYA 
Sbjct: 217 IVPGGLLIVIMPSVPDGMPYSELANGIFFNLLASILLDMAKRGLIREEEVDGFNMPIYAA 276

Query: 240 PPGEFGAVVERNGNFRIEVMGLTNPSPWLKG--RINMPEYIKHVRAATESMFNKHFSYEV 297
           PPGEF A VE+NG+F IE +GLTNP+PWL     ++M E+++H+RAA E MF KHF   +
Sbjct: 277 PPGEFVAGVEKNGHFNIEEIGLTNPAPWLTDDVHVDMIEFLRHIRAAWEGMFIKHFPPNI 336

Query: 298 TEEMFRQLLERLEEINDKMVSCYRDGVQLFAVLQR 332
            +E+F QL  RL E+ + M   Y+D +Q   VLQR
Sbjct: 337 VDEIFDQLTIRLPEVFESMERAYKDKIQAHYVLQR 371

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224101905\|ref\|XP_002312469.1\| predicted protein [Populus trichocarpa] gi\|222852289\|gb\|EEE89836.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224101907\|ref\|XP_002312470.1\| predicted protein [Populus trichocarpa] gi\|222852290\|gb\|EEE89837.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449457458\|ref\|XP_004146465.1\| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990-like [Cucumis sativus] gi\|449513682\|ref\|XP_004164393.1\| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|225424399\|ref\|XP_002281366.1\| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990 [Vitis vinifera] gi\|297737618\|emb\|CBI26819.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297737614\|emb\|CBI26815.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225424405\|ref\|XP_002284898.1\| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225424403\|ref\|XP_002281406.1\| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990 [Vitis vinifera] gi\|297737615\|emb\|CBI26816.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225466372\|ref\|XP_002276659.1\| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase At5g37990 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297737616\|emb\|CBI26817.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		333
TAIR\|locus:2200186		363	AT1G68040 [Arabidopsis thalian	0.987	0.906	0.449	1.1e-76
TAIR\|locus:2144461		359	AT5G38100 [Arabidopsis thalian	0.873	0.810	0.43	8.4e-58
TAIR\|locus:504956193		351	AT1G15125 [Arabidopsis thalian	0.960	0.911	0.352	8.6e-56
TAIR\|locus:2082157		348	AT3G44840 [Arabidopsis thalian	0.945	0.905	0.373	8.6e-56
TAIR\|locus:2166640		361	AT5G38780 [Arabidopsis thalian	0.945	0.872	0.386	1.6e-54
TAIR\|locus:2082117		379	AT3G44870 "AT3G44870" [Arabido	0.936	0.823	0.373	1e-52
TAIR\|locus:2082112		348	FAMT "farnesoic acid carboxyl-	0.945	0.905	0.366	2.4e-51
TAIR\|locus:2033409		353	PXMT1 [Arabidopsis thaliana (t	0.957	0.903	0.361	2.2e-50
TAIR\|locus:2033414		353	AT1G66690 "AT1G66690" [Arabido	0.963	0.909	0.355	6e-48
TAIR\|locus:2033389		352	AT1G66720 [Arabidopsis thalian	0.864	0.818	0.356	6.9e-47

TAIR\|locus:2200186 AT1G68040 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 772 (276.8 bits), Expect = 1.1e-76, P = 1.1e-76
 Identities = 151/336 (44%), Positives = 217/336 (64%)

Query:     1 RLATNVTKDHIHDAIIRKLDVKSLADSSSNTIRLADCGCAVGPNTFNAMQDLIEIVKHKY 60
             R  T++ K+ I   ++ KL+ K+L  S SNT R+AD GCA GPNTF  + ++I+ ++   
Sbjct:    30 RKTTSLLKEKIDKLVLEKLNAKTLISSDSNTFRIADLGCATGPNTFFLVDNIIKSIETSL 89

Query:    61 KSQCPNSQNPEFHVSFNDQSSNDFNTLFTSLPQEIHFFVAGVPGSFHKRLFPEKFLHLVH 120
             +    NS  PEF V FND   NDFNTLFTSLPQ+  +   GVPGSF+ R+ P+  +H+V 
Sbjct:    90 RKS--NSSKPEFLVFFNDLPQNDFNTLFTSLPQDRSYLAVGVPGSFYGRVLPQSSVHIVV 147

Query:   121 VSYALHWLSKVPEGLLDKNSPAWNKGRIHYAFAPEVVVKAYANQFAKDLERFLNNRAKEI 180
                A HWLS VP+ +LDK+S AWNKG++HY+ A + VVKAY +QF +D+E+FL  RA EI
Sbjct:   148 TMGATHWLSSVPKEVLDKSSKAWNKGKVHYSNAADEVVKAYRDQFGRDMEKFLEARATEI 207

Query:   181 VPGGMIIITNPSIPDGMPFSEIANGLMYNCMGTILYDMVKVGLLSEAQVDSFNLPIYACP 240
             V GG++++    IP GMPFS +A+ +MY  M  +L  M   GL+SE QVD+FN+PIY+  
Sbjct:   208 VSGGLLVVGMCGIPKGMPFSNLADSIMYTSMADVLTQMHSEGLISEEQVDTFNIPIYSAT 267

Query:   241 PGEFGAVVERNGNFRIEVMGLTNPSPWLKGRINMPEYIKH----VRAATESMFNKHFSYE 296
             P E   +V +NG F +E M L +P+ WLK   N+ E ++H    ++A   S+F  HF   
Sbjct:   268 PEEVTVLVVKNGCFTVESMELMDPTAWLKRPTNV-EDVRHWMVCIKATMGSLFINHFGEH 326

Query:   297 VTEEMFRQLLERLEEINDKMVSCYRDGVQLFAVLQR 332
             + +++F +L  +L  + +K+ S YR+ V LF  LQR
Sbjct:   327 LLDDVFDRLTAKLVGLTEKIESSYREKVMLFFALQR 362

GO:0005634 "nucleus" evidence=ISM

GO:0008168 "methyltransferase activity" evidence=IEA

GO:0008757 "S-adenosylmethionine-dependent methyltransferase activity" evidence=ISS

TAIR\|locus:2144461 AT5G38100 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:504956193 AT1G15125 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2082157 AT3G44840 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2166640 AT5G38780 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2082117 AT3G44870 "AT3G44870" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2082112 FAMT "farnesoic acid carboxyl-O-methyltransferase" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2033409 PXMT1 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2033414 AT1G66690 "AT1G66690" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2033389 AT1G66720 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
4th Layer	2.1.1.141	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	gw1.VIII.1912.1	hypothetical protein (351 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		333
pfam03492		331	pfam03492, Methyltransf_7, SAM dependent carboxyl	1e-111
PLN02668		386	PLN02668, PLN02668, indole-3-acetate carboxyl meth	2e-51

>gnl\|CDD\|217591 pfam03492, Methyltransf_7, SAM dependent carboxyl methyltransferase	Back alignment and domain information

 Score =  327 bits (840), Expect = e-111
 Identities = 130/323 (40%), Positives = 193/323 (59%), Gaps = 16/323 (4%)

Query: 24  LADSSSNTIRLADCGCAVGPNTFNAMQDLIEIVKHKYKSQCPNSQNPEFHVSFNDQSSND 83
           L +   N+I++AD GC+ GPNTF A+ ++I+ V+ KY+ +    + PEF V FND  SND
Sbjct: 10  LRNLFPNSIKIADLGCSSGPNTFLAVSNIIDTVEKKYQKEN-ILEPPEFQVFFNDLPSND 68

Query: 84  FNTLFTSLPQEI----HFFVAGVPGSFHKRLFPEKFLHLVHVSYALHWLSKVPEGLLDKN 139
           FNTLF  LP        +FV+GVPGSF+ RLFP   LH VH SY+LHWLS+VP+GL DK 
Sbjct: 69  FNTLFKLLPPFQKKKRSYFVSGVPGSFYGRLFPRNSLHFVHSSYSLHWLSQVPKGLEDKE 128

Query: 140 SPAWNKGRIHYA-FAPEVVVKAYANQFAKDLERFLNNRAKEIVPGGMIIITNPSIPDGMP 198
           SPAWNKG I+ +  +PE V KAY +QF KD   FL  RA+E+V GG++++T    P  + 
Sbjct: 129 SPAWNKGNIYISGASPEEVYKAYLDQFKKDFSLFLRARAEELVSGGLMVLTFLGRPS-VD 187

Query: 199 FSEIANGLMYNCMGTILYDMVKVGLLSEAQVDSFNLPIYACPPGEFGAVVERNGNF---R 255
            SE   G+ ++ +G  L D+V  GL+ E ++DSFN+PIYA  P E   ++E+ G+F   R
Sbjct: 188 PSETECGIFWDLLGDALNDLVSEGLIEEEKLDSFNIPIYAPSPEEVKEIIEKEGSFTIER 247

Query: 256 IEVMGLTNPS-----PWLKGRINMPEYI-KHVRAATESMFNKHFSYEVTEEMFRQLLERL 309
           +E++   N          + ++    ++   VRA  E M   HF  ++ +++F +  ++L
Sbjct: 248 LEIIKHPNGEVPWDESDSEDKVEDGRFVASSVRAVVEPMLVAHFGEDIMDKLFDRYAKKL 307

Query: 310 EEINDKMVSCYRDGVQLFAVLQR 332
            E   K +   +  + +   L R
Sbjct: 308 SEHLSKELQNAKKTINVVVSLSR 330

This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine. Caffeine is synthesised through sequential three-step methylation of xanthine derivatives at positions 7-N, 3-N, and 1-N. The protein 7-methylxanthine methyltransferase (designated as CaMXMT) catalyzes the second step to produce theobromine. Length = 331

>gnl\|CDD\|178273 PLN02668, PLN02668, indole-3-acetate carboxyl methyltransferase	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		333
PF03492		334	Methyltransf_7: SAM dependent carboxyl methyltrans	100.0
PLN02668		386	indole-3-acetate carboxyl methyltransferase	100.0
PRK01683		258	trans-aconitate 2-methyltransferase; Provisional	99.13
PRK14103		255	trans-aconitate 2-methyltransferase; Provisional	99.13
COG4106		257	Tam Trans-aconitate methyltransferase [General fun	98.74
PTZ00098		263	phosphoethanolamine N-methyltransferase; Provision	98.61
TIGR02072		240	BioC biotin biosynthesis protein BioC. This enzyme	98.58
TIGR00740		239	methyltransferase, putative. A simple BLAST search	98.58
TIGR02752		231	MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me	98.49
PRK11036		255	putative S-adenosyl-L-methionine-dependent methylt	98.47
PRK15068		322	tRNA mo(5)U34 methyltransferase; Provisional	98.42
PRK15451		247	tRNA cmo(5)U34 methyltransferase; Provisional	98.41
PLN02336		475	phosphoethanolamine N-methyltransferase	98.41
PF13489		161	Methyltransf_23: Methyltransferase domain; PDB: 3J	98.37
PRK10258		251	biotin biosynthesis protein BioC; Provisional	98.37
PLN02244		340	tocopherol O-methyltransferase	98.31
PRK08317		241	hypothetical protein; Provisional	98.28
PRK11207		197	tellurite resistance protein TehB; Provisional	98.27
PLN02233		261	ubiquinone biosynthesis methyltransferase	98.26
COG2226		238	UbiE Methylase involved in ubiquinone/menaquinone	98.24
smart00828		224	PKS_MT Methyltransferase in polyketide synthase (P	98.21
PRK11705		383	cyclopropane fatty acyl phospholipid synthase; Pro	98.17
TIGR00452		314	methyltransferase, putative. Known examples to dat	98.14
PRK00216		239	ubiE ubiquinone/menaquinone biosynthesis methyltra	98.12
PLN02396		322	hexaprenyldihydroxybenzoate methyltransferase	98.1
PLN02490		340	MPBQ/MSBQ methyltransferase	98.07
PF01209		233	Ubie_methyltran: ubiE/COQ5 methyltransferase famil	98.05
TIGR01934		223	MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis	97.98
PF12847		112	Methyltransf_18: Methyltransferase domain; PDB: 3G	97.98
PRK06202		232	hypothetical protein; Provisional	97.96
TIGR00477		195	tehB tellurite resistance protein TehB. Part of a	97.94
PF08241		95	Methyltransf_11: Methyltransferase domain; InterPr	97.93
PRK12335		287	tellurite resistance protein TehB; Provisional	97.81
PF03848		192	TehB: Tellurite resistance protein TehB; InterPro:	97.79
PF02353		273	CMAS: Mycolic acid cyclopropane synthetase; InterP	97.77
TIGR02716		306	C20_methyl_CrtF C-20 methyltransferase BchU. Membe	97.71
PF13847		152	Methyltransf_31: Methyltransferase domain; PDB: 3T	97.71
TIGR02081		194	metW methionine biosynthesis protein MetW. This pr	97.7
PRK07580		230	Mg-protoporphyrin IX methyl transferase; Validated	97.7
PRK11873		272	arsM arsenite S-adenosylmethyltransferase; Reviewe	97.67
TIGR02021		219	BchM-ChlM magnesium protoporphyrin O-methyltransfe	97.65
PRK06922		677	hypothetical protein; Provisional	97.61
COG2230		283	Cfa Cyclopropane fatty acid synthase and related m	97.56
PRK00121		202	trmB tRNA (guanine-N(7)-)-methyltransferase; Revie	97.5
PLN02336		475	phosphoethanolamine N-methyltransferase	97.39
smart00138		264	MeTrc Methyltransferase, chemotaxis proteins. Meth	97.35
PF08242		99	Methyltransf_12: Methyltransferase domain; InterPr	97.32
TIGR00138		181	gidB 16S rRNA methyltransferase GidB. GidB (glucos	97.3
PRK05785		226	hypothetical protein; Provisional	97.24
PRK05134		233	bifunctional 3-demethylubiquinone-9 3-methyltransf	97.21
KOG2361		264	consensus Predicted methyltransferase [General fun	97.19
KOG2940		325	consensus Predicted methyltransferase [General fun	97.19
KOG1270		282	consensus Methyltransferases [Coenzyme transport a	97.18
PF05401		201	NodS: Nodulation protein S (NodS); InterPro: IPR00	97.18
PF13649		101	Methyltransf_25: Methyltransferase domain; PDB: 3B	97.16
TIGR01983		224	UbiG ubiquinone biosynthesis O-methyltransferase.	97.09
TIGR03438		301	probable methyltransferase. This model represents	97.09
PRK11188		209	rrmJ 23S rRNA methyltransferase J; Provisional	97.05
PLN02585		315	magnesium protoporphyrin IX methyltransferase	97.04
KOG1540		296	consensus Ubiquinone biosynthesis methyltransferas	97.0
COG2242		187	CobL Precorrin-6B methylase 2 [Coenzyme metabolism	96.97
cd02440		107	AdoMet_MTases S-adenosylmethionine-dependent methy	96.84
PRK11088		272	rrmA 23S rRNA methyltransferase A; Provisional	96.77
PLN02232		160	ubiquinone biosynthesis methyltransferase	96.74
KOG3010		261	consensus Methyltransferase [General function pred	96.71
COG4123		248	Predicted O-methyltransferase [General function pr	96.69
TIGR00091		194	tRNA (guanine-N(7)-)-methyltransferase. In E. coli	96.65
PRK13942		212	protein-L-isoaspartate O-methyltransferase; Provis	96.64
PRK00107		187	gidB 16S rRNA methyltransferase GidB; Reviewed	96.61
TIGR02469		124	CbiT precorrin-6Y C5,15-methyltransferase (decarbo	96.59
PRK00312		212	pcm protein-L-isoaspartate O-methyltransferase; Re	96.55
PRK15001		378	SAM-dependent 23S ribosomal RNA mG1835 methyltrans	96.53
PRK09489		342	rsmC 16S ribosomal RNA m2G1207 methyltransferase;	96.53
PRK13944		205	protein-L-isoaspartate O-methyltransferase; Provis	96.51
PRK13255		218	thiopurine S-methyltransferase; Reviewed	96.48
PF07021		193	MetW: Methionine biosynthesis protein MetW; InterP	96.48
PRK08287		187	cobalt-precorrin-6Y C(15)-methyltransferase; Valid	96.46
TIGR00537		179	hemK_rel_arch HemK-related putative methylase. The	96.4
PF08003		315	Methyltransf_9: Protein of unknown function (DUF16	96.34
TIGR00080		215	pimt protein-L-isoaspartate(D-aspartate) O-methylt	96.34
PF05175		170	MTS: Methyltransferase small domain; InterPro: IPR	96.33
TIGR03533		284	L3_gln_methyl protein-(glutamine-N5) methyltransfe	96.32
PRK04266		226	fibrillarin; Provisional	96.3
TIGR03534		251	RF_mod_PrmC protein-(glutamine-N5) methyltransfera	96.16
PTZ00146		293	fibrillarin; Provisional	96.1
PRK14967		223	putative methyltransferase; Provisional	96.09
PF03141		506	Methyltransf_29: Putative S-adenosyl-L-methionine-	96.0
PRK14121		390	tRNA (guanine-N(7)-)-methyltransferase; Provisiona	96.0
PF00891		241	Methyltransf_2: O-methyltransferase; InterPro: IPR	96.0
TIGR03587		204	Pse_Me-ase pseudaminic acid biosynthesis-associate	95.95
COG2518		209	Pcm Protein-L-isoaspartate carboxylmethyltransfera	95.94
PF05148		219	Methyltransf_8: Hypothetical methyltransferase; In	95.8
PF06080		204	DUF938: Protein of unknown function (DUF938); Inte	95.76
TIGR03840		213	TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d	95.75
PRK14968		188	putative methyltransferase; Provisional	95.73
TIGR00438		188	rrmJ cell division protein FtsJ.	95.65
PRK11805		307	N5-glutamine S-adenosyl-L-methionine-dependent met	95.64
PF03291		331	Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971	95.63
KOG3045		325	consensus Predicted RNA methylase involved in rRNA	95.41
PF13659		117	Methyltransf_26: Methyltransferase domain; PDB: 3G	95.27
TIGR00406		288	prmA ribosomal protein L11 methyltransferase. Ribo	95.15
TIGR00536		284	hemK_fam HemK family putative methylases. The gene	95.05
PRK00811		283	spermidine synthase; Provisional	94.93
KOG1541		270	consensus Predicted protein carboxyl methylase [Ge	94.84
PRK09328		275	N5-glutamine S-adenosyl-L-methionine-dependent met	94.73
TIGR01177		329	conserved hypothetical protein TIGR01177. This fam	94.12
PRK00517		250	prmA ribosomal protein L11 methyltransferase; Revi	93.86
PRK14903		431	16S rRNA methyltransferase B; Provisional	93.72
PRK10901		427	16S rRNA methyltransferase B; Provisional	93.58
PRK01544		506	bifunctional N5-glutamine S-adenosyl-L-methionine-	93.49
PF01135		209	PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl	93.15
PRK14966		423	unknown domain/N5-glutamine S-adenosyl-L-methionin	93.14
PHA03411		279	putative methyltransferase; Provisional	93.08
PRK00377		198	cbiT cobalt-precorrin-6Y C(15)-methyltransferase;	93.05
TIGR00563		426	rsmB ribosomal RNA small subunit methyltransferase	92.56
PLN03075		296	nicotianamine synthase; Provisional	92.41
COG2264		300	PrmA Ribosomal protein L11 methylase [Translation,	92.37
PRK14904		445	16S rRNA methyltransferase B; Provisional	91.91
PRK13943		322	protein-L-isoaspartate O-methyltransferase; Provis	91.41
PRK14902		444	16S rRNA methyltransferase B; Provisional	91.33
PF08123		205	DOT1: Histone methylation protein DOT1 ; InterPro:	90.4
TIGR00417		270	speE spermidine synthase. the SpeE subunit of sper	90.19
KOG4300		252	consensus Predicted methyltransferase [General fun	89.7
TIGR00446		264	nop2p NOL1/NOP2/sun family putative RNA methylase.	89.47
PLN02366		308	spermidine synthase	88.9
PRK14901		434	16S rRNA methyltransferase B; Provisional	88.86
KOG1975		389	consensus mRNA cap methyltransferase [RNA processi	88.66
COG2813		300	RsmC 16S RNA G1207 methylase RsmC [Translation, ri	88.42
COG2227		243	UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-	88.34
PF02390		195	Methyltransf_4: Putative methyltransferase ; Inter	88.17
PRK04457		262	spermidine synthase; Provisional	88.0
PF05891		218	Methyltransf_PK: AdoMet dependent proline di-methy	87.57
KOG2904		328	consensus Predicted methyltransferase [General fun	86.81
PRK03612		521	spermidine synthase; Provisional	86.16
KOG2899		288	consensus Predicted methyltransferase [General fun	85.82
PRK01544		506	bifunctional N5-glutamine S-adenosyl-L-methionine-	85.44
PHA03412		241	putative methyltransferase; Provisional	84.09
PF01234		256	NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I	82.48
KOG3178		342	consensus Hydroxyindole-O-methyltransferase and re	82.0
KOG1499		346	consensus Protein arginine N-methyltransferase PRM	81.88
PRK07402		196	precorrin-6B methylase; Provisional	81.12
smart00650		169	rADc Ribosomal RNA adenine dimethylases.	80.25

>PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine	Back alignment and domain information

Probab=100.00  E-value=4.5e-99  Score=729.51  Aligned_cols=317  Identities=41%  Similarity=0.693  Sum_probs=266.9

Q ss_pred             HHHHHHHHhhhcccCCCCCCcEEEEeecCCCCcccHHHHHHHHHHHHHHhhhcCCCCCCCcceEEecCCCCCchHHHhhc
Q 040129           11 IHDAIIRKLDVKSLADSSSNTIRLADCGCAVGPNTFNAMQDLIEIVKHKYKSQCPNSQNPEFHVSFNDQSSNDFNTLFTS   90 (333)
Q Consensus        11 l~~ai~~~~~~~~~~~~~~~~~~IaD~GCs~G~Ns~~~~~~ii~~i~~~~~~~~~~~~~~~~~v~~nDlP~NDFn~lF~~   90 (333)
                      |++||.+++....    .+++++|||||||+|+||+.+|+.||++|+++|++.+ .+++|||||||||||+||||+||++
T Consensus         1 ~~~ai~~~~~~~~----~~~~~~iaD~GcS~G~Nsl~~~~~ii~~i~~~~~~~~-~~~~~e~~v~~nDlP~NDFn~lF~~   75 (334)
T PF03492_consen    1 LEEAIKELYNSSN----NPKPFRIADLGCSSGPNSLLAVSNIIDAIRERCRSSN-NQPPPEFQVFFNDLPSNDFNTLFKS   75 (334)
T ss_dssp             -HHHHHHHHHSTT----TTTEEEEEEES--SSHHHHHHHHHHHHHHHHHHHCTT--SS--EEEEEEEE-TTS-HHHHHHC
T ss_pred             ChHHHHHHHhcCC----CCCceEEEecCCCCCccHHHHHHHHHHHHHHHhhhhc-CCCCCeEEEEeCCCCCccHHHHHHh
Confidence            6899999986542    6889999999999999999999999999999998754 3578999999999999999999999


Q ss_pred             CCcc-------ccceeeccCcccccccCCCCceeEEEeccccccccCCCccccCCCCCCCCCCceeecCC-CHHHHHHHH
Q 040129           91 LPQE-------IHFFVAGVPGSFHKRLFPEKFLHLVHVSYALHWLSKVPEGLLDKNSPAWNKGRIHYAFA-PEVVVKAYA  162 (333)
Q Consensus        91 l~~~-------~~~f~~~vpgSFy~rlfP~~Sv~~~~Ss~alHWLS~vP~~l~~~~~~~~nkg~i~~~~~-~~~v~~ay~  162 (333)
                      ||++       ++||++|||||||+||||++||||+||++||||||++|+++.++.+|+||||+||++++ +++|.+||+
T Consensus        76 l~~~~~~~~~~~~~f~~gvpgSFy~rLfP~~Svh~~~Ss~alHWLS~vP~~l~~~~~~~~Nkg~i~~~~~~~~~v~~ay~  155 (334)
T PF03492_consen   76 LPSFQQSLKKFRNYFVSGVPGSFYGRLFPSNSVHFGHSSYALHWLSQVPEELVDKSSPAWNKGNIYISRTSPPEVAKAYA  155 (334)
T ss_dssp             HHHHHHHHHHTTSEEEEEEES-TTS--S-TT-EEEEEEES-TTB-SSS-CCCCTTTSTTTSTTTSSSSTTS-HHHHHHHH
T ss_pred             ChhhhhccCCCceEEEEecCchhhhccCCCCceEEEEEechhhhcccCCcccccccccccccCcEEEecCCCHHHHHHHH
Confidence            9987       58999999999999999999999999999999999999999999999999999999955 999999999


Q ss_pred             HHHHHhHHHHHHhhhhhhccCceEEEEecCCCCCCCCccchhhHHHHHHHHHHHHHHhccCCCHhhhhcCCcCcccCCHH
Q 040129          163 NQFAKDLERFLNNRAKEIVPGGMIIITNPSIPDGMPFSEIANGLMYNCMGTILYDMVKVGLLSEAQVDSFNLPIYACPPG  242 (333)
Q Consensus       163 ~Q~~~D~~~FL~~Ra~EL~~GG~mvl~~~gr~~~~~~~~~~~~~~~~~l~~~l~~mv~eG~i~~~~~d~fn~P~y~ps~~  242 (333)
                      +||++||.+||++||+||+|||+||++++||++.++... +.+.+|++|+++|+|||.||+|++|++|+||+|+|+||.+
T Consensus       156 ~Qf~~D~~~FL~~Ra~ELv~GG~mvl~~~gr~~~~~~~~-~~~~~~~~l~~~l~dMv~eGlI~~ek~dsfniP~Y~ps~e  234 (334)
T PF03492_consen  156 KQFQKDFSSFLKARAEELVPGGRMVLTFLGRDEEDPSST-GSCMLWDLLADALRDMVAEGLISEEKVDSFNIPIYFPSPE  234 (334)
T ss_dssp             HHHHHHHHHHHHHHHHHEEEEEEEEEEEEE-STSSTTST-TCCCHHHHHHHHHHHHHHTTSS-HCCCCTG--SBB---HH
T ss_pred             HHHHHHHHHHHHHhhheeccCcEEEEEEeeccccccccC-CcchHHHHHHHHHHHHHHcCCcCHHHhhceeCCccCCCHH
Confidence            999999999999999999999999999999999766554 4667999999999999999999999999999999999999


Q ss_pred             HHHHHHHhCCcEEEeEEEEeC-CC---CCC-----cCCCChhHHHHHHHHHhhhhhhhhcChHHHHHHHHHHHHHHHHhh
Q 040129          243 EFGAVVERNGNFRIEVMGLTN-PS---PWL-----KGRINMPEYIKHVRAATESMFNKHFSYEVTEEMFRQLLERLEEIN  313 (333)
Q Consensus       243 E~~~~ie~~G~F~I~~le~~~-p~---~~~-----~~~~~~~~~a~~iRa~~e~~l~~hfgeei~delf~r~~~~l~~~~  313 (333)
                      |++++|+++|+|+|+++|+++ +.   ++.     +...+|+.+++++||++||+|++|||++|+|+||+||++++++++
T Consensus       235 Ev~~~I~~~gsF~I~~le~~~~~~~~~~~~~~~~~d~~~~~~~~~~~iRA~~e~~l~~hfG~ei~D~LF~r~~~~v~~~~  314 (334)
T PF03492_consen  235 EVRAIIEEEGSFEIEKLELFEQPWWSVPDDESWKEDAKEYARNVANYIRAVFEPLLKAHFGEEIMDELFERYAKKVAEHL  314 (334)
T ss_dssp             HHHHHHHHHTSEEEEEEEEEEEETCCTCTTT-STTTHHCHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHhcCCCEEEEEEEEEeecccccchhhhcccchhhhHHHHHHhHHHHHHHHHHHHhChHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999987 22   111     112588999999999999999999999999999999999999999


Q ss_pred             hhhhhcCCCcEEEEEEEeeC
Q 040129          314 DKMVSCYRDGVQLFAVLQRL  333 (333)
Q Consensus       314 ~~~~~~~~~~~~~~~~l~r~  333 (333)
                      +.......++++++++|+||
T Consensus       315 ~~~~~~~~~~~~i~~~L~Rk  334 (334)
T PF03492_consen  315 EKEKSRNMKFVNIVVSLTRK  334 (334)
T ss_dssp             HHTHTT-BEEEEEEEEEEE-
T ss_pred             HHhhccCCCcEEEEEEEeeC
Confidence            88443458899999999997

Caffeine is synthesized through sequential three-step methylation of xanthine derivatives at positions 7-N, 3-N, and 1-N. The protein 7-methylxanthine methyltransferase (designated as CaMXMT) catalyses the second step to produce theobromine [].; GO: 0008168 methyltransferase activity; PDB: 2EFJ_A 1M6E_X 2EG5_C 3B5I_B.

>PLN02668 indole-3-acetate carboxyl methyltransferase	Back alignment and domain information

>PRK01683 trans-aconitate 2-methyltransferase; Provisional	Back alignment and domain information

>PRK14103 trans-aconitate 2-methyltransferase; Provisional	Back alignment and domain information

>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only]	Back alignment and domain information

>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional	Back alignment and domain information

>TIGR02072 BioC biotin biosynthesis protein BioC	Back alignment and domain information

>TIGR00740 methyltransferase, putative	Back alignment and domain information

>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase	Back alignment and domain information

>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional	Back alignment and domain information

>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional	Back alignment and domain information

>PLN02336 phosphoethanolamine N-methyltransferase	Back alignment and domain information

>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C	Back alignment and domain information

>PRK10258 biotin biosynthesis protein BioC; Provisional	Back alignment and domain information

>PLN02244 tocopherol O-methyltransferase	Back alignment and domain information

>PRK08317 hypothetical protein; Provisional	Back alignment and domain information

>PRK11207 tellurite resistance protein TehB; Provisional	Back alignment and domain information

>PLN02233 ubiquinone biosynthesis methyltransferase	Back alignment and domain information

>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes	Back alignment and domain information

>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional	Back alignment and domain information

>TIGR00452 methyltransferase, putative	Back alignment and domain information

>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed	Back alignment and domain information

>PLN02396 hexaprenyldihydroxybenzoate methyltransferase	Back alignment and domain information

>PLN02490 MPBQ/MSBQ methyltransferase	Back alignment and domain information

>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities []	Back alignment and domain information

>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases	Back alignment and domain information

>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A	Back alignment and domain information

>PRK06202 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00477 tehB tellurite resistance protein TehB	Back alignment and domain information

>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>PRK12335 tellurite resistance protein TehB; Provisional	Back alignment and domain information

>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB	Back alignment and domain information

>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4)	Back alignment and domain information

>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU	Back alignment and domain information

>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A	Back alignment and domain information

>TIGR02081 metW methionine biosynthesis protein MetW	Back alignment and domain information

>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated	Back alignment and domain information

>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed	Back alignment and domain information

>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase	Back alignment and domain information

>PRK06922 hypothetical protein; Provisional	Back alignment and domain information

>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed	Back alignment and domain information

>PLN02336 phosphoethanolamine N-methyltransferase	Back alignment and domain information

>smart00138 MeTrc Methyltransferase, chemotaxis proteins	Back alignment and domain information

>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>TIGR00138 gidB 16S rRNA methyltransferase GidB	Back alignment and domain information

>PRK05785 hypothetical protein; Provisional	Back alignment and domain information

>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional	Back alignment and domain information

>KOG2361 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>KOG2940 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism]	Back alignment and domain information

>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins	Back alignment and domain information

>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A	Back alignment and domain information

>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase	Back alignment and domain information

>TIGR03438 probable methyltransferase	Back alignment and domain information

>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional	Back alignment and domain information

>PLN02585 magnesium protoporphyrin IX methyltransferase	Back alignment and domain information

>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism]	Back alignment and domain information

>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism]	Back alignment and domain information

>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy)	Back alignment and domain information

>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional	Back alignment and domain information

>PLN02232 ubiquinone biosynthesis methyltransferase	Back alignment and domain information

>KOG3010 consensus Methyltransferase [General function prediction only]	Back alignment and domain information

>COG4123 Predicted O-methyltransferase [General function prediction only]	Back alignment and domain information

>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase	Back alignment and domain information

>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed	Back alignment and domain information

>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit	Back alignment and domain information

>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed	Back alignment and domain information

>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional	Back alignment and domain information

>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional	Back alignment and domain information

>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>PRK13255 thiopurine S-methyltransferase; Reviewed	Back alignment and domain information

>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins	Back alignment and domain information

>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated	Back alignment and domain information

>TIGR00537 hemK_rel_arch HemK-related putative methylase	Back alignment and domain information

>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase	Back alignment and domain information

>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases	Back alignment and domain information

>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific	Back alignment and domain information

>PRK04266 fibrillarin; Provisional	Back alignment and domain information

>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific	Back alignment and domain information

>PTZ00146 fibrillarin; Provisional	Back alignment and domain information

>PRK14967 putative methyltransferase; Provisional	Back alignment and domain information

>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases	Back alignment and domain information

>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional	Back alignment and domain information

>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase	Back alignment and domain information

>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases	Back alignment and domain information

>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes	Back alignment and domain information

>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family	Back alignment and domain information

>PRK14968 putative methyltransferase; Provisional	Back alignment and domain information

>TIGR00438 rrmJ cell division protein FtsJ	Back alignment and domain information

>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes	Back alignment and domain information

>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification]	Back alignment and domain information

>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A	Back alignment and domain information

>TIGR00406 prmA ribosomal protein L11 methyltransferase	Back alignment and domain information

>TIGR00536 hemK_fam HemK family putative methylases	Back alignment and domain information

>PRK00811 spermidine synthase; Provisional	Back alignment and domain information

>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only]	Back alignment and domain information

>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional	Back alignment and domain information

>TIGR01177 conserved hypothetical protein TIGR01177	Back alignment and domain information

>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed	Back alignment and domain information

>PRK14903 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PRK10901 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed	Back alignment and domain information

>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2	Back alignment and domain information

>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional	Back alignment and domain information

>PHA03411 putative methyltransferase; Provisional	Back alignment and domain information

>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional	Back alignment and domain information

>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB	Back alignment and domain information

>PLN03075 nicotianamine synthase; Provisional	Back alignment and domain information

>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK14904 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional	Back alignment and domain information

>PRK14902 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 []	Back alignment and domain information

>TIGR00417 speE spermidine synthase	Back alignment and domain information

>KOG4300 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase	Back alignment and domain information

>PLN02366 spermidine synthase	Back alignment and domain information

>PRK14901 16S rRNA methyltransferase B; Provisional	Back alignment and domain information

>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification]	Back alignment and domain information

>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism]	Back alignment and domain information

>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2	Back alignment and domain information

>PRK04457 spermidine synthase; Provisional	Back alignment and domain information

>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like	Back alignment and domain information

>KOG2904 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>PRK03612 spermidine synthase; Provisional	Back alignment and domain information

>KOG2899 consensus Predicted methyltransferase [General function prediction only]	Back alignment and domain information

>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed	Back alignment and domain information

>PHA03412 putative methyltransferase; Provisional	Back alignment and domain information

>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals	Back alignment and domain information

>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only]	Back alignment and domain information

>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms]	Back alignment and domain information

>PRK07402 precorrin-6B methylase; Provisional	Back alignment and domain information

>smart00650 rADc Ribosomal RNA adenine dimethylases	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		333
1m6e_X		359	Crystal Structure Of Salicylic Acid Carboxyl Methyl		7e-39
3b5i_A		374	Crystal Structure Of Indole-3-Acetic Acid Methyltra		1e-38
2eg5_A		372	The Structure Of Xanthosine Methyltransferase Lengt		1e-33
2efj_A		384	The Structure Of 1,7 Dimethylxanthine Methyltransfe		3e-33

>pdb|1M6E|X Chain X, Crystal Structure Of Salicylic Acid Carboxyl Methyltransferase (Samt) Length = 359

Back alignment and structure

Iteration: 1

Score = 157 bits (397), Expect = 7e-39, Method: Compositional matrix adjust. Identities = 103/313 (32%), Positives = 163/313 (52%), Gaps = 28/313 (8%) Query: 25 ADSSSNTIRLADCGCAVGPNTFNAMQDLIEIVKHKYKSQCPNSQNPEFHVSFNDQSSNDF 84 D+ + + +AD GC+ GPN A+ +LI+ V+ + + + +PE+ + ND NDF Sbjct: 46 GDTVTTRLAIADLGCSSGPNALFAVTELIKTVE-ELRKKMGRENSPEYQIFLNDLPGNDF 104 Query: 85 NTLFTSLPQEIHF----FVAGVPGSFHKRLFPEKFLHLVHVSYALHWLSKVPEGLLDKNS 140 N +F SLP E F+ GVPGSF+ RLFP LH +H SY+L WLS+VP G+ Sbjct: 105 NAIFRSLPIENDVDGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQVPIGIES--- 161 Query: 141 PAWNKGRIHYA-FAPEVVVKAYANQFAKDLERFLNNRAKEIVPGGMIIITN-PSIPDGMP 198 NKG I+ A P+ V+ AY QF +D FL RA+E+VPGG +++T + Sbjct: 162 ---NKGNIYMANTCPQSVLNAYYKQFQEDHALFLRCRAQEVVPGGRMVLTILGRRSEDRA 218 Query: 199 FSEIANGLMYNCMGTILYDMVKVGLLSEAQVDSFNLPIYACPPGEFGAVVERNGNFRIEV 258 +E L++ + L MV GL+ E ++D FN+P Y P E A + + G+F I+ Sbjct: 219 STECC--LIWQLLAMALNQMVSEGLIEEEKMDKFNIPQYTPSPTEVEAEILKEGSFLIDH 276 Query: 259 MGLTNP--SPWLK-----GRINMPEY--IKHVRAATESMFNKHFSYEVTEEMFRQ----L 305 + + S K G + Y + +RA E + HF + E++F + + Sbjct: 277 IEASEIYWSSCTKDGDGGGSVEEEGYNVARCMRAVAEPLLLDHFGEAIIEDVFHRYKLLI 336 Query: 306 LERLEEINDKMVS 318 +ER+ + K ++ Sbjct: 337 IERMSKEKTKFIN 349

PyMOL of 1m6e

>pdb|3B5I|A Chain A, Crystal Structure Of Indole-3-Acetic Acid Methyltransferase Length = 374

Back alignment and structure

>pdb|2EG5|A Chain A, The Structure Of Xanthosine Methyltransferase Length = 372

Back alignment and structure

>pdb|2EFJ|A Chain A, The Structure Of 1,7 Dimethylxanthine Methyltransferase Length = 384

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		333
2efj_A		384	3,7-dimethylxanthine methyltransferase; SAM-depend	1e-78
3b5i_A		374	S-adenosyl-L-methionine:salicylic acid carboxyl me	3e-78
1m6e_X		359	S-adenosyl-L-methionnine:salicylic acid carboxyl m	8e-74
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-08

>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Length = 384	Back alignment and structure

 Score =  244 bits (623), Expect = 1e-78
 Identities = 89/361 (24%), Positives = 151/361 (41%), Gaps = 41/361 (11%)

Query: 3   ATNVTKDHIHDAIIRKLDVKSLADSSSNTIRLADCGCAVGPNTFNAMQDLIEIVKHKYKS 62
                K  +   I   L   +   + +   ++ D GCA GPNTF+ ++D+++ +    + 
Sbjct: 27  FLIRVKPVLEQCIQELLR--ANLPNINKCFKVGDLGCASGPNTFSTVRDIVQSIDKVGQE 84

Query: 63  QCPNSQNPEFHVSFNDQSSNDFNTLFTSLPQEI------------HFFVAGVPGSFHKRL 110
           +    + P   +  ND   NDFN++F  LP                  +  +PGSF+ RL
Sbjct: 85  KKNELERPTIQIFLNDLFQNDFNSVFKLLPSFYRNLEKENGRKIGSCLIGAMPGSFYSRL 144

Query: 111 FPEKFLHLVHVSYALHWLSKVPEGLLDKNSPAWNKGRIHYAFA-PEVVVKAYANQFAKDL 169
           FPE+ +H +H  Y LHWLS+VP GL+ +   + NKG I+ + A    + KAY +QF KD 
Sbjct: 145 FPEESMHFLHSCYCLHWLSQVPSGLVTELGISVNKGCIYSSKASRPPIQKAYLDQFTKDF 204

Query: 170 ERFLNNRAKEIVPGGMIIITNPSIPDGMPFSEIANGLMYNCMGTILYDMVKVGLLSEAQV 229
             FL   ++E++  G +++T     D             + +   + D+V  G L E ++
Sbjct: 205 TTFLRIHSEELISRGRMLLTFICKEDEFDHPN-----SMDLLEMSINDLVIEGHLEEEKL 259

Query: 230 DSFNLPIYACPPGEFGAVVERNGNFRIEVMGLTNPS------------------PWLKGR 271
           DSFN+PIYA    E   +VE  G+F I  +   N                          
Sbjct: 260 DSFNVPIYAPSTEEVKRIVEEEGSFEILYLETFNAPYDAGFSIDDDYQGRSHSPVSCDEH 319

Query: 272 INMPEYIKHVRAATESMFNKHFSYEVTEEMFRQLLERLEEINDKMVSCYRDGVQLFAVLQ 331
                    VR+  E +   HF   +  ++  ++ +   ++       Y     +   L 
Sbjct: 320 ARAAHVASVVRSIYEPILASHFGEAILPDLSHRIAKNAAKVLRSGKGFY---DSVIISLA 376

Query: 332 R 332
           +
Sbjct: 377 K 377

PyMOL of 2efj

>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Length = 374	Back alignment and structure

>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Length = 359	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		333
2efj_A		384	3,7-dimethylxanthine methyltransferase; SAM-depend	100.0
1m6e_X		359	S-adenosyl-L-methionnine:salicylic acid carboxyl m	100.0
3b5i_A		374	S-adenosyl-L-methionine:salicylic acid carboxyl me	100.0
3ccf_A		279	Cyclopropane-fatty-acyl-phospholipid synthase; YP_	99.23
2p35_A		259	Trans-aconitate 2-methyltransferase; SAM dependent	99.13
2yqz_A		263	Hypothetical protein TTHA0223; RNA methyltransfera	99.02
3bus_A		273	REBM, methyltransferase; rebeccamycin synthesis; H	98.94
3dtn_A		234	Putative methyltransferase MM_2633; structural gen	98.91
3f4k_A		257	Putative methyltransferase; structural genomics, P	98.89
3hem_A		302	Cyclopropane-fatty-acyl-phospholipid synthase 2; p	98.84
3ujc_A		266	Phosphoethanolamine N-methyltransferase; parasite;	98.82
3kkz_A		267	Uncharacterized protein Q5LES9; putative methyltra	98.82
1kpg_A		287	CFA synthase;, cyclopropane-fatty-acyl-phospholipi	98.79
4gek_A		261	TRNA (CMO5U34)-methyltransferase; structural genom	98.75
3h2b_A		203	SAM-dependent methyltransferase; alpha-beta protei	98.71
3hnr_A		220	Probable methyltransferase BT9727_4108; structural	98.68
3sm3_A		235	SAM-dependent methyltransferases; NESG, structural	98.64
4htf_A		285	S-adenosylmethionine-dependent methyltransferase;	98.62
3dli_A		240	Methyltransferase; PSI-II, NYSGXRC, structural gen	98.6
3lcc_A		235	Putative methyl chloride transferase; halide methy	98.59
2o57_A		297	Putative sarcosine dimethylglycine methyltransfera	98.56
2a14_A		263	Indolethylamine N-methyltransferase; SGC,INMT, str	98.55
1pjz_A		203	Thiopurine S-methyltransferase; polymorphism, S-ad	98.55
2aot_A		292	HMT, histamine N-methyltransferase; classic methyl	98.5
1xtp_A		254	LMAJ004091AAA; SGPP, structural genomics, PSI, pro	98.5
1vl5_A		260	Unknown conserved protein BH2331; putative methylt	98.48
2fk8_A		318	Methoxy mycolic acid synthase 4; S-adenosylmethion	98.45
3bkx_A		275	SAM-dependent methyltransferase; YP_807781.1, cycl	98.44
3bgv_A		313	MRNA CAP guanine-N7 methyltransferase; alternative	98.44
3reo_A		368	(ISO)eugenol O-methyltransferase; directed evoluti	98.41
3ou2_A		218	SAM-dependent methyltransferase; O-methyltransfera	98.4
3dlc_A		219	Putative S-adenosyl-L-methionine-dependent methylt	98.38
3mgg_A		276	Methyltransferase; NYSGXRC, PSI-II, protein struct	98.38
1nkv_A		256	Hypothetical protein YJHP; structural genomics, PS	98.38
1ri5_A		298	MRNA capping enzyme; methyltransferase, M7G, messe	98.38
2g72_A		289	Phenylethanolamine N-methyltransferase; HET: SAM F	98.38
2vdw_A		302	Vaccinia virus capping enzyme D1 subunit; nucleoti	98.37
3p9c_A		364	Caffeic acid O-methyltransferase; S-adenosylmethio	98.37
3lst_A		348	CALO1 methyltransferase; calicheamicin, enediyne,	98.36
1xxl_A		239	YCGJ protein; structural genomics, protein structu	98.35
3ege_A		261	Putative methyltransferase from antibiotic biosyn	98.34
3vc1_A		312	Geranyl diphosphate 2-C-methyltransferase; rossman	98.31
2p7i_A		250	Hypothetical protein; putative methyltransferase,	98.3
2gb4_A		252	Thiopurine S-methyltransferase; 18204406, thiopuri	98.3
3dh0_A		219	SAM dependent methyltransferase; cystal structure,	98.3
3e23_A		211	Uncharacterized protein RPA2492; alpha-beta protei	98.29
3l8d_A		242	Methyltransferase; structural genomics, PSI, nysgr	98.29
3e8s_A		227	Putative SAM dependent methyltransferase; NP_74470	98.27
3mcz_A		352	O-methyltransferase; adomet_mtases, S-adenosylmeth	98.27
2ex4_A		241	Adrenal gland protein AD-003; methyltransferase, s	98.25
3gwz_A		369	MMCR; methyltransferase, mitomycin, S-adenosyl met	98.23
3jwh_A		217	HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena	98.23
3cc8_A		230	Putative methyltransferase; structural genomics, j	98.23
3cgg_A		195	SAM-dependent methyltransferase; NP_600671.1, meth	98.22
3ocj_A		305	Putative exported protein; structural genomics, PS	98.21
3dp7_A		363	SAM-dependent methyltransferase; structural genomi	98.21
3g5l_A		253	Putative S-adenosylmethionine dependent methyltran	98.21
2r3s_A		335	Uncharacterized protein; methyltransferase domain,	98.2
4a6d_A		353	Hydroxyindole O-methyltransferase; melatonin, circ	98.19
3i53_A		332	O-methyltransferase; CO-complex, rossmann-like fol	98.18
1vlm_A		219	SAM-dependent methyltransferase; possible histamin	98.18
3g5t_A		299	Trans-aconitate 3-methyltransferase; structural ge	98.15
3g2m_A		299	PCZA361.24; SAM-dependent methyltransferase, glyco	98.15
2ip2_A		334	Probable phenazine-specific methyltransferase; pyo	98.15
1y8c_A		246	S-adenosylmethionine-dependent methyltransferase;	98.13
2i62_A		265	Nicotinamide N-methyltransferase; structural genom	98.13
1qzz_A		374	RDMB, aclacinomycin-10-hydroxylase; anthracycline,	98.12
3i9f_A		170	Putative type 11 methyltransferase; structural gen	98.09
3bkw_A		243	MLL3908 protein, S-adenosylmethionine dependent me	98.08
3jwg_A		219	HEN1, methyltransferase type 12; 1.90A {Clostridiu	98.08
3pfg_A		263	N-methyltransferase; N,N-dimethyltransferase, SAM	98.07
1fp1_D		372	Isoliquiritigenin 2'-O-methyltransferase; protein-	98.06
2kw5_A		202	SLR1183 protein; structural genomics, northeast st	98.06
3ofk_A		216	Nodulation protein S; NODS, N-methyltransferase, S	98.06
2ld4_A		176	Anamorsin; methyltransferase-like fold, alpha/beta	98.05
3ggd_A		245	SAM-dependent methyltransferase; YP_325210.1, stru	98.04
1x19_A		359	CRTF-related protein; methyltransferase, bacterioc	98.03
2xvm_A		199	Tellurite resistance protein TEHB; antibiotic resi	98.01
1tw3_A		360	COMT, carminomycin 4-O-methyltransferase; anthracy	98.0
2zfu_A		215	Nucleomethylin, cerebral protein 1; nucleolar prot	97.99
1zg3_A		358	Isoflavanone 4'-O-methyltransferase; rossman fold,	97.99
2qe6_A		274	Uncharacterized protein TFU_2867; putative methylt	97.96
1fp2_A		352	Isoflavone O-methyltransferase; protein-product co	97.92
4hg2_A		257	Methyltransferase type 11; structural genomics, PS	97.91
2p8j_A		209	S-adenosylmethionine-dependent methyltransferase;	97.91
4e2x_A		416	TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s	97.89
3giw_A		277	Protein of unknown function DUF574; rossmann-fold	97.82
1yzh_A		214	TRNA (guanine-N(7)-)-methyltransferase; alpha-beta	97.81
3g07_A		292	7SK snRNA methylphosphate capping enzyme; structur	97.8
3gu3_A		284	Methyltransferase; alpha-beta protein, structural	97.78
2gs9_A		211	Hypothetical protein TT1324; methyl transferase, s	97.76
3grz_A		205	L11 mtase, ribosomal protein L11 methyltransferase	97.75
3thr_A		293	Glycine N-methyltransferase; GNMT, folate, methylt	97.75
4fsd_A		383	Arsenic methyltransferase; rossmann fold; 1.75A {C	97.71
3m70_A		286	Tellurite resistance protein TEHB homolog; structu	97.68
3opn_A		232	Putative hemolysin; structural genomics, PSI-2, pr	97.58
3lbf_A		210	Protein-L-isoaspartate O-methyltransferase; modifi	97.52
1ve3_A		227	Hypothetical protein PH0226; dimer, riken structur	97.49
3evz_A		230	Methyltransferase; NYSGXRC, NEW YORK SGX research	97.49
2pxx_A		215	Uncharacterized protein MGC2408; structural genomi	97.49
3dmg_A		381	Probable ribosomal RNA small subunit methyltransf;	97.48
3mq2_A		218	16S rRNA methyltransferase; methyltranferase, ribo	97.46
2avn_A		260	Ubiquinone/menaquinone biosynthesis methyltransfe	97.44
3q87_B		170	N6 adenine specific DNA methylase; SAM-methyltrans	97.41
1dus_A		194	MJ0882; hypothetical protein, methanococcus jannas	97.4
3hm2_A		178	Precorrin-6Y C5,15-methyltransferase; alpha-beta-s	97.38
2plw_A		201	Ribosomal RNA methyltransferase, putative; malaria	97.37
3bxo_A		239	N,N-dimethyltransferase; desosamine, sugar, carboh	97.36
3p9n_A		189	Possible methyltransferase (methylase); RV2966C, a	97.35
3iv6_A		261	Putative Zn-dependent alcohol dehydrogenase; alpha	97.34
3mti_A		185	RRNA methylase; SAM-dependent, PSI, MCSG, structur	97.34
4df3_A		233	Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase;	97.32
3e05_A		204	Precorrin-6Y C5,15-methyltransferase (decarboxyla;	97.32
3m33_A		226	Uncharacterized protein; structural genomics, PSI-	97.29
3d2l_A		243	SAM-dependent methyltransferase; ZP_00538691.1, st	97.25
1wzn_A		252	SAM-dependent methyltransferase; structural genomi	97.25
3uwp_A		438	Histone-lysine N-methyltransferase, H3 lysine-79;	97.21
2fca_A		213	TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac	97.19
3fzg_A		200	16S rRNA methylase; methyltransferase, plasmid, tr	97.19
3dxy_A		218	TRNA (guanine-N(7)-)-methyltransferase; rossmann f	97.15
1zx0_A		236	Guanidinoacetate N-methyltransferase; structural g	97.12
3q7e_A		349	Protein arginine N-methyltransferase 1; HET: SAH;	97.1
3ckk_A		235	TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-	97.09
3hp7_A		291	Hemolysin, putative; structural genomics, APC64019	97.06
3r0q_C		376	Probable protein arginine N-methyltransferase 4.2;	97.02
1ej0_A		180	FTSJ; methyltransferase, adoMet, adenosyl methioni	96.96
2fyt_A		340	Protein arginine N-methyltransferase 3; structural	96.94
1g6q_1		328	HnRNP arginine N-methyltransferase; SAM-binding do	96.93
2yxe_A		215	Protein-L-isoaspartate O-methyltransferase; rossma	96.84
1vbf_A		231	231AA long hypothetical protein-L-isoaspartate O-	96.79
1jg1_A		235	PIMT;, protein-L-isoaspartate O-methyltransferase;	96.76
4dzr_A		215	Protein-(glutamine-N5) methyltransferase, release	96.75
1af7_A		274	Chemotaxis receptor methyltransferase CHER; chemot	96.75
2pjd_A		343	Ribosomal RNA small subunit methyltransferase C; g	96.73
4dcm_A		375	Ribosomal RNA large subunit methyltransferase G; 2	96.72
2b3t_A		276	Protein methyltransferase HEMK; translation termin	96.69
2nxc_A		254	L11 mtase, ribosomal protein L11 methyltransferase	96.69
2yxd_A		183	Probable cobalt-precorrin-6Y C(15)-methyltransfer	96.68
3eey_A		197	Putative rRNA methylase; rRNA methylation, S-adeno	96.65
1u2z_A		433	Histone-lysine N-methyltransferase, H3 lysine-79 s	96.64
1l3i_A		192	Precorrin-6Y methyltransferase/putative decarboxyl	96.61
3lpm_A		259	Putative methyltransferase; structural genomics, p	96.61
2nyu_A		196	Putative ribosomal RNA methyltransferase 2; SAM, s	96.57
3p2e_A		225	16S rRNA methylase; methyltransferase, transferase	96.54
2ozv_A		260	Hypothetical protein ATU0636; structural genomics,	96.49
2fhp_A		187	Methylase, putative; alpha-beta-alpha sandwich, st	96.49
2ift_A		201	Putative methylase HI0767; NESG, Y767_haein, struc	96.47
1dl5_A		317	Protein-L-isoaspartate O-methyltransferase; isoasp	96.44
1ws6_A		171	Methyltransferase; structural genomics, riken stru	96.41
2fpo_A		202	Methylase YHHF; structural genomics, putative meth	96.39
2esr_A		177	Methyltransferase; structural genomics, hypothetic	96.39
3njr_A		204	Precorrin-6Y methylase; methyltransferase, decarbo	96.38
3gdh_A		241	Trimethylguanosine synthase homolog; M7G, CAP, dim	96.38
1fbn_A		230	MJ fibrillarin homologue; MJ proteins, ribosomal R	96.37
1jsx_A		207	Glucose-inhibited division protein B; methyltransf	96.32
2pbf_A		227	Protein-L-isoaspartate O-methyltransferase beta-A	96.32
3bwc_A		304	Spermidine synthase; SAM, SGPP, structura genomics	96.28
4hc4_A		376	Protein arginine N-methyltransferase 6; HRMT1L6, S	96.25
3orh_A		236	Guanidinoacetate N-methyltransferase; structura ge	96.25
1r18_A		227	Protein-L-isoaspartate(D-aspartate)-O-methyltrans;	96.21
2h00_A		254	Methyltransferase 10 domain containing protein; st	96.19
1nt2_A		210	Fibrillarin-like PRE-rRNA processing protein; adeM	96.11
1xdz_A		240	Methyltransferase GIDB; MCSG, protein structure in	96.11
1o9g_A		250	RRNA methyltransferase; antibiotic resistance, Se-	95.96
2b25_A		336	Hypothetical protein; structural genomics, methyl	95.94
1i1n_A		226	Protein-L-isoaspartate O-methyltransferase; S-aden	95.88
3u81_A		221	Catechol O-methyltransferase; neurotransmitter deg	95.88
1p91_A		269	Ribosomal RNA large subunit methyltransferase A; R	95.88
3gjy_A		317	Spermidine synthase; APC62791, structural genomics	95.86
1uir_A		314	Polyamine aminopropyltransferase; spermidien synth	95.77
3mb5_A		255	SAM-dependent methyltransferase; RNA methyltransfe	95.73
2y1w_A		348	Histone-arginine methyltransferase CARM1; histone	95.7
3lcv_B		281	Sisomicin-gentamicin resistance methylase SGM; ant	95.69
2gpy_A		233	O-methyltransferase; structural genomics, PSI, pro	95.61
3fpf_A		298	Mtnas, putative uncharacterized protein; thermonic	95.44
3sso_A		419	Methyltransferase; macrolide, natural product, ros	95.43
2vdv_E		246	TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl	95.42
3id6_C		232	Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase;	95.41
3htx_A		950	HEN1; HEN1, small RNA methyltransferase, protein-R	95.38
3g89_A		249	Ribosomal RNA small subunit methyltransferase G; 1	95.35
2ipx_A		233	RRNA 2'-O-methyltransferase fibrillarin; FBL, stru	95.26
3ntv_A		232	MW1564 protein; rossmann fold, putative methyltran	95.26
1iy9_A		275	Spermidine synthase; rossmann fold, structural gen	95.14
3b3j_A		480	Histone-arginine methyltransferase CARM1; protein	95.14
3bzb_A		281	Uncharacterized protein; RED ALGA, protein structu	95.09
3frh_A		253	16S rRNA methylase; methyltransferase domain, heli	95.07
1inl_A		296	Spermidine synthase; beta-barrel, rossman fold, st	94.93
2hnk_A		239	SAM-dependent O-methyltransferase; modified rossma	94.86
1i9g_A		280	Hypothetical protein RV2118C; mtase, adoMet, cryst	94.83
3tma_A		354	Methyltransferase; thump domain; 2.05A {Thermus th	94.77
3adn_A		294	Spermidine synthase; aminopropyltransferase, polya	94.74
2oxt_A		265	Nucleoside-2'-O-methyltransferase; flavivirus, vir	94.72
1xj5_A		334	Spermidine synthase 1; structural genomics, protei	94.69
3dou_A		191	Ribosomal RNA large subunit methyltransferase J; c	94.6
1g8a_A		227	Fibrillarin-like PRE-rRNA processing protein; rRNA	94.56
3ajd_A		274	Putative methyltransferase MJ0026; tRNA, M5C, ross	94.55
1yb2_A		275	Hypothetical protein TA0852; structural genomics,	94.52
2p41_A		305	Type II methyltransferase; vizier, viral enzymes i	94.48
1ixk_A		315	Methyltransferase; open beta sheet; 1.90A {Pyrococ	94.48
1mjf_A		281	Spermidine synthase; spermidine synthetase, struct	94.39
2i7c_A		283	Spermidine synthase; transferase, structural genom	94.37
2frx_A		479	Hypothetical protein YEBU; rossmann-type S-adenosy	94.3
2pt6_A		321	Spermidine synthase; transferase, structural genom	94.23
1o54_A		277	SAM-dependent O-methyltransferase; TM0748, structu	94.18
2yvl_A		248	TRMI protein, hypothetical protein; tRNA, methyltr	94.12
2xyq_A		290	Putative 2'-O-methyl transferase; transferase-vira	94.09
2wa2_A		276	Non-structural protein 5; transferase, S-adenosyl-	94.02
1sqg_A		429	SUN protein, FMU protein; rossmann-fold, mixed bet	93.87
2pwy_A		258	TRNA (adenine-N(1)-)-methyltransferase; mtase, ado	93.82
3tr6_A		225	O-methyltransferase; cellular processes; HET: SAH;	93.76
1nv8_A		284	HEMK protein; class I adoMet-dependent methyltrans	93.62
2b2c_A		314	Spermidine synthase; beta-alpha, transferase; 2.50	93.61
3duw_A		223	OMT, O-methyltransferase, putative; alternating of	93.43
3tfw_A		248	Putative O-methyltransferase; PSI-biology, nysgrc,	93.35
2yxl_A		450	PH0851 protein, 450AA long hypothetical FMU protei	93.34
2o07_A		304	Spermidine synthase; structural genomics, structur	93.25
2frn_A		278	Hypothetical protein PH0793; structural genomics,	93.18
3dr5_A		221	Putative O-methyltransferase; Q8NRD3, CGL1119, PF0	92.79
2igt_A		332	SAM dependent methyltransferase; alpha-beta sandwi	92.51
1wxx_A		382	TT1595, hypothetical protein TTHA1280; thermus the	92.29
2f8l_A		344	Hypothetical protein LMO1582; structural genomics,	92.1
4dmg_A		393	Putative uncharacterized protein TTHA1493; rRNA, m	91.58
3tqs_A		255	Ribosomal RNA small subunit methyltransferase A; p	91.38
2ih2_A		421	Modification methylase TAQI; DNA, DNA methyltransf	90.57
3m6w_A		464	RRNA methylase; rRNA methyltransferase, 5-methylcy	90.54
3gru_A		295	Dimethyladenosine transferase; rossman fold, ribos	90.37
1zq9_A		285	Probable dimethyladenosine transferase; SGC, struc	90.3
1ne2_A		200	Hypothetical protein TA1320; structural genomics,	90.21
4azs_A		569	Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15	89.17
2as0_A		396	Hypothetical protein PH1915; RNA methyltransferase	89.03
3kr9_A		225	SAM-dependent methyltransferase; class I rossmann-	88.95
3v97_A		703	Ribosomal RNA large subunit methyltransferase L; Y	88.91
3m4x_A		456	NOL1/NOP2/SUN family protein; mtase domain, PUA do	88.49
1wy7_A		207	Hypothetical protein PH1948; seven-stranded beta s	87.71
2h1r_A		299	Dimethyladenosine transferase, putative; SGC toron	86.83
3c0k_A		396	UPF0064 protein YCCW; PUA domain, adoMet dependent	86.43
3lec_A		230	NADB-rossmann superfamily protein; PSI, MCSG, stru	86.41
3fut_A		271	Dimethyladenosine transferase; methyltransferase,	83.85
3khk_A		544	Type I restriction-modification system methylation	83.83
2okc_A		445	Type I restriction enzyme stysji M protein; NP_813	83.03
1qam_A		244	ERMC' methyltransferase; rRNA methyltransferase ER	81.37
3gnl_A		244	Uncharacterized protein, DUF633, LMOF2365_1472; st	80.91
3tm4_A		373	TRNA (guanine N2-)-methyltransferase TRM14; rossma	80.81
2qm3_A		373	Predicted methyltransferase; putative methyltransf	80.52
3lkd_A		542	Type I restriction-modification system methyltrans	80.1

>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A*	Back alignment and structure

Probab=100.00  E-value=3.5e-91  Score=683.26  Aligned_cols=321  Identities=29%  Similarity=0.466  Sum_probs=278.4

Q ss_pred             ChhhhhhhHHHHHHHHHHhhhcccCCCCCCcEEEEeecCCCCcccHHHHHHHHHHHHHHhhhcCCCCCCCcceEEecCCC
Q 040129            1 RLATNVTKDHIHDAIIRKLDVKSLADSSSNTIRLADCGCAVGPNTFNAMQDLIEIVKHKYKSQCPNSQNPEFHVSFNDQS   80 (333)
Q Consensus         1 ~~~~~~~~~~l~~ai~~~~~~~~~~~~~~~~~~IaD~GCs~G~Ns~~~~~~ii~~i~~~~~~~~~~~~~~~~~v~~nDlP   80 (333)
                      |+++..+||++++||.+++... .++ .+++++|||||||+|+||+.+++.||++|+++|.+...++++|+|||||||||
T Consensus        25 ~~~~~~~~~~~~~ai~~l~~~~-~~~-~~~~~~IaDlGCssG~NT~~~v~~ii~~i~~~~~~~~~~~~~pe~~v~~nDLp  102 (384)
T 2efj_A           25 NLFLIRVKPVLEQCIQELLRAN-LPN-INKCFKVGDLGCASGPNTFSTVRDIVQSIDKVGQEKKNELERPTIQIFLNDLF  102 (384)
T ss_dssp             TTTHHHHHHHHHHHHHHHHHTT-CTT-TTTEEEEEEETCCSSHHHHHHHHHHHHHHTCC----------CEEEEEEECCT
T ss_pred             HHHHHHHHHHHHHHHHHhhhcc-cCC-cCCceEEEecCCCCCchHHHHHHHHHHHHHHHhhhcccCCCCCceEEEecCCC
Confidence            5788999999999999988643 111 13389999999999999999999999999999865212345789999999999


Q ss_pred             CCchHHHhhcCCcc------------ccceeeccCcccccccCCCCceeEEEeccccccccCCCccccCCCCCCCCCCce
Q 040129           81 SNDFNTLFTSLPQE------------IHFFVAGVPGSFHKRLFPEKFLHLVHVSYALHWLSKVPEGLLDKNSPAWNKGRI  148 (333)
Q Consensus        81 ~NDFn~lF~~l~~~------------~~~f~~~vpgSFy~rlfP~~Sv~~~~Ss~alHWLS~vP~~l~~~~~~~~nkg~i  148 (333)
                      +||||+||++||.+            .+||++|||||||+||||++|+|++||++||||||++|+.+.++.|++||||+|
T Consensus       103 ~NDFN~lF~~L~~~~~~~~~~~g~~~~~~f~~gvpgSFy~rlfp~~S~d~v~Ss~aLHWls~~p~~l~~~~s~~~nkg~i  182 (384)
T 2efj_A          103 QNDFNSVFKLLPSFYRNLEKENGRKIGSCLIGAMPGSFYSRLFPEESMHFLHSCYCLHWLSQVPSGLVTELGISVNKGCI  182 (384)
T ss_dssp             TSCHHHHHHHHHHHHHHHHHHTCCCTTSEEEEECCSCTTSCCSCTTCEEEEEEESCTTBCSSSCCC------CCCCTTCS
T ss_pred             ccchHHHHhhhhhhHhhhhhhccCCCCceEEEecchhhhhccCCCCceEEEEecceeeecCCCchhhhccccccccCCce
Confidence            99999999999862            369999999999999999999999999999999999999999999999999999


Q ss_pred             eecCC-CHHHHHHHHHHHHHhHHHHHHhhhhhhccCceEEEEecCCCCC--CCCccchhhHHHHHHHHHHHHHHhccCCC
Q 040129          149 HYAFA-PEVVVKAYANQFAKDLERFLNNRAKEIVPGGMIIITNPSIPDG--MPFSEIANGLMYNCMGTILYDMVKVGLLS  225 (333)
Q Consensus       149 ~~~~~-~~~v~~ay~~Q~~~D~~~FL~~Ra~EL~~GG~mvl~~~gr~~~--~~~~~~~~~~~~~~l~~~l~~mv~eG~i~  225 (333)
                      ||+++ |++|.+||++||++||..||++|++||||||+||++++|+++.  ++.++       +.|.++|++|+.||+|+
T Consensus       183 ~i~~~sp~~v~~ay~~Qf~~D~~~FL~~Ra~eL~pGG~mvl~~~gr~~~~~~~~~~-------~~l~~al~~lv~eGli~  255 (384)
T 2efj_A          183 YSSKASRPPIQKAYLDQFTKDFTTFLRIHSEELISRGRMLLTFICKEDEFDHPNSM-------DLLEMSINDLVIEGHLE  255 (384)
T ss_dssp             SSCTTSCHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEEECCCTTTCCCCHH-------HHHHHHHHHHHHHTSSC
T ss_pred             EecCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhccCCeEEEEEecCCCcccCcccH-------HHHHHHHHHHHHhCCcc
Confidence            99998 8999999999999999999999999999999999999999987  66543       39999999999999999


Q ss_pred             HhhhhcCCcCcccCCHHHHHHHHHhCCcEEEeEEEEeC-CCCCC---cC--------------CCChhHHHHHHHHHhhh
Q 040129          226 EAQVDSFNLPIYACPPGEFGAVVERNGNFRIEVMGLTN-PSPWL---KG--------------RINMPEYIKHVRAATES  287 (333)
Q Consensus       226 ~~~~d~fn~P~y~ps~~E~~~~ie~~G~F~I~~le~~~-p~~~~---~~--------------~~~~~~~a~~iRa~~e~  287 (333)
                      ++++|+||+|+|+||.+||+++|+++|+|+|+++|+++ +....   ++              ...|+.+++++||++||
T Consensus       256 ~ek~dsf~~P~y~ps~~E~~~~le~~g~F~i~~le~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~g~~~a~~iRa~~ep  335 (384)
T 2efj_A          256 EEKLDSFNVPIYAPSTEEVKRIVEEEGSFEILYLETFNAPYDAGFSIDDDYQGRSHSPVSCDEHARAAHVASVVRSIYEP  335 (384)
T ss_dssp             HHHHHTCCCSBCCCCHHHHHHHHHHHCSEEEEEEEEEEEETTTTCCC---------CCSHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hhhhcccCCcccCCCHHHHHHHHHHcCCceEEEEEEEeecccccccccccccccccccccchHhHhHHHhhhhhHHhhhh
Confidence            99999999999999999999999999999999999986 11111   11              13568999999999999


Q ss_pred             hhhhhcChHHHHHHHHHHHHHHHHhhhhhhhcCCCcEEEEEEEeeC
Q 040129          288 MFNKHFSYEVTEEMFRQLLERLEEINDKMVSCYRDGVQLFAVLQRL  333 (333)
Q Consensus       288 ~l~~hfgeei~delf~r~~~~l~~~~~~~~~~~~~~~~~~~~l~r~  333 (333)
                      +|.+|||++++|++|+||++++++++..   ++.++++++++|+|+
T Consensus       336 ll~~hfG~~i~d~lF~ry~~~~~~~~~~---~~~~~~~~~~~L~k~  378 (384)
T 2efj_A          336 ILASHFGEAILPDLSHRIAKNAAKVLRS---GKGFYDSVIISLAKK  378 (384)
T ss_dssp             HHHHHHCSTTHHHHHHHHHHHHHHHHHH---TCCEEEEEEEEEEEC
T ss_pred             hhHHhccHHHHHHHHHHHHHHHHHHHhh---CCCceEEEEEEEEEc
Confidence            9999999999999999999999999988   888899999999996

PyMOL of 2efj

>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35	Back alignment and structure

>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana}	Back alignment and structure

>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413}	Back alignment and structure

>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str}	Back alignment and structure

>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A	Back alignment and structure

>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes}	Back alignment and structure

>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei}	Back alignment and structure

>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A*	Back alignment and structure

>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A*	Back alignment and structure

>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A*	Back alignment and structure

>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A*	Back alignment and structure

>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A*	Back alignment and structure

>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A*	Back alignment and structure

>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian}	Back alignment and structure

>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei}	Back alignment and structure

>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli}	Back alignment and structure

>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus}	Back alignment and structure

>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana}	Back alignment and structure

>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18	Back alignment and structure

>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15	Back alignment and structure

>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36	Back alignment and structure

>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A*	Back alignment and structure

>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42	Back alignment and structure

>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41	Back alignment and structure

>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A*	Back alignment and structure

>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei}	Back alignment and structure

>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A*	Back alignment and structure

>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A*	Back alignment and structure

>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A*	Back alignment and structure

>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis}	Back alignment and structure

>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei}	Back alignment and structure

>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21	Back alignment and structure

>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A*	Back alignment and structure

>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ...	Back alignment and structure

>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus}	Back alignment and structure

>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A*	Back alignment and structure

>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora}	Back alignment and structure

>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A*	Back alignment and structure

>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A*	Back alignment and structure

>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A	Back alignment and structure

>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A*	Back alignment and structure

>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus}	Back alignment and structure

>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris}	Back alignment and structure

>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis}	Back alignment and structure

>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440}	Back alignment and structure

>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis}	Back alignment and structure

>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42	Back alignment and structure

>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A*	Back alignment and structure

>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A	Back alignment and structure

>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus}	Back alignment and structure

>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis}	Back alignment and structure

>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus}	Back alignment and structure

>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str}	Back alignment and structure

>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme}	Back alignment and structure

>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A*	Back alignment and structure

>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A*	Back alignment and structure

>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41	Back alignment and structure

>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae}	Back alignment and structure

>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A*	Back alignment and structure

>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa}	Back alignment and structure

>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43	Back alignment and structure

>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A*	Back alignment and structure

>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A*	Back alignment and structure

>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus}	Back alignment and structure

>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti}	Back alignment and structure

>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A	Back alignment and structure

>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A*	Back alignment and structure

>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A*	Back alignment and structure

>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A	Back alignment and structure

>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A*	Back alignment and structure

>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A	Back alignment and structure

>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413}	Back alignment and structure

>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A*	Back alignment and structure

>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A*	Back alignment and structure

>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A*	Back alignment and structure

>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens}	Back alignment and structure

>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A*	Back alignment and structure

>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca}	Back alignment and structure

>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A*	Back alignment and structure

>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans}	Back alignment and structure

>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum}	Back alignment and structure

>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A*	Back alignment and structure

>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A*	Back alignment and structure

>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53	Back alignment and structure

>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens}	Back alignment and structure

>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A	Back alignment and structure

>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus}	Back alignment and structure

>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp}	Back alignment and structure

>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A*	Back alignment and structure

>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A	Back alignment and structure

>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae}	Back alignment and structure

>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp}	Back alignment and structure

>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli}	Back alignment and structure

>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43	Back alignment and structure

>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus}	Back alignment and structure

>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens}	Back alignment and structure

>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A*	Back alignment and structure

>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP}	Back alignment and structure

>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41	Back alignment and structure

>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi}	Back alignment and structure

>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4	Back alignment and structure

>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae}	Back alignment and structure

>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum}	Back alignment and structure

>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae}	Back alignment and structure

>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis}	Back alignment and structure

>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides}	Back alignment and structure

>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A*	Back alignment and structure

>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix}	Back alignment and structure

>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0	Back alignment and structure

>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans}	Back alignment and structure

>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15}	Back alignment and structure

>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43	Back alignment and structure

>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A*	Back alignment and structure

>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53	Back alignment and structure

>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli}	Back alignment and structure

>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A*	Back alignment and structure

>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*	Back alignment and structure

>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A*	Back alignment and structure

>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens}	Back alignment and structure

>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus}	Back alignment and structure

>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana}	Back alignment and structure

>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A*	Back alignment and structure

>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A*	Back alignment and structure

>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6	Back alignment and structure

>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii}	Back alignment and structure

>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7	Back alignment and structure

>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A*	Back alignment and structure

>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp}	Back alignment and structure

>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A*	Back alignment and structure

>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli}	Back alignment and structure

>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli}	Back alignment and structure

>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A*	Back alignment and structure

>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A*	Back alignment and structure

>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii}	Back alignment and structure

>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405}	Back alignment and structure

>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31	Back alignment and structure

>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A*	Back alignment and structure

>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes}	Back alignment and structure

>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens}	Back alignment and structure

>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A*	Back alignment and structure

>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str}	Back alignment and structure

>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46	Back alignment and structure

>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46	Back alignment and structure

>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1	Back alignment and structure

>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46	Back alignment and structure

>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46	Back alignment and structure

>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46	Back alignment and structure

>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus}	Back alignment and structure

>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A*	Back alignment and structure

>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A	Back alignment and structure

>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20	Back alignment and structure

>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum}	Back alignment and structure

>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A*	Back alignment and structure

>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens}	Back alignment and structure

>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*	Back alignment and structure

>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7	Back alignment and structure

>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54	Back alignment and structure

>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3	Back alignment and structure

>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20	Back alignment and structure

>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A	Back alignment and structure

>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13	Back alignment and structure

>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A*	Back alignment and structure

>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ...	Back alignment and structure

>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33	Back alignment and structure

>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A*	Back alignment and structure

>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C*	Back alignment and structure

>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A	Back alignment and structure

>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A*	Back alignment and structure

>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans}	Back alignment and structure

>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A*	Back alignment and structure

>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A*	Back alignment and structure

>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E	Back alignment and structure

>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E*	Back alignment and structure

>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana}	Back alignment and structure

>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A*	Back alignment and structure

>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens}	Back alignment and structure

>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus}	Back alignment and structure

>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17	Back alignment and structure

>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus}	Back alignment and structure

>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae}	Back alignment and structure

>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A*	Back alignment and structure

>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A*	Back alignment and structure

>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans}	Back alignment and structure

>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13	Back alignment and structure

>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus}	Back alignment and structure

>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus}	Back alignment and structure

>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A	Back alignment and structure

>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0	Back alignment and structure

>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A	Back alignment and structure

>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A	Back alignment and structure

>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13	Back alignment and structure

>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A*	Back alignment and structure

>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38	Back alignment and structure

>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A*	Back alignment and structure

>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A*	Back alignment and structure

>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli}	Back alignment and structure

>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A*	Back alignment and structure

>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13	Back alignment and structure

>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus}	Back alignment and structure

>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A*	Back alignment and structure

>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A*	Back alignment and structure

>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A	Back alignment and structure

>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus}	Back alignment and structure

>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0	Back alignment and structure

>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A*	Back alignment and structure

>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17	Back alignment and structure

>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A*	Back alignment and structure

>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp}	Back alignment and structure

>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii}	Back alignment and structure

>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A*	Back alignment and structure

>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A*	Back alignment and structure

>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum}	Back alignment and structure

>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51	Back alignment and structure

>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A*	Back alignment and structure

>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45	Back alignment and structure

>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus}	Back alignment and structure

>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0	Back alignment and structure

>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A*	Back alignment and structure

>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A*	Back alignment and structure

>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A*	Back alignment and structure

>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24	Back alignment and structure

>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32	Back alignment and structure

>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A*	Back alignment and structure

>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51	Back alignment and structure

>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A*	Back alignment and structure

>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A*	Back alignment and structure

>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium}	Back alignment and structure

>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32	Back alignment and structure

>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum}	Back alignment and structure

>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12}	Back alignment and structure

>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae}	Back alignment and structure

>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A*	Back alignment and structure

>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei}	Back alignment and structure

>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45	Back alignment and structure

>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A	Back alignment and structure

>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str}	Back alignment and structure

>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A*	Back alignment and structure

>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638}	Back alignment and structure

>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		333
d1m6ex_		359	c.66.1.35 (X:) Salicylic acid carboxyl methyltrans	9e-91

>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Length = 359	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Salicylic acid carboxyl methyltransferase (SAMT)
domain: Salicylic acid carboxyl methyltransferase (SAMT)
species: Clarkia breweri [TaxId: 36903]

 Score =  273 bits (699), Expect = 9e-91
 Identities = 107/347 (30%), Positives = 163/347 (46%), Gaps = 31/347 (8%)

Query: 1   RLATNVTKDHIHDAIIRKLDVKSLADSSSNTIRLADCGCAVGPNTFNAMQDLIEIVKHKY 60
           R   ++TK     AI          D+ +  + +AD GC+ GPN   A+ +LI+ V+   
Sbjct: 26  RQVISITKPITEAAITALYS----GDTVTTRLAIADLGCSSGPNALFAVTELIKTVEELR 81

Query: 61  KSQCPNSQNPEFHVSFNDQSSNDFNTLFTSLPQEIHF----FVAGVPGSFHKRLFPEKFL 116
           K     + +PE+ +  ND   NDFN +F SLP E       F+ GVPGSF+ RLFP   L
Sbjct: 82  KKMGREN-SPEYQIFLNDLPGNDFNAIFRSLPIENDVDGVCFINGVPGSFYGRLFPRNTL 140

Query: 117 HLVHVSYALHWLSKVPEGLLDKNSPAWNKGRIHYAFA-PEVVVKAYANQFAKDLERFLNN 175
           H +H SY+L WLS+VP G+        NKG I+ A   P+ V+ AY  QF +D   FL  
Sbjct: 141 HFIHSSYSLMWLSQVPIGI------ESNKGNIYMANTCPQSVLNAYYKQFQEDHALFLRC 194

Query: 176 RAKEIVPGGMIIITNPSIPDGMPFSEIANGLMYNCMGTILYDMVKVGLLSEAQVDSFNLP 235
           RA+E+VPGG +++T          S     L++  +   L  MV  GL+ E ++D FN+P
Sbjct: 195 RAQEVVPGGRMVLTILGRRSEDRAST-ECCLIWQLLAMALNQMVSEGLIEEEKMDKFNIP 253

Query: 236 IYACPPGEFGAVVERNGNFRIEVMGLTNPSPWLKGRINMPE----------YIKHVRAAT 285
            Y   P E  A + + G+F I+ +  +    W     +               + +RA  
Sbjct: 254 QYTPSPTEVEAEILKEGSFLIDHIEAS-EIYWSSCTKDGDGGGSVEEEGYNVARCMRAVA 312

Query: 286 ESMFNKHFSYEVTEEMFRQLLERLEEINDKMVSCYRDGVQLFAVLQR 332
           E +   HF   + E++F +    + E   +M       + +   L R
Sbjct: 313 EPLLLDHFGEAIIEDVFHRYKLLIIE---RMSKEKTKFINVIVSLIR 356

PyMOL of d1m6ex_

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		333
d1m6ex_		359	Salicylic acid carboxyl methyltransferase (SAMT) {	100.0
d2a14a1		257	Indolethylamine N-methyltransferase, INMT {Human (	99.04
d1vl5a_		231	Hypothetical protein BH2331 {Bacillus halodurans [	98.95
d1im8a_		225	Hypothetical protein HI0319 (YecO) {Haemophilus in	98.91
d2fk8a1		280	Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri	98.83
d2o57a1		282	Putative sarcosine dimethylglycine methyltransfera	98.83
d1xxla_		234	Hypothetical protein YcgJ {Bacillus subtilis [TaxI	98.78
d2g72a1		263	Phenylethanolamine N-methyltransferase, PNMTase {H	98.73
d1tw3a2		253	Carminomycin 4-O-methyltransferase {Streptomyces p	98.72
d2ex4a1		222	Adrenal gland protein AD-003 (C9orf32) {Human (Hom	98.7
d1jqea_		280	Histamine methyltransferase {Human (Homo sapiens)	98.7
d1xtpa_		254	Hypothetical protein Lmaj004091aaa (LmjF30.0810) {	98.69
d1kpia_		291	CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]}	98.68
d1qzza2		256	Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu	98.6
d1nkva_		245	Hypothetical Protein YjhP {Escherichia coli [TaxId	98.58
d1ve3a1		226	Hypothetical protein PH0226 {Archaeon Pyrococcus h	98.58
d1vlma_		208	Possible histamine N-methyltransferase TM1293 {The	98.54
d1kpga_		285	CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]}	98.51
d1pjza_		201	Thiopurine S-methyltransferase {Pseudomonas syring	98.49
d1fp1d2		244	Chalcone O-methyltransferase {Alfalfa (Medicago sa	98.39
d2bzga1		229	Thiopurine S-methyltransferase {Human (Homo sapien	98.37
d2p7ia1		225	Hypothetical protein ECA1738 {Erwinia carotovora [	98.34
d2i6ga1		198	Putative methyltransferase TehB {Salmonella typhim	98.33
d1ri5a_		252	mRNA cap (Guanine N-7) methyltransferase {Fungus (	98.27
d1wzna1		251	Hypothetical methyltransferase PH1305 {Archaeon Py	98.14
d1fp2a2		244	Isoflavone O-methyltransferase {Alfalfa (Medicago	98.12
d1kyza2		243	Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra	98.02
d2avna1		246	Hypothetical methyltransferase TM1389 {Thermotoga	97.99
d1y8ca_		246	Putative methyltransferase CAC2371 {Clostridium ac	97.92
d2gh1a1		281	Methyltransferase BC2162 {Bacillus cereus [TaxId:	97.8
d1p91a_		268	rRNA methyltransferase RlmA {Escherichia coli [Tax	97.74
d1dl5a1		213	Protein-L-isoaspartyl O-methyltransferase {Thermot	97.57
d2fcaa1		204	tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil	97.52
d1xvaa_		292	Glycine N-methyltransferase {Rat (Rattus norvegicu	97.45
d1nw3a_		328	Catalytic, N-terminal domain of histone methyltran	97.38
d1g6q1_		328	Arginine methyltransferase, HMT1 {Baker's yeast (S	97.38
d1i1na_		224	Protein-L-isoaspartyl O-methyltransferase {Human (	97.38
d1dusa_		194	Hypothetical protein MJ0882 {Archaeon Methanococcu	97.36
d1g8sa_		230	Fibrillarin homologue {Archaeon Methanococcus jann	97.21
d1yzha1		204	tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep	97.21
d1l3ia_		186	Precorrin-6Y methyltransferase (CbiT) {Archaeon Me	97.03
d1yb2a1		250	Hypothetical protein Ta0852 {Thermoplasma acidophi	96.98
d2fyta1		311	Protein arginine N-methyltransferase 3, PRMT3 {Hum	96.94
d1oria_		316	Protein arginine N-methyltransferase 1, PRMT1 {Rat	96.91
d2nxca1		254	PrmA-like protein TTHA0656 (TT0836) {Thermus therm	96.86
d1vbfa_		224	Protein-L-isoaspartyl O-methyltransferase {Sulfolo	96.77
d2b3ta1		274	N5-glutamine methyltransferase, HemK {Escherichia	96.7
d1i9ga_		264	Probable methyltransferase Rv2118c {Mycobacterium	96.68
d1u2za_		406	Catalytic, N-terminal domain of histone methyltran	96.62
d1nt2a_		209	Fibrillarin homologue {Archaeon Archaeoglobus fulg	96.59
d1g8aa_		227	Fibrillarin homologue {Archaeon Pyrococcus horikos	96.47
d1zx0a1		229	Guanidinoacetate methyltransferase {Human (Homo sa	96.45
d1af7a2		193	Chemotaxis receptor methyltransferase CheR, C-term	95.95
d1jg1a_		215	Protein-L-isoaspartyl O-methyltransferase {Archaeo	95.87
d2b25a1		324	Hypothetical protein FLJ20628 {Human (Homo sapiens	95.04
d1r18a_		223	Protein-L-isoaspartyl O-methyltransferase {Fruit f	95.02
d1o54a_		266	Hypothetical protein TM0748 {Thermotoga maritima [	94.92
d2h00a1		250	Methyltransferase 10 domain containing protein MET	94.1
d1m6ya2		192	TM0872, methyltransferase domain {Thermotoga marit	90.14
d1wxxa2		318	Hypothetical protein TTHA1280, middle and C-termin	88.06
d2as0a2		324	Hypothetical protein PH1915, middle and C-terminal	87.81
d2f8la1		328	Hypothetical protein Lmo1582 {Listeria monocytogen	81.98
d2fpoa1		183	Methylase YhhF {Escherichia coli [TaxId: 562]}	81.57
d2esra1		152	Putative methyltransferase SPy1538 {Streptococcus	80.27
d1wy7a1		201	Hypothetical protein PH1948 {Archaeon Pyrococcus h	80.23

>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Salicylic acid carboxyl methyltransferase (SAMT)
domain: Salicylic acid carboxyl methyltransferase (SAMT)
species: Clarkia breweri [TaxId: 36903]

Probab=100.00  E-value=6.5e-100  Score=735.52  Aligned_cols=318  Identities=33%  Similarity=0.522  Sum_probs=293.5

Q ss_pred             ChhhhhhhHHHHHHHHHHhhhcccCCCCCCcEEEEeecCCCCcccHHHHHHHHHHHHHHhhhcCCCCCCCcceEEecCCC
Q 040129            1 RLATNVTKDHIHDAIIRKLDVKSLADSSSNTIRLADCGCAVGPNTFNAMQDLIEIVKHKYKSQCPNSQNPEFHVSFNDQS   80 (333)
Q Consensus         1 ~~~~~~~~~~l~~ai~~~~~~~~~~~~~~~~~~IaD~GCs~G~Ns~~~~~~ii~~i~~~~~~~~~~~~~~~~~v~~nDlP   80 (333)
                      |++|+++||+|++||.++++...    .+++++|||||||+||||+.+|+.||++|+++|++++. .++|||||||||||
T Consensus        26 ~~~i~~~kp~leeai~~~~~~~~----~~~~~~IADlGCS~G~Ntl~~v~~iI~~i~~~~~~~~~-~~~pe~qvf~nDLP  100 (359)
T d1m6ex_          26 RQVISITKPITEAAITALYSGDT----VTTRLAIADLGCSSGPNALFAVTELIKTVEELRKKMGR-ENSPEYQIFLNDLP  100 (359)
T ss_dssp             HHHHHHTHHHHHHHHHHHHSSSS----SSSEECCEEESCCSSTTTTTGGGTTHHHHHHHHHSSSC-SSCCEEEEEEEECT
T ss_pred             HHHHHHHHHHHHHHHHhcccCCC----CCCceEEEEeCCCCCccHHHHHHHHHHHHHHHHHhcCC-CCCCeEEEEeCCCC
Confidence            47899999999999999876542    46789999999999999999999999999999987642 35789999999999


Q ss_pred             CCchHHHhhcCCccc----cceeeccCcccccccCCCCceeEEEeccccccccCCCccccCCCCCCCCCCceeecCC-CH
Q 040129           81 SNDFNTLFTSLPQEI----HFFVAGVPGSFHKRLFPEKFLHLVHVSYALHWLSKVPEGLLDKNSPAWNKGRIHYAFA-PE  155 (333)
Q Consensus        81 ~NDFn~lF~~l~~~~----~~f~~~vpgSFy~rlfP~~Sv~~~~Ss~alHWLS~vP~~l~~~~~~~~nkg~i~~~~~-~~  155 (333)
                      +||||+||++||...    +||++|||||||+||||++||||+||++|||||||+|+++.+      |||+||++++ ++
T Consensus       101 ~NDFNtLF~~L~~~~~~~~~~f~~gvpGSFY~rLfP~~Slh~~~Ss~alHWLS~vP~~l~~------n~~~i~~~~~~~~  174 (359)
T d1m6ex_         101 GNDFNAIFRSLPIENDVDGVCFINGVPGSFYGRLFPRNTLHFIHSSYSLMWLSQVPIGIES------NKGNIYMANTCPQ  174 (359)
T ss_dssp             TSCHHHHHTTTTTSCSCTTCEEEEEEESCSSSCCSCTTCBSCEEEESCTTBCSSCCSCCCC------CTTTTSSCSSSCC
T ss_pred             cchHHHHHHhccccccCCCCeEEEecCCchhhhcCCCCceEEeeehhhhhhhhcCCccccC------CCCcEEEcCCCCH
Confidence            999999999998754    799999999999999999999999999999999999999876      8999999987 99


Q ss_pred             HHHHHHHHHHHHhHHHHHHhhhhhhccCceEEEEecCCCCCCCCccchhhHHHHHHHHHHHHHHhccCCCHhhhhcCCcC
Q 040129          156 VVVKAYANQFAKDLERFLNNRAKEIVPGGMIIITNPSIPDGMPFSEIANGLMYNCMGTILYDMVKVGLLSEAQVDSFNLP  235 (333)
Q Consensus       156 ~v~~ay~~Q~~~D~~~FL~~Ra~EL~~GG~mvl~~~gr~~~~~~~~~~~~~~~~~l~~~l~~mv~eG~i~~~~~d~fn~P  235 (333)
                      +|.+||++||++||.+||++||+||+|||+||++++||++.++.++ +.+.+|++|.++|+|||+||+|++||+|+||+|
T Consensus       175 ~v~~ay~~Qf~~D~~~FL~~Ra~ELv~GG~mvl~~~gr~~~~~~~~-~~~~~~~~l~~al~dmv~eGlI~eek~dsfn~P  253 (359)
T d1m6ex_         175 SVLNAYYKQFQEDHALFLRCRAQEVVPGGRMVLTILGRRSEDRAST-ECCLIWQLLAMALNQMVSEGLIEEEKMDKFNIP  253 (359)
T ss_dssp             TTSCCSHHHHHHHHHHHHHHHHHHBCTTCEEEEEEEECSSSSSSST-TTSTTTHHHHHHHHHHHHTTCSCCSTTGGGCCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhcCCcEEEEEEeccCCCCCCCC-ccchHHHHHHHHHHHHHHcCCCCHHHHHhccCc
Confidence            9999999999999999999999999999999999999999888765 677899999999999999999999999999999


Q ss_pred             cccCCHHHHHHHHHhCCcEEEeEEEEeC----CCCCC-----cCCCChhHHHHHHHHHhhhhhhhhcChHHHHHHHHHHH
Q 040129          236 IYACPPGEFGAVVERNGNFRIEVMGLTN----PSPWL-----KGRINMPEYIKHVRAATESMFNKHFSYEVTEEMFRQLL  306 (333)
Q Consensus       236 ~y~ps~~E~~~~ie~~G~F~I~~le~~~----p~~~~-----~~~~~~~~~a~~iRa~~e~~l~~hfgeei~delf~r~~  306 (333)
                      +|+||++|++++|+++|+|+|+++|+++    |....     +.+.+|+.+++++|||+||+|++|||++|+|+||+||+
T Consensus       254 ~Y~ps~eEv~~~ie~~gsF~i~~~e~~~~~~~~~~~~~~~~~d~~~~~~~~a~~~RA~~e~~l~~hfg~~i~D~lF~r~~  333 (359)
T d1m6ex_         254 QYTPSPTEVEAEILKEGSFLIDHIEASEIYWSSCTKDGDGGGSVEEEGYNVARCMRAVAEPLLLDHFGEAIIEDVFHRYK  333 (359)
T ss_dssp             CBCCCSHHHHHHHHHTTTBCCEEEEEEEEETTCCSSCTTCCSSTTTTTTHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHH
T ss_pred             cccCCHHHHHHHhccCCCeeeeeeEeeecccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcChHHHHHHHHHHH
Confidence            9999999999999999999999999886    22111     12357899999999999999999999999999999999


Q ss_pred             HHHHHhhhhhhhcCCCcEEEEEEEeeC
Q 040129          307 ERLEEINDKMVSCYRDGVQLFAVLQRL  333 (333)
Q Consensus       307 ~~l~~~~~~~~~~~~~~~~~~~~l~r~  333 (333)
                      +++++++.+   ++.++++++++|+||
T Consensus       334 ~~v~~~~~~---~~~~~~~~~~sL~rK  357 (359)
T d1m6ex_         334 LLIIERMSK---EKTKFINVIVSLIRK  357 (359)
T ss_dssp             HHHHHHHHS---SCCEEEEEEEEEEBC
T ss_pred             HHHHhhHhh---cCCceEEEEEEEEec
Confidence            999999998   889999999999997

PyMOL of d1m6ex_

>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]}	Back information, alignment and structure

>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]}	Back information, alignment and structure

>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]}	Back information, alignment and structure

>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]}	Back information, alignment and structure

>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}	Back information, alignment and structure

>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]}	Back information, alignment and structure

>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}	Back information, alignment and structure

>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}	Back information, alignment and structure

>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}	Back information, alignment and structure

>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]}	Back information, alignment and structure

>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]}	Back information, alignment and structure

>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure