Citrus Sinensis ID: 040136


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-
MLKSPKLTSHVSKTLFKSLSKRPSFVFFSFGFSNSCTIDYSNCTARSICQSNDSESENEWERLLKPFDLNELRKSLHKITPFQLCKLLRLPLDVDTSMEIFTWAGSQEGYCHTFDVYYVLIDKLGANKEFKVIDSVLLQMKEEGIICRESLFILIMKYYGRGGVPGQATRLLLDMKSVYGCQPTFRSYNVVLDVLVAGNCHKVAPNLFYDMLSKGISPTVYTFGVVMKALCMVNEVDSACSLLRDMTKHGCVPNSVVYQTLIHALSKSNRVSEALMLLEEMILMGCTSDVQTFNDVIHGLCKVNRIHEAAKLVDRMLVRGFTPDDITYGVLMHGLCRTGRVDEARALLNKIPSANVVLLNTVINGYVISGRFDEAKAIFYDSMLSVGCIPDVFTFNILIHGLCKQRRFGSALELVNAMAVKGCEPNIVTYTILVDGFCKEGQLEKANIIINEMLAKGLSLNTGDRIEEALGLYQDMLLEGVTANTVTYNTLIHAFLRRGSLHEAHKLVNDMLFRGCPLDEITYNGLIKALCNAGAVDKGLGLFEEMMRKGIKPSSISCNILINGLCRTRKANTALEFLRDMIHRGLTPDIVTYNSLINGLCKMGCIQEALNLFDKLQAEGIYPDAVTYNTLISWHFKEGLFDDAFLILHKGVANGFVPNDATWYILVRNLVKEINMESWNF
ccccccccHHHHHHHHHccccccHHHHHHHHccccccccccHHHHHHHHccccccHHHHHHHHHccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccc
cccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccHccc
mlkspkltshVSKTLFKSlskrpsfvffsfgfsnsctidysnctarsicqsndseseNEWERLLKPFDLNELRKslhkitpfqlckllrlpldvdtsmEIFTwagsqegychTFDVYYVLIDklgankefKVIDSVLLQMKEEGIICRESLFILIMKYygrggvpgqaTRLLLDMksvygcqptfrsYNVVLDVLVagnchkvapnLFYDmlskgisptvyTFGVVMKALCMVNEVDSACSLLrdmtkhgcvpnsVVYQTLIHALSKSNRVSEALMLLEEMILMGctsdvqtfNDVIHGLCKVNRIHEAAKLVDRMlvrgftpddityGVLMHGLCRTGRVDEARALLNKIPSANVVLLNTVINGyvisgrfdeAKAIFYdsmlsvgcipdvftFNILIHGLCKQRRFGSALELVNAMAvkgcepniVTYTILVDGFCKEGQLEKANIIINEMLAkglslntgDRIEEALGLYQDMLLEGVTANTVTYNTLIHAFLRRGSLHEAHKLVNDmlfrgcpldeitYNGLIKALCNAGAVDKGLGLFEEMMrkgikpssisCNILINGLCRTRKANTALEFLRDMihrgltpdivTYNSLINGLCKMGCIQEALNLFDKLqaegiypdavtYNTLISWHFKEGLFDDAFLILHKgvangfvpndaTWYILVRNLVKEINMESWNF
mlkspkltshvSKTLfkslskrpSFVFFSFGFSNSCTIDYSNCTARSICQSNDSESENEWERLLKPFDLNELRKSLHkitpfqlckLLRLPLDVDTSMEIFTWAGSQEGYCHTFDVYYVLIDKLGANKEFKVIDSVLLQMKEEGIICRESLFILIMKYYGRGGVPGQATRLLLDMKSVYGCQPTFRSYNVVLDVLVAGNCHKVAPNLFYDMLSKGISPTVYTFGVVMKALCMVNEVDSACSLLRDMTKHGCVPNSVVYQTLIHALSKSNRVSEALMLLEEMILMGCTSDVQTFNDVIHGLCKVNRIHEAAKLVDRMLVRGFTPDDITYGVLMHGLCRTGRVDEARALLNkipsanvvlLNTVINGYVISGRFDEAKAIFYDSMLSVGCIPDVFTFNILIHGLCKQRRFGSALELVNAMAVKGCEPNIVTYTILVDGFCKEGQLEKANIIINEMLAKGLSLNTGDRIEEALGLYQDMLLEGVTANTVTYNTLIHAFLRRGSLHEAHKLVNDMLFRGCPLDEITYNGLIKALCNAGAVDKGLGLFEEMMRKGIKPSSISCNILINGLCRTRKANTALEFLRDMIHRGLTPDIVTYNSLINGLCKMGCIQEALNLFDKLQAEGIYPDAVTYNTLISWHFKEGLFDDAFLILHKGVANGFVPNDATWYILVRNLVKEinmeswnf
MLKSPKLTSHVSKTLFKSLSKRPsfvffsfgfsnsCTIDYSNCTARSICQSNDSESENEWERLLKPFDLNELRKSLHKITPFQLCKLLRLPLDVDTSMEIFTWAGSQEGYCHTFDVYYVLIDKLGANKEFKVIDSVLLQMKEEGIICRESLFILIMKYYGRGGVPGQATRLLLDMKSVYGCQPTFRSYNVVLDVLVAGNCHKVAPNLFYDMLSKGISPTVYTFGVVMKALCMVNEVDSACSLLRDMTKHGCVPNSVVYQTLIHALSKSNRVSealmlleemilmGCTSDVQTFNDVIHGLCKVNRIHEAAKLVDRMLVRGFTPDDITYGVLMHGLCRTGRVDEARALLNKIPSANVVLLNTVINGYVISGRFDEAKAIFYDSMLSVGCIPDVFTFNILIHGLCKQRRFGSALELVNAMAVKGCEPNIVTYTILVDGFCKEGQLEKANIIINEMLAKGLSLNTGDRIEEALGLYQDMLLEGVTANTVTYNTLIHAFLRRGSLHEAHKLVNDMLFRGCPLDEITYNGLIKALCNAGAVDKGLGLFEEMMRKGIKPSSISCNILINGLCRTRKANTALEFLRDMIHRGLTPDIVTYNSLINGLCKMGCIQEALNLFDKLQAEGIYPDAVTYNTLISWHFKEGLFDDAFLILHKGVANGFVPNDATWYILVRNLVKEINMESWNF
******************LSKRPSFVFFSFGFSNSCTIDYSNCTARSICQ*********WERLLKPFDLNELRKSLHKITPFQLCKLLRLPLDVDTSMEIFTWAGSQEGYCHTFDVYYVLIDKLGANKEFKVIDSVLLQMKEEGIICRESLFILIMKYYGRGGVPGQATRLLLDMKSVYGCQPTFRSYNVVLDVLVAGNCHKVAPNLFYDMLSKGISPTVYTFGVVMKALCMVNEVDSACSLLRDMTKHGCVPNSVVYQTLIHALSKSNRVSEALMLLEEMILMGCTSDVQTFNDVIHGLCKVNRIHEAAKLVDRMLVRGFTPDDITYGVLMHGLCRTGRVDEARALLNKIPSANVVLLNTVINGYVISGRFDEAKAIFYDSMLSVGCIPDVFTFNILIHGLCKQRRFGSALELVNAMAVKGCEPNIVTYTILVDGFCKEGQLEKANIIINEMLAKGLSLNTGDRIEEALGLYQDMLLEGVTANTVTYNTLIHAFLRRGSLHEAHKLVNDMLFRGCPLDEITYNGLIKALCNAGAVDKGLGLFEEMMRKGIKPSSISCNILINGLCRTRKANTALEFLRDMIHRGLTPDIVTYNSLINGLCKMGCIQEALNLFDKLQAEGIYPDAVTYNTLISWHFKEGLFDDAFLILHKGVANGFVPNDATWYILVRNLVKEINM*****
*LKS*K*TSHVSKTLFKSLSKRPSFVFFSFGFSNSCTIDYSNCTARSICQSNDSESENEWERLLKPFDLNELRKSLHKITPFQLCKLLRLPLDVDTSMEIFTWAGSQEGYCHTFDVYYVLIDKLGANKEFKVIDSVLLQMKEEGIICRESLFILIMKYYGRGGVPGQATRLLLDMKSVYGCQPTFRSYNVVLDVLVAGNCHKVAPNLFYDMLSKGISPTVYTFGVVMKALCMVNEVDSACSLLRDMTKHGCVPNSVVYQTLIHALSKSNRVSEALMLLEEMILMGCTSDVQTFNDVIHGLCKVNRIHEAAKLVDRMLVRGFTPDDITYGVLMHGLCRTGRVDEARALLNKIPSANVVLLNTVINGYVISGRFDEAKAIFYDSMLSVGCIPDVFTFNILIHGLCKQRRFGSALELVNAMAVKGCEPNIVTYTILVDGFCKEGQLEKANIIINEMLAKGLSLNTGDRIEEALGLYQDMLLEGVTANTVTYNTLIHAFLRRGSLHEAHKLVNDMLFRGCPLDEITYNGLIKALCNAGAVDKGLGLFEEMMRKGIKPSSISCNILINGLCRTRKANTALEFLRDMIHRGLTPDIVTYNSLINGLCKMGCIQEALNLFDKLQAEGIYPDAVTYNTLISWHFKEGLFDDAFLILHKGVANGFVPNDATWYILVRNLVKEINMESWNF
**********VSKTLFKSLSKRPSFVFFSFGFSNSCTIDYSNCTARSI***********WERLLKPFDLNELRKSLHKITPFQLCKLLRLPLDVDTSMEIFTWAGSQEGYCHTFDVYYVLIDKLGANKEFKVIDSVLLQMKEEGIICRESLFILIMKYYGRGGVPGQATRLLLDMKSVYGCQPTFRSYNVVLDVLVAGNCHKVAPNLFYDMLSKGISPTVYTFGVVMKALCMVNEVDSACSLLRDMTKHGCVPNSVVYQTLIHALSKSNRVSEALMLLEEMILMGCTSDVQTFNDVIHGLCKVNRIHEAAKLVDRMLVRGFTPDDITYGVLMHGLCRTGRVDEARALLNKIPSANVVLLNTVINGYVISGRFDEAKAIFYDSMLSVGCIPDVFTFNILIHGLCKQRRFGSALELVNAMAVKGCEPNIVTYTILVDGFCKEGQLEKANIIINEMLAKGLSLNTGDRIEEALGLYQDMLLEGVTANTVTYNTLIHAFLRRGSLHEAHKLVNDMLFRGCPLDEITYNGLIKALCNAGAVDKGLGLFEEMMRKGIKPSSISCNILINGLCRTRKANTALEFLRDMIHRGLTPDIVTYNSLINGLCKMGCIQEALNLFDKLQAEGIYPDAVTYNTLISWHFKEGLFDDAFLILHKGVANGFVPNDATWYILVRNLVKEINMESWNF
MLKSPKLTSHVSKTLFKSLSKRPSFVFFSFGFSNSCTIDYSNCTARSICQSNDSESENEWERLLKPFDLNELRKSLHKITPFQLCKLLRLPLDVDTSMEIFTWAGSQEGYCHTFDVYYVLIDKLGANKEFKVIDSVLLQMKEEGIICRESLFILIMKYYGRGGVPGQATRLLLDMKSVYGCQPTFRSYNVVLDVLVAGNCHKVAPNLFYDMLSKGISPTVYTFGVVMKALCMVNEVDSACSLLRDMTKHGCVPNSVVYQTLIHALSKSNRVSEALMLLEEMILMGCTSDVQTFNDVIHGLCKVNRIHEAAKLVDRMLVRGFTPDDITYGVLMHGLCRTGRVDEARALLNKIPSANVVLLNTVINGYVISGRFDEAKAIFYDSMLSVGCIPDVFTFNILIHGLCKQRRFGSALELVNAMAVKGCEPNIVTYTILVDGFCKEGQLEKANIIINEMLAKGLSLNTGDRIEEALGLYQDMLLEGVTANTVTYNTLIHAFLRRGSLHEAHKLVNDMLFRGCPLDEITYNGLIKALCNAGAVDKGLGLFEEMMRKGIKPSSISCNILINGLCRTRKANTALEFLRDMIHRGLTPDIVTYNSLINGLCKMGCIQEALNLFDKLQAEGIYPDAVTYNTLISWHFKEGLFDDAFLILHKGVANGFVPNDATWYILVRNLVKEINME****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKSPKLTSHVSKTLFKSLSKRPSFVFFSFGFSNSCTIDYSNCTARSICQSNDSESENEWERLLKPFDLNELRKSLHKITPFQLCKLLRLPLDVDTSMEIFTWAGSQEGYCHTFDVYYVLIDKLGANKEFKVIDSVLLQMKEEGIICRESLFILIMKYYGRGGVPGQATRLLLDMKSVYGCQPTFRSYNVVLDVLVAGNCHKVAPNLFYDMLSKGISPTVYTFGVVMKALCMVNEVDSACSLLRDMTKHGCVPNSVVYQTLIHALSKSNRVSEALMLLEEMILMGCTSDVQTFNDVIHGLCKVNRIHEAAKLVDRMLVRGFTPDDITYGVLMHGLCRTGRVDEARALLNKIPSANVVLLNTVINGYVISGRFDEAKAIFYDSMLSVGCIPDVFTFNILIHGLCKQRRFGSALELVNAMAVKGCEPNIVTYTILVDGFCKEGQLEKANIIINEMLAKGLSLNTGDRIEEALGLYQDMLLEGVTANTVTYNTLIHAFLRRGSLHEAHKLVNDMLFRGCPLDEITYNGLIKALCNAGAVDKGLGLFEEMMRKGIKPSSISCNILINGLCRTRKANTALEFLRDMIHRGLTPDIVTYNSLINGLCKMGCIQEALNLFDKLQAEGIYPDAVTYNTLISWHFKEGLFDDAFLILHKGVANGFVPNDATWYILVRNLVKEINMESWNF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query681 2.2.26 [Sep-21-2011]
Q9FMF6730 Pentatricopeptide repeat- yes no 0.922 0.860 0.588 0.0
Q9CA58 763 Putative pentatricopeptid no no 0.875 0.781 0.300 1e-81
O49436660 Pentatricopeptide repeat- no no 0.816 0.842 0.301 1e-77
Q9LQ16632 Pentatricopeptide repeat- no no 0.726 0.783 0.328 1e-76
Q9CAN5614 Pentatricopeptide repeat- no no 0.672 0.745 0.332 5e-75
Q9CAN0630 Pentatricopeptide repeat- no no 0.719 0.777 0.325 6e-75
Q9LFF1754 Pentatricopeptide repeat- no no 0.861 0.778 0.290 9e-75
Q9M302659 Pentatricopeptide repeat- no no 0.857 0.886 0.290 4e-74
Q9LQ14629 Pentatricopeptide repeat- no no 0.719 0.779 0.321 1e-73
Q9SXD1630 Pentatricopeptide repeat- no no 0.726 0.785 0.318 1e-73
>sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 Back     alignment and function desciption
 Score =  813 bits (2099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/675 (58%), Positives = 498/675 (73%), Gaps = 47/675 (6%)

Query: 54  SESENEWERLLKPFDLNELRKSLHKITPFQLCKLLRLPLDVDTSMEIFTWAGSQEGYCHT 113
           ++S NEWE+LLKPFDL+ LR S HKITPFQL KLL LPL+V TSME+F+W GSQ GY H+
Sbjct: 51  TDSANEWEKLLKPFDLDSLRNSFHKITPFQLYKLLELPLNVSTSMELFSWTGSQNGYRHS 110

Query: 114 FDVYYVLIDKLGANKEFKVIDSVLLQMKEEGIICRESLFILIMKYYGRGGVPGQATRLLL 173
           FDVY VLI KLGAN EFK ID +L+QMK+EGI+ +ESLFI IM+ Y + G PGQ TRL+L
Sbjct: 111 FDVYQVLIGKLGANGEFKTIDRLLIQMKDEGIVFKESLFISIMRDYDKAGFPGQTTRLML 170

Query: 174 DMKSVYGCQPTFRSYNVVLDVLVAGNCHKVAPNLFYDMLSKGISPTVYTFGVVMKALCMV 233
           +M++VY C+PTF+SYNVVL++LV+GNCHKVA N+FYDMLS+ I PT++TFGVVMKA C V
Sbjct: 171 EMRNVYSCEPTFKSYNVVLEILVSGNCHKVAANVFYDMLSRKIPPTLFTFGVVMKAFCAV 230

Query: 234 NEVDSACSLLRDMTKHGCVPNSVVYQTLIHALSKSNRVSEALMLLEEMILMGCTSDVQTF 293
           NE+DSA SLLRDMTKHGCVPNSV+YQTLIH+LSK NRV+EAL LLEEM LMGC  D +TF
Sbjct: 231 NEIDSALSLLRDMTKHGCVPNSVIYQTLIHSLSKCNRVNEALQLLEEMFLMGCVPDAETF 290

Query: 294 NDVIHGLCKVNRIHEAAKLVDRMLVRGFTPDDITYGVLMHGLCRTGRVDEARALLNKIPS 353
           NDVI GLCK +RI+EAAK+V+RML+RGF PDDITYG LM+GLC+ GRVD A+ L  +IP 
Sbjct: 291 NDVILGLCKFDRINEAAKMVNRMLIRGFAPDDITYGYLMNGLCKIGRVDAAKDLFYRIPK 350

Query: 354 ANVVLLNTVINGYVISGRFDEAKAIFYDSMLSVGCIPDVFTFNILIHGLCKQRRFGSALE 413
             +V+ NT+I+G+V  GR D+AKA+  D + S G +PDV T+N LI+G  K+   G ALE
Sbjct: 351 PEIVIFNTLIHGFVTHGRLDDAKAVLSDMVTSYGIVPDVCTYNSLIYGYWKEGLVGLALE 410

Query: 414 LVNAMAVKGCEPNIVTYTILVDGFCKEGQLEKANIIINEMLAKGLSLNT----------- 462
           +++ M  KGC+PN+ +YTILVDGFCK G++++A  ++NEM A GL  NT           
Sbjct: 411 VLHDMRNKGCKPNVYSYTILVDGFCKLGKIDEAYNVLNEMSADGLKPNTVGFNCLISAFC 470

Query: 463 ------------------------------------GDRIEEALGLYQDMLLEGVTANTV 486
                                                D I+ AL L +DM+ EGV ANTV
Sbjct: 471 KEHRIPEAVEIFREMPRKGCKPDVYTFNSLISGLCEVDEIKHALWLLRDMISEGVVANTV 530

Query: 487 TYNTLIHAFLRRGSLHEAHKLVNDMLFRGCPLDEITYNGLIKALCNAGAVDKGLGLFEEM 546
           TYNTLI+AFLRRG + EA KLVN+M+F+G PLDEITYN LIK LC AG VDK   LFE+M
Sbjct: 531 TYNTLINAFLRRGEIKEARKLVNEMVFQGSPLDEITYNSLIKGLCRAGEVDKARSLFEKM 590

Query: 547 MRKGIKPSSISCNILINGLCRTRKANTALEFLRDMIHRGLTPDIVTYNSLINGLCKMGCI 606
           +R G  PS+ISCNILINGLCR+     A+EF ++M+ RG TPDIVT+NSLINGLC+ G I
Sbjct: 591 LRDGHAPSNISCNILINGLCRSGMVEEAVEFQKEMVLRGSTPDIVTFNSLINGLCRAGRI 650

Query: 607 QEALNLFDKLQAEGIYPDAVTYNTLISWHFKEGLFDDAFLILHKGVANGFVPNDATWYIL 666
           ++ L +F KLQAEGI PD VT+NTL+SW  K G   DA L+L +G+ +GFVPN  TW IL
Sbjct: 651 EDGLTMFRKLQAEGIPPDTVTFNTLMSWLCKGGFVYDACLLLDEGIEDGFVPNHRTWSIL 710

Query: 667 VRNLVKEINMESWNF 681
           +++++ +  ++   F
Sbjct: 711 LQSIIPQETLDRRRF 725





Arabidopsis thaliana (taxid: 3702)
>sp|Q9CA58|PP120_ARATH Putative pentatricopeptide repeat-containing protein At1g74580 OS=Arabidopsis thaliana GN=At1g74580 PE=3 SV=1 Back     alignment and function description
>sp|O49436|PP327_ARATH Pentatricopeptide repeat-containing protein At4g20090 OS=Arabidopsis thaliana GN=EMB1025 PE=3 SV=1 Back     alignment and function description
>sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAN5|PPR98_ARATH Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAN0|PPR99_ARATH Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 Back     alignment and function description
>sp|Q9M302|PP270_ARATH Pentatricopeptide repeat-containing protein At3g48810 OS=Arabidopsis thaliana GN=At3g48810 PE=2 SV=1 Back     alignment and function description
>sp|Q9LQ14|PPR96_ARATH Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 Back     alignment and function description
>sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query681
147798083722 hypothetical protein VITISV_039434 [Viti 0.976 0.921 0.671 0.0
359497112740 PREDICTED: pentatricopeptide repeat-cont 0.920 0.847 0.698 0.0
255539805774 pentatricopeptide repeat-containing prot 0.977 0.860 0.662 0.0
224086515724 predicted protein [Populus trichocarpa] 0.980 0.922 0.652 0.0
356499327725 PREDICTED: pentatricopeptide repeat-cont 0.910 0.855 0.660 0.0
357494039 948 Auxin response factor [Medicago truncatu 0.953 0.684 0.624 0.0
449443698732 PREDICTED: pentatricopeptide repeat-cont 0.964 0.897 0.581 0.0
449508997732 PREDICTED: pentatricopeptide repeat-cont 0.964 0.897 0.579 0.0
297797449724 pentatricopeptide repeat-containing prot 0.916 0.861 0.600 0.0
15237662730 pentatricopeptide repeat-containing prot 0.922 0.860 0.588 0.0
>gi|147798083|emb|CAN67256.1| hypothetical protein VITISV_039434 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  962 bits (2487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/724 (67%), Positives = 565/724 (78%), Gaps = 59/724 (8%)

Query: 1   MLKSPKLTSHVSKTLFKSLSKRPSFVFFSFGFSNSCTIDYSNCTARSICQSNDSESENEW 60
           MLK PK T ++ +  FK+    PSF     GF+      + N T  +   +N  +S  EW
Sbjct: 10  MLKIPKFTKNL-QYFFKT----PSFSISPSGFNR-----FYNDTVFN--NTNGLDSGTEW 57

Query: 61  ERLLKPFDLNELRKSLHKITPFQLCKLLRLPLDVDTSMEIFTWAGSQEGYCHTFDVYYVL 120
           ERLLKPFDL ELR SL +ITP+QLCKLL LPLDV TSME+F WAG+Q+GYCH FDVYY+L
Sbjct: 58  ERLLKPFDLPELRTSLTRITPYQLCKLLELPLDVPTSMELFQWAGTQKGYCHMFDVYYML 117

Query: 121 IDKLGANKEFKVIDSVLLQMKEEGIICRESLFILIMKYYGRGGVPGQATRLLLDMKSVYG 180
           IDKLGA  EFK ID++L+QMK+EGI+ RESLFILIMK+YGR G+PGQATRLLLDM+ VY 
Sbjct: 118 IDKLGAAGEFKTIDALLMQMKQEGIVFRESLFILIMKHYGRAGLPGQATRLLLDMRGVYS 177

Query: 181 CQPTFRSYNVVLDVLVAGNCHKVAPNLFYDMLSKGISPTVYTFGVVMKALCMVNEVDSAC 240
           C+PTFRSYNVVLDVL+AGNC KV PN+FY+MLSKGISPTVYTFGVVMKALC+VNEVDSAC
Sbjct: 178 CEPTFRSYNVVLDVLLAGNCPKVVPNVFYEMLSKGISPTVYTFGVVMKALCLVNEVDSAC 237

Query: 241 SLLRDMTKHGCVPNSVVYQTLIHALSKSNRVSEALMLLEEMILMGCTSDVQTFNDVIHGL 300
           +LL+DMT+HGCVPN++VYQTLIHAL K  RV+E L LLEEM+LMGC  DV TFND IHGL
Sbjct: 238 ALLKDMTRHGCVPNAIVYQTLIHALXKVGRVNEVLKLLEEMLLMGCIPDVNTFNDAIHGL 297

Query: 301 CKVNRIHEAAKLVDRMLVRGFTPDDITYGVLMHGLCRTGRVDEARALLNKIPSANVVLLN 360
           CK+ RIHEAAKLVDRML+RGFTP+  TYGVLMHGLCR G+VDEAR LLNK+P+ NVVL N
Sbjct: 298 CKMLRIHEAAKLVDRMLLRGFTPNSFTYGVLMHGLCRMGKVDEARMLLNKVPNPNVVLFN 357

Query: 361 TVINGYVISGRFDEAKAIFYDSMLSVGCIPDVFTFNILIHGLCKQRRFGSALELVNAMAV 420
           T+INGYV  GR DEAKA+ ++SMLSVGC PD+FT+N LI GLCK+    SA EL+N M +
Sbjct: 358 TLINGYVSRGRLDEAKAVMHESMLSVGCGPDIFTYNTLILGLCKKGYLVSARELMNEMQI 417

Query: 421 KGCEPNIVTYTILVDGFCKEGQLEKANIIINEMLAKGLSLNT------------------ 462
           KGCEPN++TYTIL+D FCKEG+LE+A  +++EM  KGL+LN                   
Sbjct: 418 KGCEPNVITYTILIDRFCKEGRLEEARNVLDEMSGKGLALNAVGYNCLISALCKDEKVQD 477

Query: 463 -----GD------------------------RIEEALGLYQDMLLEGVTANTVTYNTLIH 493
                GD                        + EEALGLYQDMLLEGV ANT+TYNTLIH
Sbjct: 478 ALNMFGDMSSKGCKPDIFTFNSLIFGLCKVNKFEEALGLYQDMLLEGVIANTITYNTLIH 537

Query: 494 AFLRRGSLHEAHKLVNDMLFRGCPLDEITYNGLIKALCNAGAVDKGLGLFEEMMRKGIKP 553
           AFLRRG++ EA KLVNDMLFRGCPLD+ITYNGLIKALC AG ++KGL LFE+MM KG+ P
Sbjct: 538 AFLRRGAMQEALKLVNDMLFRGCPLDDITYNGLIKALCRAGNIEKGLALFEDMMSKGLNP 597

Query: 554 SSISCNILINGLCRTRKANTALEFLRDMIHRGLTPDIVTYNSLINGLCKMGCIQEALNLF 613
           ++ISCNILINGLCRT     ALEFLRDMIHRGLTPDIVTYNSLINGLCK G  QEALNLF
Sbjct: 598 NNISCNILINGLCRTGNIQHALEFLRDMIHRGLTPDIVTYNSLINGLCKTGRAQEALNLF 657

Query: 614 DKLQAEGIYPDAVTYNTLISWHFKEGLFDDAFLILHKGVANGFVPNDATWYILVRNLVKE 673
           DKLQ EGI PDA+TYNTLISWH KEG+FDDA L+L +GV +GF+PN+ TWYILV N +KE
Sbjct: 658 DKLQVEGICPDAITYNTLISWHCKEGMFDDAHLLLSRGVDSGFIPNEVTWYILVSNFIKE 717

Query: 674 INME 677
            + E
Sbjct: 718 GDQE 721




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359497112|ref|XP_003635427.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255539805|ref|XP_002510967.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550082|gb|EEF51569.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224086515|ref|XP_002307901.1| predicted protein [Populus trichocarpa] gi|222853877|gb|EEE91424.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356499327|ref|XP_003518493.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|357494039|ref|XP_003617308.1| Auxin response factor [Medicago truncatula] gi|355518643|gb|AET00267.1| Auxin response factor [Medicago truncatula] Back     alignment and taxonomy information
>gi|449443698|ref|XP_004139614.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449508997|ref|XP_004163464.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297797449|ref|XP_002866609.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297312444|gb|EFH42868.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15237662|ref|NP_201237.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75171655|sp|Q9FMF6.1|PP444_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g64320, mitochondrial; Flags: Precursor gi|9759408|dbj|BAB09863.1| unnamed protein product [Arabidopsis thaliana] gi|332010486|gb|AED97869.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query681
TAIR|locus:2173403730 AT5G64320 "AT5G64320" [Arabido 0.908 0.847 0.513 9.4e-169
TAIR|locus:2019085 763 AT1G74580 "AT1G74580" [Arabido 0.875 0.781 0.297 7.1e-77
TAIR|locus:2119747660 EMB1025 "embryo defective 1025 0.847 0.874 0.297 3.8e-69
TAIR|locus:2099458659 AT3G48810 "AT3G48810" [Arabido 0.856 0.884 0.286 1e-68
TAIR|locus:2015208630 AT1G63130 [Arabidopsis thalian 0.712 0.769 0.320 2.7e-68
TAIR|locus:2083976754 MEE40 "maternal effect embryo 0.866 0.782 0.285 3.5e-68
TAIR|locus:2026192630 RPF2 "rna processing factor 2" 0.726 0.785 0.310 2.8e-66
TAIR|locus:2015218590 AT1G63070 [Arabidopsis thalian 0.715 0.825 0.321 5.8e-66
TAIR|locus:2015494629 RPF3 "RNA processing factor 3" 0.719 0.779 0.311 9.4e-66
TAIR|locus:2031301577 AT1G63400 [Arabidopsis thalian 0.703 0.830 0.320 1.5e-65
TAIR|locus:2173403 AT5G64320 "AT5G64320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1641 (582.7 bits), Expect = 9.4e-169, P = 9.4e-169
 Identities = 324/631 (51%), Positives = 429/631 (67%)

Query:    54 SESENEWERLLKPFDLNELRKSLHKITPFQLCKLLRLPLDVDTSMEIFTWAGSQEGYCHT 113
             ++S NEWE+LLKPFDL+ LR S HKITPFQL KLL LPL+V TSME+F+W GSQ GY H+
Sbjct:    51 TDSANEWEKLLKPFDLDSLRNSFHKITPFQLYKLLELPLNVSTSMELFSWTGSQNGYRHS 110

Query:   114 FDVYYVLIDKLGANKEFKVIDSVLLQMKEEGIICRESLFILIMKYYGRGGVPGQATRLLL 173
             FDVY VLI KLGAN EFK ID +L+QMK+EGI+ +ESLFI IM+ Y + G PGQ TRL+L
Sbjct:   111 FDVYQVLIGKLGANGEFKTIDRLLIQMKDEGIVFKESLFISIMRDYDKAGFPGQTTRLML 170

Query:   174 DMKSVYGCQPTFRSYNVVLDVLVAGNCHKVAPNLFYDMLSKGISPTVYTFGVVMKALCMV 233
             +M++VY C+PTF+SYNVVL++LV+GNCHKVA N+FYDMLS+ I PT++TFGVVMKA C V
Sbjct:   171 EMRNVYSCEPTFKSYNVVLEILVSGNCHKVAANVFYDMLSRKIPPTLFTFGVVMKAFCAV 230

Query:   234 NEVDSACSLLRDMTKHGCVPNSVVYQTLIHALSKSNRVSXXXXXXXXXXXXGCTSDVQTF 293
             NE+DSA SLLRDMTKHGCVPNSV+YQTLIH+LSK NRV+            GC  D +TF
Sbjct:   231 NEIDSALSLLRDMTKHGCVPNSVIYQTLIHSLSKCNRVNEALQLLEEMFLMGCVPDAETF 290

Query:   294 NDVIHGLCKVNRIHEAAKLVDRMLVRGFTPDDITYGVLMHGLCRTGRVDEARALLNKIPS 353
             NDVI GLCK +RI+EAAK+V+RML+RGF PDDITYG LM+GLC+ GRVD A+ L  +IP 
Sbjct:   291 NDVILGLCKFDRINEAAKMVNRMLIRGFAPDDITYGYLMNGLCKIGRVDAAKDLFYRIPK 350

Query:   354 ANVVLLNTVINGYVISGRFDEAKAIFYDSMLSVGCIPDVFTFNILIHGLCKQRRFGSALE 413
               +V+ NT+I+G+V  GR D+AKA+  D + S G +PDV T+N LI+G  K+   G ALE
Sbjct:   351 PEIVIFNTLIHGFVTHGRLDDAKAVLSDMVTSYGIVPDVCTYNSLIYGYWKEGLVGLALE 410

Query:   414 LVNAMAVKGCEPNIVTYTILVDGFCKEGQLEKANIIINEMLAKGLSLNT-G--------- 463
             +++ M  KGC+PN+ +YTILVDGFCK G++++A  ++NEM A GL  NT G         
Sbjct:   411 VLHDMRNKGCKPNVYSYTILVDGFCKLGKIDEAYNVLNEMSADGLKPNTVGFNCLISAFC 470

Query:   464 --DRIEEALGLYQDMLLEGVTANTVTYNTLIHAFLRRGSLHEAHKLVNDMLFRGCPLDEI 521
                RI EA+ ++++M  +G   +  T+N+LI        +  A  L+ DM+  G   + +
Sbjct:   471 KEHRIPEAVEIFREMPRKGCKPDVYTFNSLISGLCEVDEIKHALWLLRDMISEGVVANTV 530

Query:   522 TYNGLIKALCNAGAVDKGLGLFEEMMRKGIKPSSISCNILINGLCRTRKANTALEFLRDM 581
             TYN LI A    G + +   L  EM+ +G     I+ N LI GLCR  + + A      M
Sbjct:   531 TYNTLINAFLRRGEIKEARKLVNEMVFQGSPLDEITYNSLIKGLCRAGEVDKARSLFEKM 590

Query:   582 IHRGLTPDIVTYNSLINGLCKMGCIQEALNLFDKLQAEGIYPDAVTYNTLISWHFKEGLF 641
             +  G  P  ++ N LINGLC+ G ++EA+    ++   G  PD VT+N+LI+   + G  
Sbjct:   591 LRDGHAPSNISCNILINGLCRSGMVEEAVEFQKEMVLRGSTPDIVTFNSLINGLCRAGRI 650

Query:   642 DDAFLILHKGVANGFVPNDATWYILVRNLVK 672
             +D   +  K  A G  P+  T+  L+  L K
Sbjct:   651 EDGLTMFRKLQAEGIPPDTVTFNTLMSWLCK 681


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2019085 AT1G74580 "AT1G74580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119747 EMB1025 "embryo defective 1025" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099458 AT3G48810 "AT3G48810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015208 AT1G63130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083976 MEE40 "maternal effect embryo arrest 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026192 RPF2 "rna processing factor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015218 AT1G63070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015494 RPF3 "RNA processing factor 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031301 AT1G63400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FMF6PP444_ARATHNo assigned EC number0.58810.92210.8602yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_VI000146
hypothetical protein (724 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query681
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-32
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-31
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 9e-28
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 8e-23
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 8e-19
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-18
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-16
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-16
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-15
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-14
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-14
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 7e-14
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-14
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-13
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 3e-13
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-13
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-11
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-11
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 9e-11
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 9e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-08
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-07
pfam1285434 pfam12854, PPR_1, PPR repeat 6e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-07
pfam0153531 pfam01535, PPR, PPR repeat 8e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-05
pfam0153531 pfam01535, PPR, PPR repeat 1e-05
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-05
pfam0153531 pfam01535, PPR, PPR repeat 3e-05
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 6e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 6e-05
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-04
pfam0153531 pfam01535, PPR, PPR repeat 1e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 1e-04
pfam0153531 pfam01535, PPR, PPR repeat 2e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-04
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 8e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.001
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.001
pfam0153531 pfam01535, PPR, PPR repeat 0.002
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.003
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score =  133 bits (335), Expect = 5e-32
 Identities = 97/416 (23%), Positives = 171/416 (41%), Gaps = 53/416 (12%)

Query: 218 PTVYTFGVVMKALCMVNEVDSACSLLRDMTKHGCVPNSVVYQTLIHALSKSNRVSEALML 277
           PT+ TF ++M       ++D A  +LR + + G   +  +Y TLI   +KS +V     +
Sbjct: 435 PTLSTFNMLMSVCASSQDIDGALRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEV 494

Query: 278 LEEMILMGCTSDVQTFNDVIHGLCKVNRIHEAAKLVDRMLVRGFTPDDITYGVLMHGLCR 337
             EM+  G  ++V TF  +I G  +  ++ +A      M  +   PD + +  L+    +
Sbjct: 495 FHEMVNAGVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQ 554

Query: 338 TGRVDEARALLNKIPSANVVLLNTVINGYVISGRFDEAKAIFYDSMLSVGCIPDVFTFNI 397
           +G VD A  +L ++ +                    E   I           PD  T   
Sbjct: 555 SGAVDRAFDVLAEMKA--------------------ETHPI----------DPDHITVGA 584

Query: 398 LIHGLCKQRRFGSALELVNAMAVKGCEPNIVTYTILVDGFCKEGQLEKANIIINEMLAKG 457
           L+       +   A E+   +     +     YTI V+  C +                 
Sbjct: 585 LMKACANAGQVDRAKEVYQMIHEYNIKGTPEVYTIAVN-SCSQ----------------- 626

Query: 458 LSLNTGDRIEEALGLYQDMLLEGVTANTVTYNTLIHAFLRRGSLHEAHKLVNDMLFRGCP 517
                GD  + AL +Y DM  +GV  + V ++ L+      G L +A +++ D   +G  
Sbjct: 627 ----KGD-WDFALSIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQDARKQGIK 681

Query: 518 LDEITYNGLIKALCNAGAVDKGLGLFEEMMRKGIKPSSISCNILINGLCRTRKANTALEF 577
           L  ++Y+ L+ A  NA    K L L+E++    ++P+  + N LI  LC   +   ALE 
Sbjct: 682 LGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQLPKALEV 741

Query: 578 LRDMIHRGLTPDIVTYNSLINGLCKMGCIQEALNLFDKLQAEGIYPDAVTYNTLIS 633
           L +M   GL P+ +TY+ L+    +       L+L  + + +GI P+ V    +  
Sbjct: 742 LSEMKRLGLCPNTITYSILLVASERKDDADVGLDLLSQAKEDGIKPNLVMCRCITG 797


Length = 1060

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 681
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.97
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.96
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.95
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.94
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.93
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.93
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.91
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.9
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.9
PRK11788389 tetratricopeptide repeat protein; Provisional 99.89
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.87
PRK11788389 tetratricopeptide repeat protein; Provisional 99.87
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.87
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.86
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.85
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.85
PRK14574 822 hmsH outer membrane protein; Provisional 99.84
PRK14574 822 hmsH outer membrane protein; Provisional 99.83
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.83
KOG2076895 consensus RNA polymerase III transcription factor 99.81
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.8
KOG2076 895 consensus RNA polymerase III transcription factor 99.79
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.79
KOG1915677 consensus Cell cycle control protein (crooked neck 99.78
KOG2003 840 consensus TPR repeat-containing protein [General f 99.78
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.77
KOG2003840 consensus TPR repeat-containing protein [General f 99.74
KOG1915677 consensus Cell cycle control protein (crooked neck 99.71
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.64
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.63
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.62
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.6
KOG0547606 consensus Translocase of outer mitochondrial membr 99.59
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.59
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.58
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.58
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.58
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.58
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.57
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.56
KOG1126638 consensus DNA-binding cell division cycle control 99.56
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.55
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.55
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.54
KOG1126638 consensus DNA-binding cell division cycle control 99.52
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.49
KOG0547606 consensus Translocase of outer mitochondrial membr 99.49
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.48
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.48
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.48
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.47
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.45
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.45
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.4
KOG1129478 consensus TPR repeat-containing protein [General f 99.4
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.4
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.36
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.36
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.34
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.34
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.33
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.32
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.32
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.32
PRK12370553 invasion protein regulator; Provisional 99.32
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.3
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.29
PRK12370553 invasion protein regulator; Provisional 99.28
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.27
KOG1129478 consensus TPR repeat-containing protein [General f 99.25
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.25
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.24
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.23
PF1304150 PPR_2: PPR repeat family 99.19
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.19
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.18
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.18
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.16
PF1304150 PPR_2: PPR repeat family 99.16
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.16
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.15
PRK11189296 lipoprotein NlpI; Provisional 99.11
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.06
PRK04841 903 transcriptional regulator MalT; Provisional 99.04
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.03
PRK11189296 lipoprotein NlpI; Provisional 99.03
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.97
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.93
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.93
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.93
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.93
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.9
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.89
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.86
KOG1125579 consensus TPR repeat-containing protein [General f 98.86
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.83
PRK04841903 transcriptional regulator MalT; Provisional 98.82
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.79
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.79
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.76
KOG1125579 consensus TPR repeat-containing protein [General f 98.74
KOG1128777 consensus Uncharacterized conserved protein, conta 98.68
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.68
PLN02789320 farnesyltranstransferase 98.66
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.65
PRK10370198 formate-dependent nitrite reductase complex subuni 98.65
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.64
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.62
PLN02789320 farnesyltranstransferase 98.55
KOG1128777 consensus Uncharacterized conserved protein, conta 98.55
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.55
PRK10370198 formate-dependent nitrite reductase complex subuni 98.55
PF1285434 PPR_1: PPR repeat 98.51
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.51
PF1285434 PPR_1: PPR repeat 98.5
PRK15359144 type III secretion system chaperone protein SscB; 98.49
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 98.48
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.47
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.45
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.44
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 98.44
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.43
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.43
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.43
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.41
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.41
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.36
PRK15359144 type III secretion system chaperone protein SscB; 98.36
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.33
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.26
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.19
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.1
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.09
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.06
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.0
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.96
KOG20411189 consensus WD40 repeat protein [General function pr 97.93
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.86
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.85
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.84
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.83
COG4700251 Uncharacterized protein conserved in bacteria cont 97.81
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.8
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.79
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.79
KOG0553304 consensus TPR repeat-containing protein [General f 97.78
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.77
KOG20411189 consensus WD40 repeat protein [General function pr 97.77
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.75
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.73
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.73
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.72
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.7
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.69
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.68
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.67
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.67
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.65
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.64
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 97.63
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.63
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.62
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.61
KOG0553304 consensus TPR repeat-containing protein [General f 97.6
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.58
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.58
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.55
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.55
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.54
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.54
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.54
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.53
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.53
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.52
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.49
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.48
COG4700251 Uncharacterized protein conserved in bacteria cont 97.44
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.44
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.43
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.43
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.42
PF12688120 TPR_5: Tetratrico peptide repeat 97.39
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.35
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.3
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.26
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.25
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.24
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.23
PF12688120 TPR_5: Tetratrico peptide repeat 97.22
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.13
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.07
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.06
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.05
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.03
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.01
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.95
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.92
PRK10803263 tol-pal system protein YbgF; Provisional 96.91
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.89
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.86
PF1337173 TPR_9: Tetratricopeptide repeat 96.86
PRK10803263 tol-pal system protein YbgF; Provisional 96.77
COG3898 531 Uncharacterized membrane-bound protein [Function u 96.7
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.68
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.67
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 96.63
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.52
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.48
PRK15331165 chaperone protein SicA; Provisional 96.46
COG3898531 Uncharacterized membrane-bound protein [Function u 96.4
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.4
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.39
PRK15331165 chaperone protein SicA; Provisional 96.31
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.3
PF1337173 TPR_9: Tetratricopeptide repeat 96.2
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.16
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.15
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 96.11
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.08
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.06
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.79
KOG1585308 consensus Protein required for fusion of vesicles 95.77
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.67
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.66
smart00299140 CLH Clathrin heavy chain repeat homology. 95.58
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.52
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.46
KOG4555175 consensus TPR repeat-containing protein [Function 95.44
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 95.36
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.33
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.33
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.3
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.23
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.11
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.07
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.05
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.04
KOG4555175 consensus TPR repeat-containing protein [Function 95.01
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.99
smart00299140 CLH Clathrin heavy chain repeat homology. 94.97
KOG1941 518 consensus Acetylcholine receptor-associated protei 94.8
PRK11906458 transcriptional regulator; Provisional 94.78
KOG1585308 consensus Protein required for fusion of vesicles 94.67
PRK11906458 transcriptional regulator; Provisional 94.59
KOG1258577 consensus mRNA processing protein [RNA processing 94.48
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 94.45
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.42
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.3
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.02
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.96
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 93.96
KOG3941406 consensus Intermediate in Toll signal transduction 93.81
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 93.75
KOG1941 518 consensus Acetylcholine receptor-associated protei 93.72
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.7
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 93.64
PF13512142 TPR_18: Tetratricopeptide repeat 93.48
COG0457291 NrfG FOG: TPR repeat [General function prediction 93.48
KOG3941 406 consensus Intermediate in Toll signal transduction 93.33
PF13512142 TPR_18: Tetratricopeptide repeat 93.23
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.17
COG3629280 DnrI DNA-binding transcriptional activator of the 93.12
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 93.08
COG0457291 NrfG FOG: TPR repeat [General function prediction 93.01
COG1747 711 Uncharacterized N-terminal domain of the transcrip 92.86
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.68
KOG2610491 consensus Uncharacterized conserved protein [Funct 92.63
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 92.59
PF1342844 TPR_14: Tetratricopeptide repeat 92.48
PF1342844 TPR_14: Tetratricopeptide repeat 92.45
COG3629280 DnrI DNA-binding transcriptional activator of the 92.18
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.94
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 91.67
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.29
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.25
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.94
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.89
PF13170297 DUF4003: Protein of unknown function (DUF4003) 90.79
KOG1586288 consensus Protein required for fusion of vesicles 90.72
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 90.69
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 90.65
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 90.6
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 90.35
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 90.28
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 89.91
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 89.89
KOG2062 929 consensus 26S proteasome regulatory complex, subun 89.74
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 89.59
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 89.46
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 89.06
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 88.67
PF1343134 TPR_17: Tetratricopeptide repeat 88.57
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 88.47
KOG4234271 consensus TPR repeat-containing protein [General f 88.13
PF06552186 TOM20_plant: Plant specific mitochondrial import r 88.03
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 88.02
KOG4570 418 consensus Uncharacterized conserved protein [Funct 87.87
KOG4648 536 consensus Uncharacterized conserved protein, conta 87.8
PRK11619 644 lytic murein transglycosylase; Provisional 87.46
COG2976207 Uncharacterized protein conserved in bacteria [Fun 87.42
KOG1550552 consensus Extracellular protein SEL-1 and related 87.39
PF1343134 TPR_17: Tetratricopeptide repeat 86.97
KOG1550552 consensus Extracellular protein SEL-1 and related 86.84
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 86.52
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 86.45
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 86.35
PF13170297 DUF4003: Protein of unknown function (DUF4003) 86.21
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 85.58
KOG4570418 consensus Uncharacterized conserved protein [Funct 85.25
KOG1258577 consensus mRNA processing protein [RNA processing 85.08
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 84.62
PF06552186 TOM20_plant: Plant specific mitochondrial import r 84.21
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 83.97
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 83.76
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 83.75
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 83.72
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 83.62
PRK09687280 putative lyase; Provisional 83.54
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 82.97
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 82.96
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 82.91
PRK09687280 putative lyase; Provisional 82.77
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 82.52
KOG4648 536 consensus Uncharacterized conserved protein, conta 82.38
COG3947361 Response regulator containing CheY-like receiver a 82.05
COG2976207 Uncharacterized protein conserved in bacteria [Fun 81.61
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 81.56
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 81.22
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 80.78
COG4455273 ImpE Protein of avirulence locus involved in tempe 80.78
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 80.74
PF13929292 mRNA_stabil: mRNA stabilisation 80.65
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 80.08
KOG1586288 consensus Protein required for fusion of vesicles 80.04
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.6e-74  Score=642.84  Aligned_cols=574  Identities=20%  Similarity=0.255  Sum_probs=530.8

Q ss_pred             HHHHhcCCCChHHHHHHHHHhhhCCCCCCCHHHHHHHHHHHHcCCCchHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCC
Q 040136           84 LCKLLRLPLDVDTSMEIFTWAGSQEGYCHTFDVYYVLIDKLGANKEFKVIDSVLLQMKEEGIICRESLFILIMKYYGRGG  163 (681)
Q Consensus        84 ~~~~l~~~~~~~~al~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g  163 (681)
                      +...+...+..+.+..++..+.+ .+..++...++.++..|++.|+++.|.++|++|.+    ++..+|+.++.+|++.|
T Consensus        92 ll~~~~~~~~~~~a~~~~~~~~~-~~~~~~~~~~n~li~~~~~~g~~~~A~~~f~~m~~----~d~~~~n~li~~~~~~g  166 (857)
T PLN03077         92 LFRLCEWKRAVEEGSRVCSRALS-SHPSLGVRLGNAMLSMFVRFGELVHAWYVFGKMPE----RDLFSWNVLVGGYAKAG  166 (857)
T ss_pred             HHHHHhhCCCHHHHHHHHHHHHH-cCCCCCchHHHHHHHHHHhCCChHHHHHHHhcCCC----CCeeEHHHHHHHHHhCC
Confidence            33444556778888888887654 45567777888888888888888888888888864    35568888888888888


Q ss_pred             ChHHHHHHHHHcHhhcCCCCCHHhHHHHHHHHHhcCCcCcHHHHHHHHHHCCCCCChhhHHHHHHHHHhcCChhHHHHHH
Q 040136          164 VPGQATRLLLDMKSVYGCQPTFRSYNVVLDVLVAGNCHKVAPNLFYDMLSKGISPTVYTFGVVMKALCMVNEVDSACSLL  243 (681)
Q Consensus       164 ~~~~A~~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~A~~~~~~m~~~~~~p~~~~~~~ll~~~~~~g~~~~A~~~~  243 (681)
                      ++++|+++|++|. ..|+.||..+|+.++.++...++...+.+++..|.+.|+.||..+|+.++.+|++.|++++|.++|
T Consensus       167 ~~~~A~~~f~~M~-~~g~~Pd~~t~~~ll~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~lf  245 (857)
T PLN03077        167 YFDEALCLYHRML-WAGVRPDVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALITMYVKCGDVVSARLVF  245 (857)
T ss_pred             CHHHHHHHHHHHH-HcCCCCChhHHHHHHHHhCCccchhhHHHHHHHHHHcCCCcccchHhHHHHHHhcCCCHHHHHHHH
Confidence            8888888888888 678888888888888888888888888888888888888888888999999999999999999999


Q ss_pred             HHHHhCCCCCChhhHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCC
Q 040136          244 RDMTKHGCVPNSVVYQTLIHALSKSNRVSEALMLLEEMILMGCTSDVQTFNDVIHGLCKVNRIHEAAKLVDRMLVRGFTP  323 (681)
Q Consensus       244 ~~~~~~~~~~~~~~~~~li~~~~~~~~~~~A~~~~~~m~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~~~~~~~~~  323 (681)
                      ++|..    ||..+||++|.+|++.|++++|+++|++|.+.|+.||..||+.++.+|++.|+.+.|.+++..|.+.|+.|
T Consensus       246 ~~m~~----~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g~~Pd~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~  321 (857)
T PLN03077        246 DRMPR----RDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTITSVISACELLGDERLGREMHGYVVKTGFAV  321 (857)
T ss_pred             hcCCC----CCcchhHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHHHhcCChHHHHHHHHHHHHhCCcc
Confidence            99864    67899999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcccHHHHHHHHHhcCCHHHHHHHHhhcCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHH
Q 040136          324 DDITYGVLMHGLCRTGRVDEARALLNKIPSANVVLLNTVINGYVISGRFDEAKAIFYDSMLSVGCIPDVFTFNILIHGLC  403 (681)
Q Consensus       324 ~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~p~~~~~~~ll~~~~  403 (681)
                      |..+|+.++.+|++.|++++|.++|++|..+|..+||.++.+|.+.|++++|++ +++.|...|+.||..||+.++.+|+
T Consensus       322 d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~~s~n~li~~~~~~g~~~~A~~-lf~~M~~~g~~Pd~~t~~~ll~a~~  400 (857)
T PLN03077        322 DVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMISGYEKNGLPDKALE-TYALMEQDNVSPDEITIASVLSACA  400 (857)
T ss_pred             chHHHHHHHHHHHhcCCHHHHHHHHhhCCCCCeeeHHHHHHHHHhCCCHHHHHH-HHHHHHHhCCCCCceeHHHHHHHHh
Confidence            999999999999999999999999999999999999999999999999999999 9999999999999999999999999


Q ss_pred             hcCChhHHHHHHHHHHhcCCCcCHhhHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCc--------cccHHHHHHHHHH
Q 040136          404 KQRRFGSALELVNAMAVKGCEPNIVTYTILVDGFCKEGQLEKANIIINEMLAKGLSLNT--------GDRIEEALGLYQD  475 (681)
Q Consensus       404 ~~~~~~~A~~~~~~~~~~~~~~~~~~~~~ll~~~~~~g~~~~A~~~~~~~~~~~~~~~~--------~~~~~~a~~~~~~  475 (681)
                      +.|+++.|.++++.+.+.|+.|+..+|+.|+++|++.|++++|.++|++|.+.+.....        .++.++|+.+|++
T Consensus       401 ~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~vs~~~mi~~~~~~g~~~eA~~lf~~  480 (857)
T PLN03077        401 CLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAGLRLNNRCFEALIFFRQ  480 (857)
T ss_pred             ccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHHHHhCCCCCeeeHHHHHHHHHHCCCHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999876554332        7889999999999


Q ss_pred             HHhcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCCCH
Q 040136          476 MLLEGVTANTVTYNTLIHAFLRRGSLHEAHKLVNDMLFRGCPLDEITYNGLIKALCNAGAVDKGLGLFEEMMRKGIKPSS  555 (681)
Q Consensus       476 ~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~p~~  555 (681)
                      |.. ++.||..+|+.++.+|++.|+.+.+.+++..+.+.|..+|..++++|+++|+++|++++|..+|+.+     .||.
T Consensus       481 m~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~~~~~~~naLi~~y~k~G~~~~A~~~f~~~-----~~d~  554 (857)
T PLN03077        481 MLL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYAWNQFNSH-----EKDV  554 (857)
T ss_pred             HHh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCCCccceechHHHHHHHHcCCHHHHHHHHHhc-----CCCh
Confidence            986 5899999999999999999999999999999999999999999999999999999999999999987     5799


Q ss_pred             HHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHH-HCCCCCCHHHHHHHHHH
Q 040136          556 ISCNILINGLCRTRKANTALEFLRDMIHRGLTPDIVTYNSLINGLCKMGCIQEALNLFDKLQ-AEGIYPDAVTYNTLISW  634 (681)
Q Consensus       556 ~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~-~~~~~p~~~~~~~l~~~  634 (681)
                      .+|+.++.+|++.|+.++|+++|++|.+.|+.||..||+.++.+|.+.|++++|.++|+.|. +.|+.|+..+|+.++++
T Consensus       555 ~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~lv~~  634 (857)
T PLN03077        555 VSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDL  634 (857)
T ss_pred             hhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHhhcChHHHHHHHHHHHHHHhCCCCchHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999 56999999999999999


Q ss_pred             HHhcCChhHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCccc
Q 040136          635 HFKEGLFDDAFLILHKGVANGFVPNDATWYILVRNLVKEINME  677 (681)
Q Consensus       635 ~~~~g~~~~A~~~~~~~~~~g~~~~~~~~~~ll~~~~~~g~~~  677 (681)
                      |.+.|++++|.+++++|.   +.||..+|..|+.+|...|+.+
T Consensus       635 l~r~G~~~eA~~~~~~m~---~~pd~~~~~aLl~ac~~~~~~e  674 (857)
T PLN03077        635 LGRAGKLTEAYNFINKMP---ITPDPAVWGALLNACRIHRHVE  674 (857)
T ss_pred             HHhCCCHHHHHHHHHHCC---CCCCHHHHHHHHHHHHHcCChH
Confidence            999999999999999994   7999999999999999888765



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query681
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-17
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-15
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-14
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-13
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-09
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-11
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-06
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 7e-10
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-09
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 8e-06
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-04
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-04
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 85.6 bits (210), Expect = 2e-17
 Identities = 23/201 (11%), Positives = 55/201 (27%), Gaps = 21/201 (10%)

Query: 418 MAVKGCEPNIVTYTILVDGFCKEGQLEKANIIINEMLAKGLSLNTGDRIEEALGLYQDML 477
            +                      QL  A                       L ++    
Sbjct: 118 HSQAQLSGQQQRLLAFFKCCLLTDQLPLA--------------------HHLLVVHHGQR 157

Query: 478 LEGVTANTVTYNTLIHAFLRRGSLHEAHKLVNDMLFRGCPLDEITYNGLIKALCNAGAVD 537
            +        YN ++  + R+G+  E   ++  +   G   D ++Y   ++ +       
Sbjct: 158 QKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDA 217

Query: 538 KGLG-LFEEMMRKGIKPSSISCNILINGLCRTRKANTALEFLRDMIHRGLTPDIVTYNSL 596
             +    E+M ++G+K  ++   +L++   R        +           P  V  + L
Sbjct: 218 GTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKL 277

Query: 597 INGLCKMGCIQEALNLFDKLQ 617
           +  +           L   L+
Sbjct: 278 LRDVYAKDGRVSYPKLHLPLK 298


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query681
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.97
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.96
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.94
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.93
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.93
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.91
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.91
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.91
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.86
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.86
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.85
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.85
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.84
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.82
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.82
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.82
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.81
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.8
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.79
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.77
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.77
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.77
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.77
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.75
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.74
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.73
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.73
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.72
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.71
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.71
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.69
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.69
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.66
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.64
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.64
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.64
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.61
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.6
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.6
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.58
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.57
3u4t_A272 TPR repeat-containing protein; structural genomics 99.57
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.57
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.56
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.56
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.55
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.54
3u4t_A272 TPR repeat-containing protein; structural genomics 99.54
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.54
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.52
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.52
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.52
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.51
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.5
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.5
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.47
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.46
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.45
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.44
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.43
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.43
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.41
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.39
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.39
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.38
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.38
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.38
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.37
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.36
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.32
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.3
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.3
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.3
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.3
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.29
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.26
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.24
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.22
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.22
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.21
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.15
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.13
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.08
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.07
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.06
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.03
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.02
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.0
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.99
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.99
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.98
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.97
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.97
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.94
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.93
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.91
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.9
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.89
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.89
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.89
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.88
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.88
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.85
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.85
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.84
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.83
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.83
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.79
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.78
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.78
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.74
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.73
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.71
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.71
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.68
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.67
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.64
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.61
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.61
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.6
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.59
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.58
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.57
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.57
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.56
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.55
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.55
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.53
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.53
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.53
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.53
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.53
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.52
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.52
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.51
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.51
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.51
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.49
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.48
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.48
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.48
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.47
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.46
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.46
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.45
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.45
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.4
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.4
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.39
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.38
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.37
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.34
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.33
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.33
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.31
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.31
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.26
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.26
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.26
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.25
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.24
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.22
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.21
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.2
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.19
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.19
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.18
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.18
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.12
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.11
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.11
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.1
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.08
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.08
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.03
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.02
3k9i_A117 BH0479 protein; putative protein binding protein, 98.01
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.0
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.0
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.0
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.0
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.98
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.97
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.92
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.91
3k9i_A117 BH0479 protein; putative protein binding protein, 97.91
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.88
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.87
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.87
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.82
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.78
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.73
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.71
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.69
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.69
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.62
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.61
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.53
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.44
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.41
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.39
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.38
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.26
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.18
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.17
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.03
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.81
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.77
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.71
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.62
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.43
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.42
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.41
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.39
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.31
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.13
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.09
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.07
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.82
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.64
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.61
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 95.61
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.57
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.32
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 95.18
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.16
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.12
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.07
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 95.05
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.67
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.66
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.57
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 94.4
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 93.28
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 92.98
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 92.76
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 92.75
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 92.46
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 92.03
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 91.76
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 91.1
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 90.89
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 90.42
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 90.34
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 88.75
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 88.71
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 88.44
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 86.89
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 86.47
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 86.26
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 85.96
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 83.44
2qx5_A661 Nucleoporin NIC96; mRNA transport, nuclear pore co 83.39
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 82.24
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 81.65
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 81.14
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 80.18
2p58_C116 Putative type III secretion protein YSCG; type III 80.13
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 80.02
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=8.7e-40  Score=354.70  Aligned_cols=498  Identities=12%  Similarity=0.033  Sum_probs=391.6

Q ss_pred             CCHHHHHHHHHHHHcCCCchHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhCCChHHHHHHHHHcHhhcCCCCCHHhHHHH
Q 040136          112 HTFDVYYVLIDKLGANKEFKVIDSVLLQMKEEGIICRESLFILIMKYYGRGGVPGQATRLLLDMKSVYGCQPTFRSYNVV  191 (681)
Q Consensus       112 ~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~l  191 (681)
                      ++...|..++..+.+.|++++|..+|+++....  |+...+..++.+|.+.|++++|..+|+++..   .+++..+++.+
T Consensus        82 ~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~--p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~---~~~~~~~~~~l  156 (597)
T 2xpi_A           82 SREDYLRLWRHDALMQQQYKCAAFVGEKVLDIT--GNPNDAFWLAQVYCCTGDYARAKCLLTKEDL---YNRSSACRYLA  156 (597)
T ss_dssp             CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHH--CCHHHHHHHHHHHHHTTCHHHHHHHHHHTCG---GGTCHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHccCchHHHHHHHHHHhhC--CCchHHHHHHHHHHHcCcHHHHHHHHHHHhc---cccchhHHHHH
Confidence            456667777777777777777777777777544  3556667777777777777777777777641   15667777777


Q ss_pred             HHHHHhcCCcCcHHHHHHHHHHCCCCCChhhHHHHHHHHHhcCChhHHHHHHHHHHhCCCCCChhhHHHHHHHHHhcCCh
Q 040136          192 LDVLVAGNCHKVAPNLFYDMLSKGISPTVYTFGVVMKALCMVNEVDSACSLLRDMTKHGCVPNSVVYQTLIHALSKSNRV  271 (681)
Q Consensus       192 l~~~~~~~~~~~A~~~~~~m~~~~~~p~~~~~~~ll~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~~  271 (681)
                      +.+|.+.|++++|+++|+++.     |+..    ....+.+.++           ...+.+++..+|+.++.+|.+.|++
T Consensus       157 ~~~~~~~g~~~~A~~~~~~~~-----~~~~----~~~~~~~~~~-----------~~~~~~~~~~~~~~l~~~~~~~g~~  216 (597)
T 2xpi_A          157 AFCLVKLYDWQGALNLLGETN-----PFRK----DEKNANKLLM-----------QDGGIKLEASMCYLRGQVYTNLSNF  216 (597)
T ss_dssp             HHHHHHTTCHHHHHHHHCSSC-----TTC--------------C-----------CCSSCCHHHHHHHHHHHHHHHTTCH
T ss_pred             HHHHHHHhhHHHHHHHHhccC-----Cccc----cccccccccc-----------cccccchhHHHHHHHHHHHHHcCCH
Confidence            777777777777777776422     1110    0011111111           1224456788999999999999999


Q ss_pred             hHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHH--HH-HHHHHHCCCCCCcccHHHHHHHHHhcCCHHHHHHHH
Q 040136          272 SEALMLLEEMILMGCTSDVQTFNDVIHGLCKVNRIHEAA--KL-VDRMLVRGFTPDDITYGVLMHGLCRTGRVDEARALL  348 (681)
Q Consensus       272 ~~A~~~~~~m~~~~~~~~~~~~~~li~~~~~~~~~~~a~--~~-~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~  348 (681)
                      ++|.++|++|.+.+ +.+...+..+...+...+..+.+.  .+ +..+...+..+...+|..++..|.+.|++++|.++|
T Consensus       217 ~~A~~~~~~~~~~~-p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~  295 (597)
T 2xpi_A          217 DRAKECYKEALMVD-AKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYL  295 (597)
T ss_dssp             HHHHHHHHHHHHHC-TTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhC-chhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHH
Confidence            99999999998764 335556665555443333222211  11 444444444445566777788899999999999999


Q ss_pred             hhcCC--CChHHHHHHHHHHHhcCCHHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHhcCCCcC
Q 040136          349 NKIPS--ANVVLLNTVINGYVISGRFDEAKAIFYDSMLSVGCIPDVFTFNILIHGLCKQRRFGSALELVNAMAVKGCEPN  426 (681)
Q Consensus       349 ~~~~~--~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~~~~p~~~~~~~ll~~~~~~~~~~~A~~~~~~~~~~~~~~~  426 (681)
                      +++..  ++..+|+.++.+|.+.|++++|++ +++.+...+ +.+..++..++.++.+.|++++|..+++.+.+.. +.+
T Consensus       296 ~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~-~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~  372 (597)
T 2xpi_A          296 SSINGLEKSSDLLLCKADTLFVRSRFIDVLA-ITTKILEID-PYNLDVYPLHLASLHESGEKNKLYLISNDLVDRH-PEK  372 (597)
T ss_dssp             HTSTTGGGCHHHHHHHHHHHHHTTCHHHHHH-HHHHHHHHC-TTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC-TTS
T ss_pred             HHhhcCCchHHHHHHHHHHHHHhcCHHHHHH-HHHHHHHcC-cccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC-ccc
Confidence            99988  889999999999999999999999 888887655 3377889999999999999999999999998663 557


Q ss_pred             HhhHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCccccHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHhcCCHHHHHH
Q 040136          427 IVTYTILVDGFCKEGQLEKANIIINEMLAKGLSLNTGDRIEEALGLYQDMLLEGVTANTVTYNTLIHAFLRRGSLHEAHK  506 (681)
Q Consensus       427 ~~~~~~ll~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~  506 (681)
                      ..++..++.+|.+.|++++|..+|+++.+..                        +.+..+|+.++.+|.+.|++++|.+
T Consensus       373 ~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~------------------------~~~~~~~~~l~~~~~~~g~~~~A~~  428 (597)
T 2xpi_A          373 AVTWLAVGIYYLCVNKISEARRYFSKSSTMD------------------------PQFGPAWIGFAHSFAIEGEHDQAIS  428 (597)
T ss_dssp             HHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC------------------------TTCHHHHHHHHHHHHHHTCHHHHHH
T ss_pred             HHHHHHHHHHHHHhccHHHHHHHHHHHHHhC------------------------CCCHHHHHHHHHHHHHcCCHHHHHH
Confidence            8899999999999999999999999988753                        2378899999999999999999999


Q ss_pred             HHHHHHhCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHC--
Q 040136          507 LVNDMLFRGCPLDEITYNGLIKALCNAGAVDKGLGLFEEMMRKGIKPSSISCNILINGLCRTRKANTALEFLRDMIHR--  584 (681)
Q Consensus       507 ~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~--  584 (681)
                      +|+++.+.+ +.+..++..++.+|.+.|++++|..+|+++.+... .+..+|+.++..|.+.|++++|.++|+++.+.  
T Consensus       429 ~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~-~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~  506 (597)
T 2xpi_A          429 AYTTAARLF-QGTHLPYLFLGMQHMQLGNILLANEYLQSSYALFQ-YDPLLLNELGVVAFNKSDMQTAINHFQNALLLVK  506 (597)
T ss_dssp             HHHHHHHTT-TTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCC-CCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHhC-ccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCC-CChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhh
Confidence            999999874 66889999999999999999999999999998743 37899999999999999999999999999875  


Q ss_pred             --CCCCC--HHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCCH
Q 040136          585 --GLTPD--IVTYNSLINGLCKMGCIQEALNLFDKLQAEGIYPDAVTYNTLISWHFKEGLFDDAFLILHKGVANGFVPND  660 (681)
Q Consensus       585 --~~~p~--~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~g~~~~~  660 (681)
                        +..|+  ..+|..++.+|.+.|++++|++.++++.+.+ +.+..+|..++.+|.+.|++++|.+.++++++  +.|+.
T Consensus       507 ~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~--~~p~~  583 (597)
T 2xpi_A          507 KTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLS-TNDANVHTAIALVYLHKKIPGLAITHLHESLA--ISPNE  583 (597)
T ss_dssp             HSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHS-SCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--HCTTC
T ss_pred             ccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHh--cCCCC
Confidence              66787  7899999999999999999999999999864 44789999999999999999999999999998  45655


Q ss_pred             H-HHHHHH
Q 040136          661 A-TWYILV  667 (681)
Q Consensus       661 ~-~~~~ll  667 (681)
                      . .+..+.
T Consensus       584 ~~~~~~l~  591 (597)
T 2xpi_A          584 IMASDLLK  591 (597)
T ss_dssp             HHHHHHHH
T ss_pred             hHHHHHHH
Confidence            4 444443



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2qx5_A Nucleoporin NIC96; mRNA transport, nuclear pore complex, nucleus, protein transport, translocation, transport, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2rfo_A Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 681
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-04
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 42.4 bits (98), Expect = 2e-04
 Identities = 36/185 (19%), Positives = 66/185 (35%), Gaps = 9/185 (4%)

Query: 449 IINEMLAKGLSLNTGDRIEEALGLYQDMLLEGVTANTVTYNTLIHAFLRRGSLHEAHKLV 508
            ++  +  G  L      + A+  Y   L      + V +  L   +  +G +  A    
Sbjct: 202 FLDAYINLGNVLKEARIFDRAVAAYLRAL-SLSPNHAVVHGNLACVYYEQGLIDLAIDTY 260

Query: 509 NDMLFRGCPLDEITYNGLIKALCNAGAVDKGLGLFEEMMRKGIKPSSISCNILINGLCRT 568
              +    P     Y  L  AL   G+V +    +   +R      + S N L N     
Sbjct: 261 RRAI-ELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRL-CPTHADSLNNLANIKREQ 318

Query: 569 RKANTALEFLRDMIHRGLTPDIV-TYNSLINGLCKMGCIQEALNLFDKLQAEGIYPD-AV 626
                A+   R  +   + P+    +++L + L + G +QEAL  + +  A  I P  A 
Sbjct: 319 GNIEEAVRLYRKALE--VFPEFAAAHSNLASVLQQQGKLQEALMHYKE--AIRISPTFAD 374

Query: 627 TYNTL 631
            Y+ +
Sbjct: 375 AYSNM 379


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query681
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.92
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.91
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.56
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.54
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.17
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.17
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.15
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.14
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.12
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.05
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.02
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.95
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.91
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.9
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.58
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.57
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.57
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.55
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.51
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.45
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.43
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.4
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.4
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.36
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.3
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.28
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.23
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.22
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.19
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.16
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.16
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.15
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.07
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.05
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.04
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.03
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.03
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.92
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.82
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.78
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.75
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.73
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.73
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.72
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.66
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.63
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.61
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.49
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.49
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.38
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.36
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.18
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.72
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.71
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.46
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.14
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.89
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 94.69
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.43
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 93.23
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 92.39
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 92.2
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 90.15
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 86.11
d1bpoa1157 Clathrin heavy-chain linker domain {Rat (Rattus no 81.83
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92  E-value=1.1e-20  Score=189.73  Aligned_cols=382  Identities=14%  Similarity=0.077  Sum_probs=266.3

Q ss_pred             HHHHHHhcCChhHHHHHHHHHHhCCCCCChhhHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCC
Q 040136          226 VMKALCMVNEVDSACSLLRDMTKHGCVPNSVVYQTLIHALSKSNRVSEALMLLEEMILMGCTSDVQTFNDVIHGLCKVNR  305 (681)
Q Consensus       226 ll~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~A~~~~~~m~~~~~~~~~~~~~~li~~~~~~~~  305 (681)
                      +...+.+.|++++|.+.++++.+.. |.+..++..+..+|.+.|++++|.+.+++..+.. +.+..++..+...+...|+
T Consensus         5 la~~~~~~G~~~~A~~~~~~~l~~~-p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~-p~~~~a~~~l~~~~~~~g~   82 (388)
T d1w3ba_           5 LAHREYQAGDFEAAERHCMQLWRQE-PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-PLLAEAYSNLGNVYKERGQ   82 (388)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHhhhhcc
Confidence            3455667788888888888777664 4456777777777778888888888887777654 4456677777777777777


Q ss_pred             HHHHHHHHHHHHHCCCCCCcccHHHHHHHHHhcCCHHHHHHHHhhcCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHh
Q 040136          306 IHEAAKLVDRMLVRGFTPDDITYGVLMHGLCRTGRVDEARALLNKIPSANVVLLNTVINGYVISGRFDEAKAIFYDSMLS  385 (681)
Q Consensus       306 ~~~a~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~  385 (681)
                      +++|+..+......... +.............                               .+....+.. .......
T Consensus        83 ~~~A~~~~~~~~~~~~~-~~~~~~~~~~~~~~-------------------------------~~~~~~~~~-~~~~~~~  129 (388)
T d1w3ba_          83 LQEAIEHYRHALRLKPD-FIDGYINLAAALVA-------------------------------AGDMEGAVQ-AYVSALQ  129 (388)
T ss_dssp             HHHHHHHHHHHHHHCTT-CHHHHHHHHHHHHH-------------------------------HSCSSHHHH-HHHHHHH
T ss_pred             ccccccccccccccccc-cccccccccccccc-------------------------------ccccccccc-ccccccc
Confidence            77777777777665322 22222222222222                               222222222 1111111


Q ss_pred             CCCCCCHHHHHHHHHHHHhcCChhHHHHHHHHHHhcCCCcCHhhHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCcccc
Q 040136          386 VGCIPDVFTFNILIHGLCKQRRFGSALELVNAMAVKGCEPNIVTYTILVDGFCKEGQLEKANIIINEMLAKGLSLNTGDR  465 (681)
Q Consensus       386 ~~~~p~~~~~~~ll~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~~ll~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~  465 (681)
                      .. .................+....+...+....... +.+...+..+...+...|++++|...+.+.++..        
T Consensus       130 ~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~--------  199 (388)
T d1w3ba_         130 YN-PDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD--------  199 (388)
T ss_dssp             HC-TTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC--------
T ss_pred             cc-cccccccccccccccccchhhhhHHHHHHhhccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHhC--------
Confidence            11 2233344445555666677777777776666552 3345667777777888888888888887776643        


Q ss_pred             HHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHH
Q 040136          466 IEEALGLYQDMLLEGVTANTVTYNTLIHAFLRRGSLHEAHKLVNDMLFRGCPLDEITYNGLIKALCNAGAVDKGLGLFEE  545 (681)
Q Consensus       466 ~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~  545 (681)
                                      +.+...+..+...+...|++++|...++...... +.+...+..+...+.+.|++++|+..|++
T Consensus       200 ----------------p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~  262 (388)
T d1w3ba_         200 ----------------PNFLDAYINLGNVLKEARIFDRAVAAYLRALSLS-PNHAVVHGNLACVYYEQGLIDLAIDTYRR  262 (388)
T ss_dssp             ----------------TTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHH
T ss_pred             ----------------cccHHHHHHHhhhhhccccHHHHHHHHHHhHHHh-hhHHHHHHHHHHHHHHCCCHHHHHHHHHH
Confidence                            2256677788888888888888888888887764 55677777888888888888888888888


Q ss_pred             HHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCC-
Q 040136          546 MMRKGIKPSSISCNILINGLCRTRKANTALEFLRDMIHRGLTPDIVTYNSLINGLCKMGCIQEALNLFDKLQAEGIYPD-  624 (681)
Q Consensus       546 ~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~p~-  624 (681)
                      +++... -+..++..+...+...|++++|++.++..... .+.+...+..+..++...|++++|+..++++++.  .|+ 
T Consensus       263 al~~~p-~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~-~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~  338 (388)
T d1w3ba_         263 AIELQP-HFPDAYCNLANALKEKGSVAEAEDCYNTALRL-CPTHADSLNNLANIKREQGNIEEAVRLYRKALEV--FPEF  338 (388)
T ss_dssp             HHHTCS-SCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHH-CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTS--CTTC
T ss_pred             HHHhCC-CCHHHHHHHHHHHHHcCCHHHHHHHHHhhhcc-CCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHh--CCCC
Confidence            887643 25677888888888888888888888888775 3456777888888888888999999998888874  454 


Q ss_pred             HHHHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCC-HHHHHHHHHHHHhcCc
Q 040136          625 AVTYNTLISWHFKEGLFDDAFLILHKGVANGFVPN-DATWYILVRNLVKEIN  675 (681)
Q Consensus       625 ~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~g~~~~-~~~~~~ll~~~~~~g~  675 (681)
                      ..++..++.+|.+.|++++|...++++++  +.|+ ...|..+...+.+.||
T Consensus       339 ~~~~~~la~~~~~~g~~~~A~~~~~~al~--l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         339 AAAHSNLASVLQQQGKLQEALMHYKEAIR--ISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHHHHHHHTTTCCHHHHHHHHHHHT--TCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHHHHcCCHHHHHHHHHHHHH--hCCCCHHHHHHHHHHHHHcCC
Confidence            66788888888889999999999998887  4564 5677888888877765



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bpoa1 a.118.1.4 (A:331-487) Clathrin heavy-chain linker domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure