Citrus Sinensis ID: 040176
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 142 | ||||||
| 255552664 | 419 | Auxin-induced protein 5NG4, putative [Ri | 0.584 | 0.198 | 0.747 | 3e-30 | |
| 356495907 | 367 | PREDICTED: auxin-induced protein 5NG4-li | 0.809 | 0.313 | 0.558 | 2e-25 | |
| 358248788 | 371 | uncharacterized protein LOC100814137 [Gl | 0.816 | 0.312 | 0.549 | 5e-25 | |
| 296087699 | 345 | unnamed protein product [Vitis vinifera] | 0.633 | 0.260 | 0.6 | 1e-24 | |
| 225452526 | 360 | PREDICTED: auxin-induced protein 5NG4 [V | 0.633 | 0.25 | 0.6 | 2e-24 | |
| 147778870 | 671 | hypothetical protein VITISV_027749 [Viti | 0.633 | 0.134 | 0.6 | 2e-24 | |
| 356550026 | 372 | PREDICTED: auxin-induced protein 5NG4-li | 0.605 | 0.231 | 0.640 | 2e-24 | |
| 356571529 | 366 | PREDICTED: auxin-induced protein 5NG4-li | 0.626 | 0.243 | 0.615 | 4e-24 | |
| 296087698 | 344 | unnamed protein product [Vitis vinifera] | 0.683 | 0.281 | 0.608 | 1e-23 | |
| 225452524 | 359 | PREDICTED: auxin-induced protein 5NG4 [V | 0.683 | 0.270 | 0.608 | 1e-23 |
| >gi|255552664|ref|XP_002517375.1| Auxin-induced protein 5NG4, putative [Ricinus communis] gi|223543386|gb|EEF44917.1| Auxin-induced protein 5NG4, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 136 bits (342), Expect = 3e-30, Method: Compositional matrix adjust.
Identities = 68/91 (74%), Positives = 78/91 (85%)
Query: 47 VYSYGVAALGPVFVAMFKPLSIAIAVAMGVMFLGDRLYLGSLVGATIISLGFYTVMWGKA 106
V+++ + GPVFVAMFKPLSIAIAVAMGVMFLGD L+LGSL+GATIIS+GFYTVMWGKA
Sbjct: 328 VHTWALHLKGPVFVAMFKPLSIAIAVAMGVMFLGDALHLGSLIGATIISIGFYTVMWGKA 387
Query: 107 KEEVSEDPGVDRQESAAAQKVPLLQSRKNEL 137
KEEV ED G +S +AQKVPLLQS K+EL
Sbjct: 388 KEEVIEDYGGSSLQSPSAQKVPLLQSYKDEL 418
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356495907|ref|XP_003516812.1| PREDICTED: auxin-induced protein 5NG4-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|358248788|ref|NP_001239940.1| uncharacterized protein LOC100814137 [Glycine max] gi|255641164|gb|ACU20859.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|296087699|emb|CBI34955.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225452526|ref|XP_002279762.1| PREDICTED: auxin-induced protein 5NG4 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147778870|emb|CAN62735.1| hypothetical protein VITISV_027749 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356550026|ref|XP_003543391.1| PREDICTED: auxin-induced protein 5NG4-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356571529|ref|XP_003553929.1| PREDICTED: auxin-induced protein 5NG4-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|296087698|emb|CBI34954.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225452524|ref|XP_002279776.1| PREDICTED: auxin-induced protein 5NG4 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 142 | ||||||
| TAIR|locus:2091363 | 367 | UMAMIT41 "AT3G28050" [Arabidop | 0.647 | 0.250 | 0.553 | 8.4e-41 | |
| TAIR|locus:2173752 | 370 | UMAMIT37 "AT5G40230" [Arabidop | 0.492 | 0.189 | 0.628 | 8.9e-21 | |
| TAIR|locus:2091383 | 360 | UMAMIT46 "AT3G28070" [Arabidop | 0.711 | 0.280 | 0.467 | 4.9e-20 | |
| TAIR|locus:2091393 | 358 | UMAMIT47 "AT3G28080" [Arabidop | 0.718 | 0.284 | 0.457 | 4.3e-19 | |
| TAIR|locus:2130344 | 347 | UMAMIT38 "AT4G15540" [Arabidop | 0.528 | 0.216 | 0.526 | 1.7e-18 | |
| TAIR|locus:2091368 | 355 | UMAMIT44 "AT3G28130" [Arabidop | 0.450 | 0.180 | 0.640 | 6e-18 | |
| TAIR|locus:2173737 | 339 | UMAMIT42 "Usually multiple aci | 0.732 | 0.306 | 0.415 | 2.2e-17 | |
| TAIR|locus:2091338 | 353 | UMAMIT45 "AT3G28100" [Arabidop | 0.563 | 0.226 | 0.512 | 4.9e-17 | |
| TAIR|locus:2020688 | 375 | UMAMIT36 "AT1G70260" [Arabidop | 0.464 | 0.176 | 0.363 | 6.7e-15 | |
| TAIR|locus:2202745 | 374 | UMAMIT35 "AT1G60050" [Arabidop | 0.528 | 0.200 | 0.333 | 4.7e-13 |
| TAIR|locus:2091363 UMAMIT41 "AT3G28050" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 270 (100.1 bits), Expect = 8.4e-41, Sum P(2) = 8.4e-41
Identities = 57/103 (55%), Positives = 77/103 (74%)
Query: 47 VYSYGVAALGPVFVAMFKPLSIAIAVAMGVMFLGDRLYLGSLVGATIISLGFYTVMWGKA 106
++++ + GP+FVAMFKPLSIAIAVAMGV+FL D LY+GSL+GAT+I++GFYTVMWGKA
Sbjct: 265 IHTWALRIKGPLFVAMFKPLSIAIAVAMGVIFLRDSLYIGSLIGATVITIGFYTVMWGKA 324
Query: 107 KEE--VSEDPGVDRQES--------AAAQKVPLLQSRKNELEH 139
KE V +D + +E+ + +QK PLL+S KN+ EH
Sbjct: 325 KEVALVEDDNKANHEEANEADLDSPSGSQKAPLLESYKND-EH 366
|
|
| TAIR|locus:2173752 UMAMIT37 "AT5G40230" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2091383 UMAMIT46 "AT3G28070" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2091393 UMAMIT47 "AT3G28080" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130344 UMAMIT38 "AT4G15540" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2091368 UMAMIT44 "AT3G28130" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2173737 UMAMIT42 "Usually multiple acids move in and out Transporters 42" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2091338 UMAMIT45 "AT3G28100" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2020688 UMAMIT36 "AT1G70260" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2202745 UMAMIT35 "AT1G60050" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00020780001 | SubName- Full=Chromosome chr14 scaffold_21, whole genome shotgun sequence; (360 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 142 | |||
| PLN00411 | 358 | PLN00411, PLN00411, nodulin MtN21 family protein; | 3e-25 | |
| PLN00411 | 358 | PLN00411, PLN00411, nodulin MtN21 family protein; | 6e-07 | |
| COG0697 | 292 | COG0697, RhaT, Permeases of the drug/metabolite tr | 0.004 |
| >gnl|CDD|177805 PLN00411, PLN00411, nodulin MtN21 family protein; Provisional | Back alignment and domain information |
|---|
Score = 97.7 bits (243), Expect = 3e-25
Identities = 49/107 (45%), Positives = 67/107 (62%), Gaps = 5/107 (4%)
Query: 30 TLFKAATSKGMSHFVFVVYSYGVAALGPVFVAMFKPLSIAIAVAMGVMFLGDRLYLGSLV 89
TL T ++ +V++S+ V GP+++A+FKPLSI IAV MG +FL D LYLG L+
Sbjct: 255 TLITIVTMAIITSVYYVIHSWTVRHKGPLYLAIFKPLSILIAVVMGAIFLNDSLYLGCLI 314
Query: 90 GATIISLGFYTVMWGKAKEEVSEDPGVDRQESAAAQKVPLLQSRKNE 136
G +I+LGFY VMWGKA EE + +E K PLL + KN+
Sbjct: 315 GGILITLGFYAVMWGKANEEKDQLLSFSGKE-----KTPLLLNGKND 356
|
Length = 358 |
| >gnl|CDD|177805 PLN00411, PLN00411, nodulin MtN21 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223769 COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 142 | |||
| PLN00411 | 358 | nodulin MtN21 family protein; Provisional | 99.7 | |
| PRK10532 | 293 | threonine and homoserine efflux system; Provisiona | 99.29 | |
| PRK11689 | 295 | aromatic amino acid exporter; Provisional | 99.18 | |
| PRK11453 | 299 | O-acetylserine/cysteine export protein; Provisiona | 99.17 | |
| PLN00411 | 358 | nodulin MtN21 family protein; Provisional | 99.15 | |
| PRK11272 | 292 | putative DMT superfamily transporter inner membran | 99.04 | |
| PF00892 | 126 | EamA: EamA-like transporter family; InterPro: IPR0 | 98.96 | |
| PRK15430 | 296 | putative chloramphenical resistance permease RarD; | 98.91 | |
| TIGR00817 | 302 | tpt Tpt phosphate/phosphoenolpyruvate translocator | 98.9 | |
| PRK02971 | 129 | 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl | 98.89 | |
| TIGR03340 | 281 | phn_DUF6 phosphonate utilization associated putati | 98.79 | |
| TIGR00950 | 260 | 2A78 Carboxylate/Amino Acid/Amine Transporter. | 98.71 | |
| PTZ00343 | 350 | triose or hexose phosphate/phosphate translocator; | 98.59 | |
| COG0697 | 292 | RhaT Permeases of the drug/metabolite transporter | 98.51 | |
| PRK15051 | 111 | 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol fl | 98.47 | |
| PF13536 | 113 | EmrE: Multidrug resistance efflux transporter | 98.42 | |
| PRK10452 | 120 | multidrug efflux system protein MdtJ; Provisional | 98.28 | |
| COG2510 | 140 | Predicted membrane protein [Function unknown] | 98.23 | |
| PRK15430 | 296 | putative chloramphenical resistance permease RarD; | 98.14 | |
| TIGR00688 | 256 | rarD rarD protein. This uncharacterized protein is | 98.09 | |
| TIGR03340 | 281 | phn_DUF6 phosphonate utilization associated putati | 98.04 | |
| TIGR00950 | 260 | 2A78 Carboxylate/Amino Acid/Amine Transporter. | 98.04 | |
| TIGR00776 | 290 | RhaT RhaT L-rhamnose-proton symporter family prote | 97.95 | |
| TIGR00817 | 302 | tpt Tpt phosphate/phosphoenolpyruvate translocator | 97.86 | |
| PRK11453 | 299 | O-acetylserine/cysteine export protein; Provisiona | 97.83 | |
| PRK09541 | 110 | emrE multidrug efflux protein; Reviewed | 97.77 | |
| PTZ00343 | 350 | triose or hexose phosphate/phosphate translocator; | 97.72 | |
| PF03151 | 153 | TPT: Triose-phosphate Transporter family; InterPro | 97.66 | |
| PRK11272 | 292 | putative DMT superfamily transporter inner membran | 97.63 | |
| COG5006 | 292 | rhtA Threonine/homoserine efflux transporter [Amin | 97.58 | |
| COG0697 | 292 | RhaT Permeases of the drug/metabolite transporter | 97.58 | |
| PF06027 | 334 | DUF914: Eukaryotic protein of unknown function (DU | 97.44 | |
| PF08449 | 303 | UAA: UAA transporter family; InterPro: IPR013657 T | 97.43 | |
| PRK11689 | 295 | aromatic amino acid exporter; Provisional | 97.4 | |
| COG2076 | 106 | EmrE Membrane transporters of cations and cationic | 97.3 | |
| PRK10650 | 109 | multidrug efflux system protein MdtI; Provisional | 97.25 | |
| PRK11431 | 105 | multidrug efflux system protein; Provisional | 97.21 | |
| TIGR00688 | 256 | rarD rarD protein. This uncharacterized protein is | 97.15 | |
| PF04142 | 244 | Nuc_sug_transp: Nucleotide-sugar transporter; Inte | 96.76 | |
| PF06027 | 334 | DUF914: Eukaryotic protein of unknown function (DU | 96.65 | |
| KOG4510 | 346 | consensus Permease of the drug/metabolite transpor | 96.59 | |
| COG2962 | 293 | RarD Predicted permeases [General function predict | 96.58 | |
| PF00893 | 93 | Multi_Drug_Res: Small Multidrug Resistance protein | 96.55 | |
| TIGR00803 | 222 | nst UDP-galactose transporter. NSTs generally appe | 96.5 | |
| TIGR00776 | 290 | RhaT RhaT L-rhamnose-proton symporter family prote | 96.29 | |
| COG2962 | 293 | RarD Predicted permeases [General function predict | 96.26 | |
| PF08449 | 303 | UAA: UAA transporter family; InterPro: IPR013657 T | 96.25 | |
| KOG1580 | 337 | consensus UDP-galactose transporter related protei | 96.2 | |
| PF10639 | 113 | UPF0546: Uncharacterised protein family UPF0546; I | 95.41 | |
| KOG4510 | 346 | consensus Permease of the drug/metabolite transpor | 94.67 | |
| PF06800 | 269 | Sugar_transport: Sugar transport protein; InterPro | 94.65 | |
| KOG1441 | 316 | consensus Glucose-6-phosphate/phosphate and phosph | 94.54 | |
| KOG2765 | 416 | consensus Predicted membrane protein [Function unk | 93.91 | |
| KOG4314 | 290 | consensus Predicted carbohydrate/phosphate translo | 93.32 | |
| PF05653 | 300 | Mg_trans_NIPA: Magnesium transporter NIPA; InterPr | 92.83 | |
| KOG2765 | 416 | consensus Predicted membrane protein [Function unk | 92.07 | |
| KOG1581 | 327 | consensus UDP-galactose transporter related protei | 91.53 | |
| KOG1582 | 367 | consensus UDP-galactose transporter related protei | 91.43 | |
| PRK10532 | 293 | threonine and homoserine efflux system; Provisiona | 90.9 | |
| KOG2234 | 345 | consensus Predicted UDP-galactose transporter [Car | 90.82 | |
| COG4975 | 288 | GlcU Putative glucose uptake permease [Carbohydrat | 90.15 | |
| KOG2234 | 345 | consensus Predicted UDP-galactose transporter [Car | 89.04 | |
| COG3169 | 116 | Uncharacterized protein conserved in bacteria [Fun | 88.79 | |
| PF04342 | 108 | DUF486: Protein of unknown function, DUF486; Inter | 88.41 | |
| KOG1583 | 330 | consensus UDP-N-acetylglucosamine transporter [Car | 85.94 | |
| KOG4831 | 125 | consensus Unnamed protein [Function unknown] | 85.35 | |
| PF06800 | 269 | Sugar_transport: Sugar transport protein; InterPro | 82.85 | |
| PRK13499 | 345 | rhamnose-proton symporter; Provisional | 82.78 | |
| PF04246 | 135 | RseC_MucC: Positive regulator of sigma(E), RseC/Mu | 81.0 | |
| COG5070 | 309 | VRG4 Nucleotide-sugar transporter [Carbohydrate tr | 80.31 |
| >PLN00411 nodulin MtN21 family protein; Provisional | Back alignment and domain information |
|---|
Probab=99.70 E-value=4e-17 Score=138.94 Aligned_cols=96 Identities=48% Similarity=0.855 Sum_probs=83.7
Q ss_pred HHHhch-hHHHHHHHHHhhhccCchhhhhhhhHHHHHHHHHHHHHhccccccchhhhhHHHHHHHHHHHhccccccccCC
Q 040176 35 ATSKGM-SHFVFVVYSYGVAALGPVFVAMFKPLSIAIAVAMGVMFLGDRLYLGSLVGATIISLGFYTVMWGKAKEEVSED 113 (142)
Q Consensus 35 ~l~~Gi-S~la~~l~~~~i~~~gps~~s~~~~l~PV~a~ila~l~LgE~l~l~~iiG~~lil~Gv~l~~~~k~~~~~~~~ 113 (142)
++|.|+ +.++|.+|+|+++++||+++|++.|++|++++++|++++||++++.+++|+++|+.|++++.|.|++|.+.++
T Consensus 259 i~y~~i~t~lay~lw~~~v~~~ga~~as~~~~L~PV~a~llg~l~LgE~lt~~~~iG~~LIl~Gv~l~~~~~~~~~~~~~ 338 (358)
T PLN00411 259 IVTMAIITSVYYVIHSWTVRHKGPLYLAIFKPLSILIAVVMGAIFLNDSLYLGCLIGGILITLGFYAVMWGKANEEKDQL 338 (358)
T ss_pred HHHHHHHHHHHHHHHHHHHhccCchHHHHHHhHHHHHHHHHHHHHhCCCCcHHHHHHHHHHHHHHHHHHhhhhhhhhhcc
Confidence 556666 6789999999999999999999999999999999999999999999999999999999999997766644333
Q ss_pred CCCCcccCcccccccccccccc
Q 040176 114 PGVDRQESAAAQKVPLLQSRKN 135 (142)
Q Consensus 114 ~~~~~~~~~~~~~~~~~~~~~~ 135 (142)
..+ +| +||.|++.||+|
T Consensus 339 ~~~----~~-~~~~~~~~~~~~ 355 (358)
T PLN00411 339 LSF----SG-KEKTPLLLNGKN 355 (358)
T ss_pred cCc----cc-cccchhhhhccc
Confidence 332 34 888999999988
|
|
| >PRK10532 threonine and homoserine efflux system; Provisional | Back alignment and domain information |
|---|
| >PRK11689 aromatic amino acid exporter; Provisional | Back alignment and domain information |
|---|
| >PRK11453 O-acetylserine/cysteine export protein; Provisional | Back alignment and domain information |
|---|
| >PLN00411 nodulin MtN21 family protein; Provisional | Back alignment and domain information |
|---|
| >PRK11272 putative DMT superfamily transporter inner membrane protein; Provisional | Back alignment and domain information |
|---|
| >PF00892 EamA: EamA-like transporter family; InterPro: IPR000620 This domain is found in proteins including the Erwinia chrysanthemi PecM protein, which is involved in pectinase, cellulase and blue pigment regulation; and the Salmonella typhimurium PagO protein, the function of which is unknown | Back alignment and domain information |
|---|
| >PRK15430 putative chloramphenical resistance permease RarD; Provisional | Back alignment and domain information |
|---|
| >TIGR00817 tpt Tpt phosphate/phosphoenolpyruvate translocator | Back alignment and domain information |
|---|
| >PRK02971 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; Provisional | Back alignment and domain information |
|---|
| >TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein | Back alignment and domain information |
|---|
| >TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter | Back alignment and domain information |
|---|
| >PTZ00343 triose or hexose phosphate/phosphate translocator; Provisional | Back alignment and domain information |
|---|
| >COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK15051 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnE; Provisional | Back alignment and domain information |
|---|
| >PF13536 EmrE: Multidrug resistance efflux transporter | Back alignment and domain information |
|---|
| >PRK10452 multidrug efflux system protein MdtJ; Provisional | Back alignment and domain information |
|---|
| >COG2510 Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15430 putative chloramphenical resistance permease RarD; Provisional | Back alignment and domain information |
|---|
| >TIGR00688 rarD rarD protein | Back alignment and domain information |
|---|
| >TIGR03340 phn_DUF6 phosphonate utilization associated putative membrane protein | Back alignment and domain information |
|---|
| >TIGR00950 2A78 Carboxylate/Amino Acid/Amine Transporter | Back alignment and domain information |
|---|
| >TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein | Back alignment and domain information |
|---|
| >TIGR00817 tpt Tpt phosphate/phosphoenolpyruvate translocator | Back alignment and domain information |
|---|
| >PRK11453 O-acetylserine/cysteine export protein; Provisional | Back alignment and domain information |
|---|
| >PRK09541 emrE multidrug efflux protein; Reviewed | Back alignment and domain information |
|---|
| >PTZ00343 triose or hexose phosphate/phosphate translocator; Provisional | Back alignment and domain information |
|---|
| >PF03151 TPT: Triose-phosphate Transporter family; InterPro: IPR004853 This family consists entirely of aligned regions from Drosophila melanogaster proteins | Back alignment and domain information |
|---|
| >PRK11272 putative DMT superfamily transporter inner membrane protein; Provisional | Back alignment and domain information |
|---|
| >COG5006 rhtA Threonine/homoserine efflux transporter [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0697 RhaT Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PF06027 DUF914: Eukaryotic protein of unknown function (DUF914); InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >PF08449 UAA: UAA transporter family; InterPro: IPR013657 This family includes transporters with a specificity for UDP-N-acetylglucosamine [] | Back alignment and domain information |
|---|
| >PRK11689 aromatic amino acid exporter; Provisional | Back alignment and domain information |
|---|
| >COG2076 EmrE Membrane transporters of cations and cationic drugs [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10650 multidrug efflux system protein MdtI; Provisional | Back alignment and domain information |
|---|
| >PRK11431 multidrug efflux system protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00688 rarD rarD protein | Back alignment and domain information |
|---|
| >PF04142 Nuc_sug_transp: Nucleotide-sugar transporter; InterPro: IPR007271 This family of membrane proteins transport nucleotide sugars from the cytoplasm into golgi vesicles | Back alignment and domain information |
|---|
| >PF06027 DUF914: Eukaryotic protein of unknown function (DUF914); InterPro: IPR009262 This family consists of several hypothetical proteins of unknown function | Back alignment and domain information |
|---|
| >KOG4510 consensus Permease of the drug/metabolite transporter (DMT) superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >COG2962 RarD Predicted permeases [General function prediction only] | Back alignment and domain information |
|---|
| >PF00893 Multi_Drug_Res: Small Multidrug Resistance protein; InterPro: IPR000390 Members of this family which have been characterised, belong to the small multidrug resistance (Smr) protein family and are integral membrane proteins | Back alignment and domain information |
|---|
| >TIGR00803 nst UDP-galactose transporter | Back alignment and domain information |
|---|
| >TIGR00776 RhaT RhaT L-rhamnose-proton symporter family protein | Back alignment and domain information |
|---|
| >COG2962 RarD Predicted permeases [General function prediction only] | Back alignment and domain information |
|---|
| >PF08449 UAA: UAA transporter family; InterPro: IPR013657 This family includes transporters with a specificity for UDP-N-acetylglucosamine [] | Back alignment and domain information |
|---|
| >KOG1580 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF10639 UPF0546: Uncharacterised protein family UPF0546; InterPro: IPR018908 This family of proteins has no known function | Back alignment and domain information |
|---|
| >KOG4510 consensus Permease of the drug/metabolite transporter (DMT) superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF06800 Sugar_transport: Sugar transport protein; InterPro: IPR010651 This is a family of bacterial sugar transporters approximately 300 residues long | Back alignment and domain information |
|---|
| >KOG1441 consensus Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter [Carbohydrate transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2765 consensus Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4314 consensus Predicted carbohydrate/phosphate translocator [General function prediction only] | Back alignment and domain information |
|---|
| >PF05653 Mg_trans_NIPA: Magnesium transporter NIPA; InterPro: IPR008521 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG2765 consensus Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1581 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1582 consensus UDP-galactose transporter related protein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10532 threonine and homoserine efflux system; Provisional | Back alignment and domain information |
|---|
| >KOG2234 consensus Predicted UDP-galactose transporter [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG4975 GlcU Putative glucose uptake permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2234 consensus Predicted UDP-galactose transporter [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG3169 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF04342 DUF486: Protein of unknown function, DUF486; InterPro: IPR007437 This family contains several proteins of uncharacterised function | Back alignment and domain information |
|---|
| >KOG1583 consensus UDP-N-acetylglucosamine transporter [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4831 consensus Unnamed protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06800 Sugar_transport: Sugar transport protein; InterPro: IPR010651 This is a family of bacterial sugar transporters approximately 300 residues long | Back alignment and domain information |
|---|
| >PRK13499 rhamnose-proton symporter; Provisional | Back alignment and domain information |
|---|
| >PF04246 RseC_MucC: Positive regulator of sigma(E), RseC/MucC; InterPro: IPR007359 This bacterial family of integral membrane proteins represents a positive regulator of the sigma(E) transcription factor, namely RseC/MucC | Back alignment and domain information |
|---|
| >COG5070 VRG4 Nucleotide-sugar transporter [Carbohydrate transport and metabolism / Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 142 | |||
| 2i68_A | 137 | Protein EMRE; transmembrane protein, small-multidr | 99.16 | |
| 3b5d_A | 110 | Multidrug transporter EMRE; helical membrane prote | 98.78 |
| >2i68_A Protein EMRE; transmembrane protein, small-multidrug resistance, transporter, homodimer, dual topology, transport protein; NMR {Escherichia coli} | Back alignment and structure |
|---|
Probab=99.16 E-value=9.2e-11 Score=87.24 Aligned_cols=65 Identities=17% Similarity=0.226 Sum_probs=50.2
Q ss_pred hHHHHHHHHHhhhccCchhhhhh-hhHHHHHHHHHHHHHhccccccchhhhhHHHHHHHHHHHhcc
Q 040176 41 SHFVFVVYSYGVAALGPVFVAMF-KPLSIAIAVAMGVMFLGDRLYLGSLVGATIISLGFYTVMWGK 105 (142)
Q Consensus 41 S~la~~l~~~~i~~~gps~~s~~-~~l~PV~a~ila~l~LgE~l~l~~iiG~~lil~Gv~l~~~~k 105 (142)
+.++|.+|.+++++.+++.+..+ ..+.|++++++|+++++|++++.+++|.++|++|+++.++.+
T Consensus 40 ~~ls~~l~~~alk~i~~s~ay~iw~~l~pv~~~l~g~l~lgE~ls~~~~~Gi~LIi~GV~ll~~~~ 105 (137)
T 2i68_A 40 YCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLS 105 (137)
T ss_dssp HHHHHHHHHHHHC-----CHHHHHHHHHHHHHHHHHHHHHC------CHHHHHHHHHHHHHHHHC-
T ss_pred HHHHHHHHHHHHHhCChhHHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHHHHHhcCC
Confidence 88899999999999999999887 899999999999999999999999999999999999988754
|
| >3b5d_A Multidrug transporter EMRE; helical membrane protein, multidrug resistance transporter, SMR, antiport, inner membrane, transmembrane; HET: P4P; 3.80A {Escherichia coli K12} PDB: 3b61_A 3b62_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00