Citrus Sinensis ID: 040184


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------70
MTSLRVLSLDLNQLTGNISSSPLIHLTSIERLFLSYNQFQIPFSLEPFFNNSKLKVFSGECNEIFVESESSHSMTPKFQLESVALSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEFLNWLLENNTNLNTLVLRNNSLSGPFRMPIQPHWHLDTLYVSKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIGDMNSLEALDLSHNQLTGEIPEHLAMSCFNLEFLVLSENSLLGQLFSKKNYLRKLVSLHLDANYFTGEIPKSLSNCSHLEGLYMSDNNLYGNIPAWLGNLSSLYDIMMASNHLQGPIPLEFCQLNYLQILDLSENNISGSLPSCSSHSSITQVHLSKNMLYGPLRYGTFFNRSSIVTLDLSYNSFSGYIPYWIERLTYLRYLILANNNLEGEVPIQLCRLKQLRLIDLSNNNIFGQIPGCLDNTSLHNNGDNDDSLVPAFNHNVRSTYSAGSSTMEKEESIMFTTKEISFSYKGKPLNKMYGVDLSCNKLTGEIPPQISKLTRIRALNLSHNNLTGVIPVTFSNLNQVESLDISYNNLNGKIPPQLVELNALAFFSVAHNNLSGKIPEWTAQFTTFKEDSYEGNPLLCGKPLPDCDVAAVPEASNEEDGNSLIDMGSFYITFTSSYVIVILAIIGVLYVNPYWHRRWFYLIENWMTSCFYFIIDNLIPTRFYHACMQLHYYLV
cccccEEEccccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEccccccEEEcccHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEccccEEEEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEEcccccccccccEEEcccccccccccHHHHcccccccEEEccccEEcccccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHcccccccccccccccccccccccccccccccccccEEEEEEEccEEEEEccccccccEEEEcccccccccccHHHHccccccccccccccccccccHHHHccccccEEccccccccccccHHHHcccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEHHHHHHHHEEEEHHHHccHHHHHHHHHHHHHHHEEEEEEEEEcccccccccccccEEEEEc
ccccEEEEEccccccccccHHHHHccccccEEEcccccccccccHHHHccccccEEEEEccccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEEccccccccccHHHHHccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHHHccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHHcccccccEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccccccccccEEEEEccccccccccHHHHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHcccccHHEEEccccccccccccccccccHcHccccHccEEEccccccccccccccccccEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHcHHHHHHHHHHHHHHc
MTSLRVLSLDlnqltgnisssplihLTSIERLFLSYnqfqipfslepffnnsklkvfsgECNEIFVesesshsmtpkfqLESVAlsgsgihatfpkflynqhdleyvdfsdsnlkgEFLNWLLENNTNLNTLVLRnnslsgpfrmpiqphwhldtlyvsknffqgnipleigvyfPRLVYLnlsrndfngsipssigdmnslealdlshnqltgeipehlamsCFNLEFLVLSENSLlgqlfskkNYLRKLVSLHldanyftgeipkslsncshleglymsdnnlygnipawlGNLSSLYDIMMASnhlqgpiplefcqlNYLQILDlsennisgslpscsshssitqvhlsknmlygplrygtffnrssivtldlsynsfsgyiPYWIERLTYLRYLILANnnlegevpiqLCRLKQLRLidlsnnnifgqipgcldntslhnngdnddslvpafnhnvrstysagsstmekEESIMFTTKEisfsykgkplnkmygvdlscnkltgeippqisKLTRIRALNlshnnltgvipvtfsnlnqveSLDIsynnlngkippqLVELNALAFFSVAHnnlsgkipewtAQFTtfkedsyegnpllcgkplpdcdvaavpeasneedgnslidmgsfyiTFTSSYVIVILAIIGVLYVNPYWHRRWFYLIENWMTSCFYFIIDNLIPTRFYHACMQLHYYLV
MTSLRVLSLDLNqltgnissspLIHLTSIERLFLSYNQFQIPFSLEPFFNNSKLKVFSGECNEIFVEsesshsmtPKFQLESVALSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEFLNWLLENNTNLNTLVLRNNSLSGPFRMPIQPHWHLDTLYVSKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIGDMNSLEALDLSHNQLTGEIPEHLAMSCFNLEFLVLSENSLLGQLFSKKNYLRKLVSLHLDANYFTGEIPKSLSNCSHLEGLYMSDNNLYGNIPAWLGNLSSLYDIMMASNHLQGPIPLEFCQLNYLQILDLSENNISGSLPSCSSHSSITQVHLSKNMLYGPLRYGTFFNRSSIVTLDLSYNSFSGYIPYWIERLTYLRYLILANNNLEGEVPIQLCRLKQLRLIDLSNNNIFGQIPGCLDNTSLHNNGDNDDSLVPAFNHNVRStysagsstmekeESIMFTTKEISFSYKGKPLNKMYGVDLSCNKLTGEIPPQISKLTRIRALNLSHNNLTGVIPVTFSNLNQVESLDISYNNLNGKIPPQLVELNALAFFSVAHNNLSGKIPEWTAQFTTFKEDSYEGNPLLCGKPLPDCDVAAVPeasneedgnsLIDMGSFYITFTSSYVIVILAIIGVLYVNPYWHRRWFYLIENWMTSCFYFIIDNLIPTRFYHACMQLHYYLV
MTSLRVLSLDLNQLTGNISSSPLIHLTSIERLFLSYNQFQIPFSLEPFFNNSKLKVFSGECNEIFVESESSHSMTPKFQLESVALSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEFlnwllenntnlntlvlrnnslSGPFRMPIQPHWHLDTLYVSKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIGDMNSLEALDLSHNQLTGEIPEHLAMSCFNLEFLVLSENSLLGQLFSKKNYLRKLVSLHLDANYFTGEIPKSLSNCSHLEGLYMSDNNLYGNIPAWLGNLSSLYDIMMASNHLQGPIPLEFCQLNYLQILDLSENNIsgslpscsshssITQVHLSKNMLYGPLRYGTFFNRSSIVTLDLSYNSFSGYIPYWIERLTYLRYLILANNNLEGEVPIQLCRLKQLRLIDLSNNNIFGQIPGCLDNTSLHNNGDNDDSLVPAFNHNVRSTYSAGSSTMEKEESIMFTTKEISFSYKGKPLNKMYGVDLSCNKLTGEIPPQISKLTRIRALNLSHNNLTGVIPVTFSNLNQVESLDISYNNLNGKIPPQLVELNALAFFSVAHNNLSGKIPEWTAQFTTFKEDSYEGNPLLCGKPLPDCDVAAVPEASNEEDGNSLIDMGSFYITFTSSYVIVILAIIGVLYVNPYWHRRWFYLIENWMTSCFYFIIDNLIPTRFYHACMQLHYYLV
******LSLDLNQLTGNISSSPLIHLTSIERLFLSYNQFQIPFSLEPFFNNSKLKVFSGECNEIFVE***********QLESVALSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEFLNWLLENNTNLNTLVLRNNSLSGPFRMPIQPHWHLDTLYVSKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIP**I****SLEALDLSHNQLTGEIPEHLAMSCFNLEFLVLSENSLLGQLFSKKNYLRKLVSLHLDANYFTGEIPKSLSNCSHLEGLYMSDNNLYGNIPAWLGNLSSLYDIMMASNHLQGPIPLEFCQLNYLQILDLSENNIS**********SITQVHLSKNMLYGPLRYGTFFNRSSIVTLDLSYNSFSGYIPYWIERLTYLRYLILANNNLEGEVPIQLCRLKQLRLIDLSNNNIFGQIPGCLDNTSL**********************************IMFTTKEISFSYKGKPLNKMYGVDLSCNKLTGEIPPQISKLTRIRALNLSHNNLTGVIPVTFSNLNQVESLDISYNNLNGKIPPQLVELNALAFFSVAHNNLSGKIPEWTAQFTTFKEDSYEGNPLLCGKPLPDCDVAAV**********SLIDMGSFYITFTSSYVIVILAIIGVLYVNPYWHRRWFYLIENWMTSCFYFIIDNLIPTRFYHACMQLHYYL*
MTSLRVLSLDLNQLTGNISSSPLIHLTSIERLFLSYNQFQIPFSLEPFFNNSKLKVFSGECNEIFVESESSHSMTPKFQLESVALSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEFLNWLLENNTNLNTLVLRNNSLSGPFRMPIQPHWHLDTLYVSKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIGDMNSLEALDLSHNQLTGEIPEHLAMSCFNLEFLVLSENSLLGQLFSKKNYLRKLVSLHLDANYFTGEIPKSLSNCSHLEGLYMSDNNLYGNIPAWLGNLSSLYDIMMASNHLQGPIPLEFCQLNYLQILDLSENNISGSLPSCSSHSSITQVHLSKNMLYGPLRYGTFFNRSSIVTLDLSYNSFSGYIPYWIERLTYLRYLILANNNLEGEVPIQLCRLKQLRLIDLSNNNIFGQIPGCLDNTSLHNN*********AFNHNVRSTYSAGSSTMEKEESIMFTTKEISFSYKGKPLNKMYGVDLSCNKLTGEIPPQISKLTRIRALNLSHNNLTGVIPVTFSNLNQVESLDISYNNLNGKIPPQLVELNALAFFSVAHNNLSGKIPEWTAQFTTFKEDSYEGNPLLCG***************************SFYITFTSSYVIVILAIIGVLYVNPYWHRRWFYLIENWMTSCFYFIIDNLIPTRFYHACMQLHYYLV
MTSLRVLSLDLNQLTGNISSSPLIHLTSIERLFLSYNQFQIPFSLEPFFNNSKLKVFSGECNEIFVE********PKFQLESVALSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEFLNWLLENNTNLNTLVLRNNSLSGPFRMPIQPHWHLDTLYVSKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIGDMNSLEALDLSHNQLTGEIPEHLAMSCFNLEFLVLSENSLLGQLFSKKNYLRKLVSLHLDANYFTGEIPKSLSNCSHLEGLYMSDNNLYGNIPAWLGNLSSLYDIMMASNHLQGPIPLEFCQLNYLQILDLSENNISGS************VHLSKNMLYGPLRYGTFFNRSSIVTLDLSYNSFSGYIPYWIERLTYLRYLILANNNLEGEVPIQLCRLKQLRLIDLSNNNIFGQIPGCLDNTSLHNNGDNDDSLVPAFNHNVRS***********EESIMFTTKEISFSYKGKPLNKMYGVDLSCNKLTGEIPPQISKLTRIRALNLSHNNLTGVIPVTFSNLNQVESLDISYNNLNGKIPPQLVELNALAFFSVAHNNLSGKIPEWTAQFTTFKEDSYEGNPLLCGKPLPDCDVAAVPEASNEEDGNSLIDMGSFYITFTSSYVIVILAIIGVLYVNPYWHRRWFYLIENWMTSCFYFIIDNLIPTRFYHACMQLHYYLV
*TSLRVLSLDLNQLTGNISSSPLIHLTSIERLFLSYNQFQIPFSLEPFFNNSKLKVFSGECNEIFVESESSHSMTPKFQLESVALSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEFLNWLLENNTNLNTLVLRNNSLSGPFRMPIQPHWHLDTLYVSKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIGDMNSLEALDLSHNQLTGEIPEHLAMSCFNLEFLVLSENSLLGQLFSKKNYLRKLVSLHLDANYFTGEIPKSLSNCSHLEGLYMSDNNLYGNIPAWLGNLSSLYDIMMASNHLQGPIPLEFCQLNYLQILDLSENNISGSLPSCSSHSSITQVHLSKNMLYGPLRYGTFFNRSSIVTLDLSYNSFSGYIPYWIERLTYLRYLILANNNLEGEVPIQLCRLKQLRLIDLSNNNIFGQIPGCLDNTSLHNNGDNDDSLVPAFNHNVRSTYSAGSSTMEKEESIMFTTKEISFSYKGKPLNKMYGVDLSCNKLTGEIPPQISKLTRIRALNLSHNNLTGVIPVTFSNLNQVESLDISYNNLNGKIPPQLVELNALAFFSVAHNNLSGKIPEWTAQFTTFKEDSYEGNPLLCGKPLPDCDVAAVPEA******NSLIDMGSFYITFTSSYVIVILAIIGVLYVNPYWHRRWFYLIENWMTSCFYFIIDNLIPTRFYHACMQLHYYLV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSLRVLSLDLNQLTGNISSSPLIHLTSIERLFLSYNQFQIPFSLEPFFNNSKLKVFSGECNEIFVESESSHSMTPKFQLESVALSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEFLNWLLENNTNLNTLVLRNNSLSGPFRMPIQPHWHLDTLYVSKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIGDMNSLEALDLSHNQLTGEIPEHLAMSCFNLEFLVLSENSLLGQLFSKKNYLRKLVSLHLDANYFTGEIPKSLSNCSHLEGLYMSDNNLYGNIPAWLGNLSSLYDIMMASNHLQGPIPLEFCQLNYLQILDLSENNISGSLPSCSSHSSITQVHLSKNMLYGPLRYGTFFNRSSIVTLDLSYNSFSGYIPYWIERLTYLRYLILANNNLEGEVPIQLCRLKQLRLIDLSNNNIFGQIPGCLDNTSLHNNGDNDDSLVPAFNHNVRSTYSAGSSTMEKEESIMFTTKEISFSYKGKPLNKMYGVDLSCNKLTGEIPPQISKLTRIRALNLSHNNLTGVIPVTFSNLNQVESLDISYNNLNGKIPPQLVELNALAFFSVAHNNLSGKIPEWTAQFTTFKEDSYEGNPLLCGKPLPDCDVAAVPEASNEEDGNSLIDMGSFYITFTSSYVIVILAIIGVLYVNPYWHRRWFYLIENWMTSCFYFIIDNLIPTRFYHACMQLHYYLV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query699 2.2.26 [Sep-21-2011]
C0LGQ5 1249 LRR receptor-like serine/ no no 0.911 0.510 0.296 8e-60
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.856 0.478 0.312 1e-59
Q9FL28 1173 LRR receptor-like serine/ no no 0.786 0.468 0.311 1e-58
Q9SHI2 1101 Leucine-rich repeat recep no no 0.904 0.574 0.306 3e-57
Q9LJF3 1164 Receptor-like protein kin no no 0.941 0.565 0.291 5e-57
Q8L899 1207 Systemin receptor SR160 O N/A no 0.846 0.490 0.300 6e-56
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.846 0.490 0.300 1e-55
Q9LYN8 1192 Leucine-rich repeat recep no no 0.848 0.497 0.302 1e-55
Q9ZWC8 1166 Serine/threonine-protein no no 0.805 0.482 0.301 4e-55
P93194 1109 Receptor-like protein kin N/A no 0.696 0.439 0.325 9e-55
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function desciption
 Score =  232 bits (591), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 220/743 (29%), Positives = 354/743 (47%), Gaps = 106/743 (14%)

Query: 1   MTSLRVLSLDLNQLTGNISSSPLIHLTSIERLFLSYNQFQIPFSLEPFFNNSKLKVFS-- 58
           + +L++L+L   +LTG I S  L  L  ++ L L  N  + P   E   N S L VF+  
Sbjct: 166 LVNLQMLALASCRLTGPIPSQ-LGRLVRVQSLILQDNYLEGPIPAE-LGNCSDLTVFTAA 223

Query: 59  ------------GECNEIFVESESSHSMTPKF--------QLESVALSGSGIHATFPKFL 98
                       G    + + + +++S+T +         QL+ ++L  + +    PK L
Sbjct: 224 ENMLNGTIPAELGRLENLEILNLANNSLTGEIPSQLGEMSQLQYLSLMANQLQGLIPKSL 283

Query: 99  YNQHDLEYVDFSDSNLKGEFLN--WLLENNTNLNTLVLRNNSLSGPFRMPI-QPHWHLDT 155
            +  +L+ +D S +NL GE     W   N + L  LVL NN LSG     I   + +L+ 
Sbjct: 284 ADLGNLQTLDLSANNLTGEIPEEFW---NMSQLLDLVLANNHLSGSLPKSICSNNTNLEQ 340

Query: 156 LYVSKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIGDMNSLEALDLSHNQLTGE 215
           L +S     G IP+E+      L  L+LS N   GSIP ++ ++  L  L L +N L G 
Sbjct: 341 LVLSGTQLSGEIPVELS-KCQSLKQLDLSNNSLAGSIPEALFELVELTDLYLHNNTLEGT 399

Query: 216 IPEHLAMSCFNLEFLVLSENSLLGQLFSKKNYLRKLVSLHLDANYFTGEIPKSLSNCS-- 273
           +   ++ +  NL++LVL  N+L G+L  + + LRKL  L L  N F+GEIP+ + NC+  
Sbjct: 400 LSPSIS-NLTNLQWLVLYHNNLEGKLPKEISALRKLEVLFLYENRFSGEIPQEIGNCTSL 458

Query: 274 --------HLEG--------------LYMSDNNLYGNIPAWLGNLSSLYDIMMASNHLQG 311
                   H EG              L++  N L G +PA LGN   L  + +A N L G
Sbjct: 459 KMIDMFGNHFEGEIPPSIGRLKELNLLHLRQNELVGGLPASLGNCHQLNILDLADNQLSG 518

Query: 312 PIPLEFCQLNYLQILDLSENNISGSLP-SCSSHSSITQVHLSKNMLYGPLRYGTFFNRSS 370
            IP  F  L  L+ L L  N++ G+LP S  S  ++T+++LS N L G +        SS
Sbjct: 519 SIPSSFGFLKGLEQLMLYNNSLQGNLPDSLISLRNLTRINLSHNRLNGTIH--PLCGSSS 576

Query: 371 IVTLDLSYNSFSGYIPYWIERLTYLRYLILANNNLEGEVPIQLCRLKQLRLIDLSNNNIF 430
            ++ D++ N F   IP  +     L  L L  N L G++P  L ++++L L+D+S+N + 
Sbjct: 577 YLSFDVTNNGFEDEIPLELGNSQNLDRLRLGKNQLTGKIPWTLGKIRELSLLDMSSNALT 636

Query: 431 G----QIPGCLDNTSLHNNGDNDDSLVPAFNHNVRSTYSAGSSTMEKEESI---MF-TTK 482
           G    Q+  C   T +  N +     +P +   +        S+ +  ES+   +F  TK
Sbjct: 637 GTIPLQLVLCKKLTHIDLNNNFLSGPIPPWLGKLSQLGELKLSSNQFVESLPTELFNCTK 696

Query: 483 EISFSYKGKPLN-----------------------------------KMYGVDLSCNKLT 507
            +  S  G  LN                                   K+Y + LS N LT
Sbjct: 697 LLVLSLDGNSLNGSIPQEIGNLGALNVLNLDKNQFSGSLPQAMGKLSKLYELRLSRNSLT 756

Query: 508 GEIPPQISKLTRIR-ALNLSHNNLTGVIPVTFSNLNQVESLDISYNNLNGKIPPQLVELN 566
           GEIP +I +L  ++ AL+LS+NN TG IP T   L+++E+LD+S+N L G++P  + ++ 
Sbjct: 757 GEIPVEIGQLQDLQSALDLSYNNFTGDIPSTIGTLSKLETLDLSHNQLTGEVPGSVGDMK 816

Query: 567 ALAFFSVAHNNLSGKIPEWTAQFTTFKEDSYEGNPLLCGKPLPDCDVAAVPEASNEEDGN 626
           +L + +V+ NNL GK+ +   QF+ +  DS+ GN  LCG PL  C+              
Sbjct: 817 SLGYLNVSFNNLGGKLKK---QFSRWPADSFLGNTGLCGSPLSRCNRVRSNNKQQGLSAR 873

Query: 627 SLIDMGSFYITFTSSYVIVILAI 649
           S++ + +         +I+++A+
Sbjct: 874 SVVIISAISALTAIGLMILVIAL 896




Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 Back     alignment and function description
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query699
255581263 912 serine-threonine protein kinase, plant-t 0.941 0.721 0.516 1e-178
224142481781 predicted protein [Populus trichocarpa] 0.951 0.851 0.478 1e-162
224073452710 predicted protein [Populus trichocarpa] 0.962 0.947 0.446 1e-148
359476165 1464 PREDICTED: LRR receptor-like serine/thre 0.964 0.460 0.460 1e-147
224112245 876 predicted protein [Populus trichocarpa] 0.826 0.659 0.460 1e-147
224073382 1309 predicted protein [Populus trichocarpa] 0.964 0.514 0.440 1e-147
224073436 1014 predicted protein [Populus trichocarpa] 0.964 0.664 0.437 1e-146
224134891 953 predicted protein [Populus trichocarpa] 0.962 0.706 0.437 1e-144
224123984 1016 predicted protein [Populus trichocarpa] 0.962 0.662 0.434 1e-143
224073422 969 predicted protein [Populus trichocarpa] 0.947 0.683 0.436 1e-142
>gi|255581263|ref|XP_002531443.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223528936|gb|EEF30930.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  630 bits (1626), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 350/677 (51%), Positives = 459/677 (67%), Gaps = 19/677 (2%)

Query: 1   MTSLRVLSLDLNQLTGNISSSPLIHLTSIERLFLSYNQFQIPFSLEPFFNNSKLKVFSGE 60
           +TSL++L L  NQ  G+IS+SPL  L S+  L +S N FQ+PFSL PFFN+S LK   G+
Sbjct: 250 LTSLQLLDLSSNQFVGDISNSPLKILKSLVDLDVSNNHFQVPFSLGPFFNHSNLKHIRGQ 309

Query: 61  CNEIFVESESSHSMTPKFQLESVALSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEFLN 120
            N I++E+E  HS  P+FQL S+  SG GI  TFP FLY+Q++L++VD S  +LKGEF N
Sbjct: 310 NNAIYLEAEL-HS-APRFQLISIIFSGYGICGTFPNFLYHQNNLQFVDLSHLSLKGEFPN 367

Query: 121 WLLENNTNLNTLVLRNNSLSGPFRMPIQPHWHLDTLYVSKNFFQGNIPLEIGVYFPRLVY 180
           WLL NNT L  L L NNSLSG  ++P+ PH +L  L +S N    +IPLEIG + P+L  
Sbjct: 368 WLLTNNTRLEILDLVNNSLSGHLQLPLHPHVNLLALDISNNHVHDHIPLEIGTFLPKLEL 427

Query: 181 LNLSRNDFNGSIPSSIGDMNSLEALDLSHNQLTGEIPEHLAMSCFNLEFLVLSENSLLGQ 240
           LN+S N F+GSIPSS G+MNSL  LDLS+NQL+G IPEHLA  CF+L  L+LS NSL GQ
Sbjct: 428 LNMSSNGFDGSIPSSFGNMNSLRILDLSNNQLSGSIPEHLATGCFSLNTLILSNNSLQGQ 487

Query: 241 LFSKKNYLRKLVSLHLDANYFTGEIPKSLSNCSHLEGLYMSDNNLYGNIPAWLGNLSSLY 300
           +FSK+  L  L  L LD N+F+G IPKSLS  S L  + +SDN+L G IP W+GNLS L 
Sbjct: 488 MFSKQFNLTNLWWLELDKNHFSGRIPKSLSK-SALSIMDLSDNHLSGMIPGWIGNLSYLQ 546

Query: 301 DIMMASNHLQGPIPLEFCQLNYLQILDLSENNISGSLPSCSSHSSITQVHLSKNMLYGPL 360
           ++++++N L+GPIP+EFCQL+YL++LDL+ N++SG LPSC S SSI  VHLS+NM+ GP 
Sbjct: 547 NLILSNNRLKGPIPVEFCQLHYLEVLDLANNSVSGILPSCLSPSSIIHVHLSQNMIEGPW 606

Query: 361 RYGTFFNRSSIVTLDLSYNSFSGYIPYWIERLTYLRYLILANNNLEGEVPIQLCRLKQLR 420
               F     +VTLDLS N  +G IP  I  +  LR L L +N  +GE+P Q+C L QL 
Sbjct: 607 T-NAFSGSHFLVTLDLSSNRITGRIPTLIGGINALRILNLKSNRFDGEIPAQICGLYQLS 665

Query: 421 LIDLSNNNIFGQIPGCLDNTSLHNNGDNDDSLVPAFNHNVRSTYSAGSSTMEKEESIMFT 480
           LI L++NN+ G IP CL         D  DSL P    +V    +  +        + FT
Sbjct: 666 LIVLADNNLSGSIPSCLQ-------LDQSDSLAP----DVPPVPNPLNPYYLPVRPMYFT 714

Query: 481 TKEISFSYKGKPLNKMYGVDLSCNKLTGEIPPQISKLTRIRALNLSHNNLTGVIPVTFSN 540
           TK  S+SY+GK L+ + G+D SCNKLTGEIPP++   + I +LNLS+N  TG IP TFSN
Sbjct: 715 TKRRSYSYQGKILSYISGIDFSCNKLTGEIPPEMGNHSAIYSLNLSYNRFTGPIPSTFSN 774

Query: 541 LNQVESLDISYNNLNGKIPPQLVELNALAFFSVAHNNLSGKIPEWTAQFTTFKEDSYEGN 600
           L Q+ESLD+SYNNLNG IP QL+EL  L++FSVAHNNL GK P+ T QF TF+  SYEGN
Sbjct: 775 LKQIESLDLSYNNLNGDIPSQLLELKFLSYFSVAHNNLFGKTPKRTGQFATFEVSSYEGN 834

Query: 601 PLLCGKPLP----DCDVAAVPEASNEEDGNSLIDMGSFYITFTSSYVIVILAIIGVLYVN 656
           P LCG PLP    + + ++ P AS  ++ ++ +DM +FY +F  SY  VI+ +  VLY+N
Sbjct: 835 PNLCGLPLPKSCTEREASSAPRASAMDEESNFLDMNTFYGSFIVSYTFVIIGMFLVLYIN 894

Query: 657 PYWHRRWFYLIENWMTS 673
           P W R WF  ++  ++S
Sbjct: 895 PQWRRAWFDFVDICISS 911




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224142481|ref|XP_002324585.1| predicted protein [Populus trichocarpa] gi|222866019|gb|EEF03150.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073452|ref|XP_002304097.1| predicted protein [Populus trichocarpa] gi|222841529|gb|EEE79076.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359476165|ref|XP_002283141.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224112245|ref|XP_002332815.1| predicted protein [Populus trichocarpa] gi|222833209|gb|EEE71686.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073382|ref|XP_002304087.1| predicted protein [Populus trichocarpa] gi|222841519|gb|EEE79066.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073436|ref|XP_002304095.1| predicted protein [Populus trichocarpa] gi|222841527|gb|EEE79074.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224134891|ref|XP_002327515.1| predicted protein [Populus trichocarpa] gi|222836069|gb|EEE74490.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224123984|ref|XP_002330258.1| predicted protein [Populus trichocarpa] gi|222871714|gb|EEF08845.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073422|ref|XP_002304093.1| predicted protein [Populus trichocarpa] gi|222841525|gb|EEE79072.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query699
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.975 0.682 0.372 2.7e-107
TAIR|locus:2037308976 RLP14 "AT1G74180" [Arabidopsis 0.949 0.680 0.362 2.3e-94
TAIR|locus:20250121083 RLP1 "AT1G07390" [Arabidopsis 0.872 0.563 0.372 7.8e-94
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.938 0.736 0.340 3.1e-90
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.915 0.684 0.345 1.6e-79
TAIR|locus:2155909908 RLP56 "AT5G49290" [Arabidopsis 0.891 0.686 0.346 4.3e-77
TAIR|locus:2019662965 RLP15 "AT1G74190" [Arabidopsis 0.822 0.595 0.340 1.1e-76
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.879 0.524 0.302 1.2e-59
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.894 0.500 0.300 2.3e-56
TAIR|locus:2160791 1102 AT5G63930 [Arabidopsis thalian 0.899 0.570 0.289 1.9e-55
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1061 (378.5 bits), Expect = 2.7e-107, P = 2.7e-107
 Identities = 265/712 (37%), Positives = 376/712 (52%)

Query:     1 MTSLRVLSLDLNQLTGNISSSPLIHLTSIERLFLSYNQFQIPFSLEPFFNNSKLKVF--S 58
             +T LRVL L  NQLTGN+ S+ L +L S+E L L  N F+  FSL    N SKLKV    
Sbjct:   281 LTGLRVLDLSSNQLTGNVPSA-LANLESLEYLSLFGNNFEGFFSLGLLANLSKLKVLRLD 339

Query:    59 GECNEIFVESESSHSMTPKFQLESVALSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEF 118
              + N + VE E+S    PKFQL  +AL    +    P FL +Q DL +VD SD+ + G F
Sbjct:   340 SQSNSLEVEFETSWK--PKFQLVVIALRSCNLEKV-PHFLLHQKDLHHVDLSDNQIHGNF 396

Query:   119 XXXXXXXXXXXXXXXXXXXXXSGPFRMPIQPHWHLDTLYVSKNFFQGNIPLEIGVYFPRL 178
                                  +  F++P   H +L  L VS N F        G   P L
Sbjct:   397 PSWLLENNTKLEVLLLQNNSFTS-FQLPKSAH-NLLFLNVSVNKFNHLFLQNFGWILPHL 454

Query:   179 VYLNLSRNDFNGSIPSSIGDMNSLEALDLSHNQLTGEIPEHLAMSCFNLEFLVLSENSLL 238
             V +NL+ N F G++PSS+ +M S+E LDLSHN+  G++P      C+NL  L LS N L 
Sbjct:   455 VCVNLAYNGFQGNLPSSLDNMKSIEFLDLSHNRFHGKLPRRFLKGCYNLTILKLSHNKLS 514

Query:   239 GQLFSKKNYLRKLVSLHLDANYFTGEIPKSLSNCSHLEGLYMSDNNLYGNIPAWLGNLSS 298
             G++F +     +L  + +D N FTG I K   +   L  L +S+N L G IP+W+G    
Sbjct:   515 GEVFPEAANFTRLWVMSMDNNLFTGNIGKGFRSLPSLNVLDISNNKLTGVIPSWIGERQG 574

Query:   299 LYDIMMASNHLQGPIPLEFCQLNYLQILDLSENNIXXXXXXXXXXXXITQVHL-SKNMLY 357
             L+ + +++N L+G IP     ++YLQ+LDLS N +               V L   N L 
Sbjct:   575 LFALQLSNNMLEGEIPTSLFNISYLQLLDLSSNRLSGDIPPHVSSIYHGAVLLLQNNNLS 634

Query:   358 GPLRYGTFFNRSSIVTLDLSYNSFSGYIPYWIERLTYLRYLILANNNLEGEVPIQLCRLK 417
             G +      N   ++ LDL  N  SG +P +I     +  L+L  NN  G++P Q C L 
Sbjct:   635 GVIPDTLLLN---VIVLDLRNNRLSGNLPEFINTQN-ISILLLRGNNFTGQIPHQFCSLS 690

Query:   418 QLRLIDLSNNNIFGQIPGCLDNTSLH-NNGDNDDSL-VPA-FNHNVRSTYSAGSSTMEK- 473
              ++L+DLSNN   G IP CL NTS     GD+     VP+ F       Y      +++ 
Sbjct:   691 NIQLLDLSNNKFNGSIPSCLSNTSFGLRKGDDSYRYDVPSRFGTAKDPVYFESLLMIDEF 750

Query:   474 --------EESIMFTTKEISFSYKGKPLNKMYGVDLSCNKLTGEIPPQISKLTRIRALNL 525
                     +  I F TK    +Y G  L  ++G+DLS N+L+GEIP ++  L  + ALNL
Sbjct:   751 NMVNETNSQTKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVELGGLVELEALNL 810

Query:   526 SHNNLTGVIPVTFSNLNQVESLDISYNNLNGKIPPQLVELNALAFFSVAHNNLSGKIPEW 585
             SHNNL+GVI  +FS L  VESLD+S+N L G IP QL ++ +LA F+V++NNLSG +P+ 
Sbjct:   811 SHNNLSGVILESFSGLKNVESLDLSFNRLQGPIPLQLTDMISLAVFNVSYNNLSGIVPQG 870

Query:   586 TAQFTTFKEDSYEGNPLLCGKPLPDCDVAAV---PEASNEEDGNSLIDMGSFYITFTSSY 642
               QF TF+  SY GNPLLCGK + D   A+    P  +  E   S +DM SFY +F ++Y
Sbjct:   871 R-QFNTFETQSYFGNPLLCGKSI-DISCASNNFHPTDNGVEADESTVDMESFYWSFVAAY 928

Query:   643 VIVILAIIGVLYVNPYWHRRWFYLIENWMTSCFYFIIDNLIPTRFYHACMQL 694
             V ++L I+  L  +  W R WFY+++ ++      +  N   T+  +  + L
Sbjct:   929 VTILLGILASLSFDSPWSRAWFYIVDAFVLKVRNMLWQNTAGTKCSYVLVSL 980


GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160791 AT5G63930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00181059
hypothetical protein (781 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query699
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-63
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-54
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-44
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-32
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  227 bits (579), Expect = 3e-63
 Identities = 195/624 (31%), Positives = 300/624 (48%), Gaps = 83/624 (13%)

Query: 3   SLRVLSLDLN--QLTGNISSSPLIHLTSIERLFLSYNQ--FQIPFSLEPFFNNSKLKVFS 58
           S RV+S+DL+   ++G ISS+ +  L  I+ + LS NQ    IP                
Sbjct: 68  SSRVVSIDLSGKNISGKISSA-IFRLPYIQTINLSNNQLSGPIP---------------- 110

Query: 59  GECNEIFVESESSHSMTPKFQLESVALSGSGIHATFPK-FLYNQHDLEYVDFSDSNLKGE 117
              ++IF  S S         L  + LS +    + P+  + N   LE +D S++ L GE
Sbjct: 111 ---DDIFTTSSS---------LRYLNLSNNNFTGSIPRGSIPN---LETLDLSNNMLSGE 155

Query: 118 FLNWLLENNTNLNTLVLRNNSLSGPFRMPIQPHWHLDTLYVSKNFFQGNIPLEIGVYFPR 177
             N  + + ++L  L L  N L G     +     L+ L ++ N   G IP E+G     
Sbjct: 156 IPN-DIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELG-QMKS 213

Query: 178 LVYLNLSRNDFNGSIPSSIGDMNSLEALDLSHNQLTGEIPEHLAMSCFNLEFLVLSENSL 237
           L ++ L  N+ +G IP  IG + SL  LDL +N LTG IP  L  +  NL++L L +N L
Sbjct: 214 LKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLG-NLKNLQYLFLYQNKL 272

Query: 238 LGQLFSKKNYLRKLVSLHLDANYFTGEIPKSLSNCSHLEGLYMSDNNLYGNIPAWLGNLS 297
            G +      L+KL+SL L  N  +GEIP+ +    +LE L++  NN  G IP  L +L 
Sbjct: 273 SGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLP 332

Query: 298 SLYDIMMASNHLQGPIPLEFCQLNYLQILDLSENNISGSLPS--CSSHSSITQVHLSKNM 355
            L  + + SN   G IP    + N L +LDLS NN++G +P   CSS  ++ ++ L  N 
Sbjct: 333 RLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSS-GNLFKLILFSNS 391

Query: 356 LYG--PLRYGTFFNRSSIVTLDLSYNSFSGYIPYWIERLTYLRYLILANNNLEGEVPIQL 413
           L G  P   G      S+  + L  NSFSG +P    +L  + +L ++NNNL+G +  + 
Sbjct: 392 LEGEIPKSLGAC---RSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRK 448

Query: 414 CRLKQLRLIDLSNNNIFGQIPGCLDNTSLHNNGDNDDSLVPAFNHNVRSTYSAGSSTMEK 473
             +  L+++ L+ N  FG +P    ++      +N D     F+  V     + S  M+ 
Sbjct: 449 WDMPSLQMLSLARNKFFGGLP----DSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQ- 503

Query: 474 EESIMFTTKEISFSYKGKPLNKMYGVDLSCNKLTGEIPPQISKLTRIRALNLSHNNLTGV 533
                                    + LS NKL+GEIP ++S   ++ +L+LSHN L+G 
Sbjct: 504 -------------------------LKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQ 538

Query: 534 IPVTFSNLNQVESLDISYNNLNGKIPPQLVELNALAFFSVAHNNLSGKIPEWTAQFTTFK 593
           IP +FS +  +  LD+S N L+G+IP  L  + +L   +++HN+L G +P  T  F    
Sbjct: 539 IPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPS-TGAFLAIN 597

Query: 594 EDSYEGNPLLCG----KPLPDCDV 613
             +  GN  LCG      LP C  
Sbjct: 598 ASAVAGNIDLCGGDTTSGLPPCKR 621


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 699
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG4237498 consensus Extracellular matrix protein slit, conta 99.92
KOG4237498 consensus Extracellular matrix protein slit, conta 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
KOG0617264 consensus Ras suppressor protein (contains leucine 99.55
PLN03150623 hypothetical protein; Provisional 99.53
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.23
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.2
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.19
PLN03150623 hypothetical protein; Provisional 99.17
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.17
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.12
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.1
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.08
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.06
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.04
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.0
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.0
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.92
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.92
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.9
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.88
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.79
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.76
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.76
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.55
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.54
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.49
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.44
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.4
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.37
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.2
KOG4341483 consensus F-box protein containing LRR [General fu 98.08
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.07
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.02
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.94
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.92
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.87
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.86
KOG4341483 consensus F-box protein containing LRR [General fu 97.85
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.85
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.85
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.76
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.72
PRK15386426 type III secretion protein GogB; Provisional 97.67
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.64
PRK15386 426 type III secretion protein GogB; Provisional 97.44
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.07
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.87
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.83
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.76
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.65
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.11
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.82
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.46
KOG4308478 consensus LRR-containing protein [Function unknown 93.44
KOG4308478 consensus LRR-containing protein [Function unknown 92.78
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.64
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.6
smart0037026 LRR Leucine-rich repeats, outliers. 91.84
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.84
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.78
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 91.33
smart0037026 LRR Leucine-rich repeats, outliers. 90.64
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.64
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.54
KOG0473 326 consensus Leucine-rich repeat protein [Function un 90.43
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 84.4
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.2e-63  Score=584.95  Aligned_cols=542  Identities=32%  Similarity=0.472  Sum_probs=500.6

Q ss_pred             CCCcEEeCCCCCCCCCCCcccccCCCCCCEEeCCCCcccccCCcccccCCCCCcEEEcccCccccccccccCCCCCcccc
Q 040184            2 TSLRVLSLDLNQLTGNISSSPLIHLTSIERLFLSYNQFQIPFSLEPFFNNSKLKVFSGECNEIFVESESSHSMTPKFQLE   81 (699)
Q Consensus         2 ~~L~~L~ls~n~l~~~i~~~~~~~l~~L~~L~Ls~n~~~~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~~~~~~~~~L~   81 (699)
                      .+++.|+|++|.++|.++. +|..+++|++|+|++|.+++.+|...+..+++|++|++++|.+.+..+.    ..+++|+
T Consensus        69 ~~v~~L~L~~~~i~~~~~~-~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~----~~l~~L~  143 (968)
T PLN00113         69 SRVVSIDLSGKNISGKISS-AIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR----GSIPNLE  143 (968)
T ss_pred             CcEEEEEecCCCccccCCh-HHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc----cccCCCC
Confidence            3578999999999988877 8999999999999999999889977777999999999999998764432    2345899


Q ss_pred             EEEccCCcCccccchhcCCCCCCCEEEcccCccccccchhhhhCCCCCCEEEcCCCcCcccCCCCCCCCCCCCEEEccCc
Q 040184           82 SVALSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEFLNWLLENNTNLNTLVLRNNSLSGPFRMPIQPHWHLDTLYVSKN  161 (699)
Q Consensus        82 ~L~ls~~~i~~~~~~~l~~~~~L~~L~ls~n~~~~~~~~~~~~~l~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~l~~n  161 (699)
                      +|++++|.+++..|..+.++++|++|++++|.+.+.+|..+ .++++|++|++++|.+.+..|..+.++++|++|++++|
T Consensus       144 ~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~-~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n  222 (968)
T PLN00113        144 TLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSL-TNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYN  222 (968)
T ss_pred             EEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhh-hhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCC
Confidence            99999999999999999999999999999999988888875 89999999999999999999999999999999999999


Q ss_pred             cCCccCchhhhhcCCCCcEEeCcCCcccccCCccccCCCCCCEEEccCCcCCCccchHHhhcCCCCcEEEccCCcCCccC
Q 040184          162 FFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIGDMNSLEALDLSHNQLTGEIPEHLAMSCFNLEFLVLSENSLLGQL  241 (699)
Q Consensus       162 ~i~~~~~~~~~~~~~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~l~~L~~L~L~~n~l~~~~  241 (699)
                      ++++.+|..+.. +++|++|++++|.+.+..|..+.++++|++|++++|.+.+.+|..+. .+++|++|++++|.+.+..
T Consensus       223 ~l~~~~p~~l~~-l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~-~l~~L~~L~Ls~n~l~~~~  300 (968)
T PLN00113        223 NLSGEIPYEIGG-LTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIF-SLQKLISLDLSDNSLSGEI  300 (968)
T ss_pred             ccCCcCChhHhc-CCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHh-hccCcCEEECcCCeeccCC
Confidence            999889988876 78999999999999999999999999999999999999988888775 6999999999999999999


Q ss_pred             cccccCCCCCcEEEccCCcCCccCCccCcCCCCCceEECCCCcCcCcCchhhhccCCCcEEeccCCcccccCCccccCCC
Q 040184          242 FSKKNYLRKLVSLHLDANYFTGEIPKSLSNCSHLEGLYMSDNNLYGNIPAWLGNLSSLYDIMMASNHLQGPIPLEFCQLN  321 (699)
Q Consensus       242 ~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~  321 (699)
                      |..+..+++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+..|..++.+++|+.|++++|.+.+..|..++.++
T Consensus       301 p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~  380 (968)
T PLN00113        301 PELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSG  380 (968)
T ss_pred             ChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcEEEcccccCcccCCCCC-CCCCccEEEccCccccccCCcccccCCCCccEEECCCCCCCCCcChhhhcCCCCCEEEc
Q 040184          322 YLQILDLSENNISGSLPSCS-SHSSITQVHLSKNMLYGPLRYGTFFNRSSIVTLDLSYNSFSGYIPYWIERLTYLRYLIL  400 (699)
Q Consensus       322 ~L~~L~l~~n~i~~~~~~~~-~~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~L  400 (699)
                      +|+.|++++|.+.+..|..+ .+++|+.|++++|.+.+..+.. +..++.|+.|++++|.+++..+..+..+++|+.|++
T Consensus       381 ~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~-~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L  459 (968)
T PLN00113        381 NLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSE-FTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSL  459 (968)
T ss_pred             CCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChh-HhcCCCCCEEECcCCcccCccChhhccCCCCcEEEC
Confidence            99999999999998887765 7899999999999998877766 899999999999999999999999999999999999


Q ss_pred             ccCcCCCCCCcccCCCCCCCEEECcCCcccccCCCccccCCccCCCCCCCCCcccccccccccccCCCCcccccceeEEe
Q 040184          401 ANNNLEGEVPIQLCRLKQLRLIDLSNNNIFGQIPGCLDNTSLHNNGDNDDSLVPAFNHNVRSTYSAGSSTMEKEESIMFT  480 (699)
Q Consensus       401 ~~n~l~~~~~~~~~~l~~L~~L~ls~n~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  480 (699)
                      ++|++.+..|..+ ..++|+.|++++|++++..|..+..                                         
T Consensus       460 ~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~-----------------------------------------  497 (968)
T PLN00113        460 ARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGS-----------------------------------------  497 (968)
T ss_pred             cCceeeeecCccc-ccccceEEECcCCccCCccChhhhh-----------------------------------------
Confidence            9999998888765 4589999999999999888876654                                         


Q ss_pred             ecceeeeeCCCCCCcccEEEccCCccCccCCccccccCccCeEEccCCcCcccCCccccCCCCCCEEeCCCCcccccCCc
Q 040184          481 TKEISFSYKGKPLNKMYGVDLSCNKLTGEIPPQISKLTRIRALNLSHNNLTGVIPVTFSNLNQVESLDISYNNLNGKIPP  560 (699)
Q Consensus       481 ~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~  560 (699)
                                  +++|+.|++++|.+.+.+|..+..+++|++|+|++|.+++.+|..|..+++|+.|||++|++++.+|.
T Consensus       498 ------------l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~  565 (968)
T PLN00113        498 ------------LSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPK  565 (968)
T ss_pred             ------------hhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCCh
Confidence                        34899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCCCeeecccCcCcccCCCCCcCCCCCCCCccCCCCCCCCCC
Q 040184          561 QLVELNALAFFSVAHNNLSGKIPEWTAQFTTFKEDSYEGNPLLCGKP  607 (699)
Q Consensus       561 ~l~~l~~L~~L~l~~N~l~~~~~~~~~~~~~l~~~~~~~Np~~C~~~  607 (699)
                      .+..+++|+.+++++|++++.+|.. .++.++...++.|||.+|+.+
T Consensus       566 ~l~~l~~L~~l~ls~N~l~~~~p~~-~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        566 NLGNVESLVQVNISHNHLHGSLPST-GAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             hHhcCcccCEEeccCCcceeeCCCc-chhcccChhhhcCCccccCCc
Confidence            9999999999999999999999975 467788888999999999754



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query699
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-50
3rgx_A768 Structural Insight Into Brassinosteroid Perception 4e-50
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-13
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 8e-12
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 3e-05
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 196 bits (498), Expect = 4e-50, Method: Compositional matrix adjust. Identities = 192/678 (28%), Positives = 292/678 (43%), Gaps = 95/678 (14%) Query: 2 TSLRVLSLDLNQLTGNISS-SPLIHLTSIERLFLSYNQFQIPFSLEPFFNNSKLKVFSGE 60 SL L L N L+G +++ + L + ++ L +S N P + + L+V Sbjct: 97 ASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLS 156 Query: 61 CNEIFVESESSHSMTPKF-QLESVALSGSGIH---------------------ATFPKFL 98 N I + ++ +L+ +A+SG+ I +T FL Sbjct: 157 ANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPFL 216 Query: 99 YNQHDLEYVDFSDSNLKGEFXXXXXXXXXXXXXXXXXXXXXSGPFRMPIQPHWHLDTLYV 158 + L+++D S + L G+F GP +P P L L + Sbjct: 217 GDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFV-GP--IPPLPLKSLQYLSL 273 Query: 159 SKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIG--------------------- 197 ++N F G IP + L L+LS N F G++P G Sbjct: 274 AENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPM 333 Query: 198 ----DMNSLEALDLSHNQLTGEIPEHLAMSCFNLEFLVLSENSLLGQLFSK--KNYLRKL 251 M L+ LDLS N+ +GE+PE L +L L LS N+ G + +N L Sbjct: 334 DTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTL 393 Query: 252 VSLHLDANYFTGEIPKSLSNCSHLEGLYMSDNNLYGNIPAWLGNLSSLYDIMMASNHLQG 311 L+L N FTG+IP +LSNCS L L++S N L G IP+ LG+LS L D+ + N L+G Sbjct: 394 QELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEG 453 Query: 312 PIPLEFCQLNYLQILDLSENNIXXXXXXXXXXXXITQVHLSKNMLYGPLRYGTFFNRSSI 371 IP E + L+ L L N+ L G + G N +++ Sbjct: 454 EIPQELMYVKTLETLILDFND-----------------------LTGEIPSG-LSNCTNL 489 Query: 372 VTLDLSYNSFSGYIPYWIERLTYLRYLILANNNLEGEVPIQLCRLKQLRLIDLSNNNIFG 431 + LS N +G IP WI RL L L L+NN+ G +P +L + L +DL+ N G Sbjct: 490 NWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNG 549 Query: 432 QIPGCL--DNTSLHNNGDNDDSLVPAFNHNVRSTYSAGSSTMEKEESIMFTTKEISFSYK 489 IP + + + N V N ++ + +E + +S Sbjct: 550 TIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNP 609 Query: 490 GKPLNKMYG---------------VDLSCNKLTGEIPPQISKLTRIRALNLSHNNLTGVI 534 +++YG +D+S N L+G IP +I + + LNL HN+++G I Sbjct: 610 CNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSI 669 Query: 535 PVTFSNLNQVESLDISYNNLNGKIPPQLVELNALAFFSVAHNNLSGKIPEWTAQFTTFKE 594 P +L + LD+S N L+G+IP + L L +++NNLSG IPE QF TF Sbjct: 670 PDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEM-GQFETFPP 728 Query: 595 DSYEGNPLLCGKPLPDCD 612 + NP LCG PLP CD Sbjct: 729 AKFLNNPGLCGYPLPRCD 746
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query699
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-136
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-108
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-72
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-64
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-70
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-66
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-56
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-38
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-67
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-62
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-51
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-47
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-31
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-18
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-63
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-61
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-56
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-51
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-44
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-58
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-54
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-50
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-46
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-42
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-28
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-58
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-47
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-47
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-46
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-40
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-39
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-56
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-56
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-47
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-43
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-21
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-20
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-52
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-43
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-41
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-40
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-40
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-38
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-31
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-41
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-36
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-32
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-31
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-31
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-30
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-35
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-28
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-35
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-31
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-24
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-31
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-27
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-32
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-19
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-09
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-08
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-29
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-23
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-14
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-29
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-16
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-17
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-27
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-24
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 7e-24
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-17
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-23
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-10
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-22
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-05
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-10
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-19
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-05
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 4e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  418 bits (1076), Expect = e-136
 Identities = 172/617 (27%), Positives = 256/617 (41%), Gaps = 96/617 (15%)

Query: 1   MTSLRVLSLDLNQLTGNISSSPLIHLTSIERLFLSYNQFQIPFSLEPFFNNSKLKVFSGE 60
            ++L+ L +  N+L+G+ S + +   T ++ L +S NQF  P    P      L+  S  
Sbjct: 222 CSALQHLDISGNKLSGDFSRA-ISTCTELKLLNISSNQFVGPI---PPLPLKSLQYLSLA 277

Query: 61  CNEI--FVESESSHSMTPKFQLESVALSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEF 118
            N+    +    S +      L  + LSG+  +   P F  +   LE +  S +N  GE 
Sbjct: 278 ENKFTGEIPDFLSGACD---TLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGEL 334

Query: 119 LNWLLENNTNLNTLVLRNNSLSGPFRMPI-QPHWHLDTLYVSKNFFQGNIPLEIG-VYFP 176
               L     L  L L  N  SG     +      L TL +S N F G I   +      
Sbjct: 335 PMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKN 394

Query: 177 RLVYLNLSRNDFNGSIPSSIGDMNSLEALDLSHNQLTGEIPEHLAMSCFNLEFLVLSENS 236
            L  L L  N F G IP ++ + + L +L LS N L+G IP  L  S   L  L L  N 
Sbjct: 395 TLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG-SLSKLRDLKLWLNM 453

Query: 237 LLGQLFSKKNYLRKLVSLHLDANYFTGEIPKSLSNCSHLEGLYMSDNNLYGNIPAWLGNL 296
           L G++  +  Y++ L +L LD N  TGEIP  LSNC++L  + +S+N L G IP W+G L
Sbjct: 454 LEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRL 513

Query: 297 SSLYDIMMASNHLQGPIPLEFCQLNYLQILDLSENNISGSLPSCSSHSSITQVHLSKNML 356
            +L  + +++N   G IP E      L  LDL+ N  +G++P+                 
Sbjct: 514 ENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAA---------------- 557

Query: 357 YGPLRYGTFFNRSSIVTLDLSYNSFSGYIPYWIERLTYLRYLILANN--NLEGEVPIQLC 414
                    F +S      ++ N  +G    +I+     +    A N    +G    QL 
Sbjct: 558 --------MFKQS----GKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLN 605

Query: 415 RLKQLRLIDLSNNNIFGQIPGCLDNTSLHNNGDNDDSLVPAFNHNVRSTYSAGSSTMEKE 474
           RL      ++++    G      DN                                   
Sbjct: 606 RLSTRNPCNITSRVYGGHTSPTFDN----------------------------------- 630

Query: 475 ESIMFTTKEISFSYKGKPLNKMYGVDLSCNKLTGEIPPQISKLTRIRALNLSHNNLTGVI 534
                                M  +D+S N L+G IP +I  +  +  LNL HN+++G I
Sbjct: 631 ------------------NGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSI 672

Query: 535 PVTFSNLNQVESLDISYNNLNGKIPPQLVELNALAFFSVAHNNLSGKIPEWTAQFTTFKE 594
           P    +L  +  LD+S N L+G+IP  +  L  L    +++NNLSG IPE   QF TF  
Sbjct: 673 PDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPE-MGQFETFPP 731

Query: 595 DSYEGNPLLCGKPLPDC 611
             +  NP LCG PLP C
Sbjct: 732 AKFLNNPGLCGYPLPRC 748


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query699
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.83
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.8
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.71
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.7
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.69
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.67
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.66
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.65
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.65
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.65
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.62
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.59
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.57
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.51
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.5
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.47
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.47
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.45
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.43
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.41
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.4
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.37
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.3
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.27
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.25
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.25
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.18
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.82
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.81
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.37
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.28
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.26
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.18
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.03
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.02
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.91
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.21
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.03
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.94
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 80.84
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=6.7e-70  Score=624.61  Aligned_cols=617  Identities=30%  Similarity=0.427  Sum_probs=495.1

Q ss_pred             CCCCcEEeCCCCCCCCCCCc-ccccCCCCCCEEeCCCCcccccCCcccccCCCCCcEEEcccCccccccccc--------
Q 040184            1 MTSLRVLSLDLNQLTGNISS-SPLIHLTSIERLFLSYNQFQIPFSLEPFFNNSKLKVFSGECNEIFVESESS--------   71 (699)
Q Consensus         1 l~~L~~L~ls~n~l~~~i~~-~~~~~l~~L~~L~Ls~n~~~~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~--------   71 (699)
                      +++|++|+|++|.++|.+|. ..++.+++|++|+|++|.+.+.++...+.++++|++|++++|.+....+..        
T Consensus        99 l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~  178 (768)
T 3rgz_A           99 SASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCG  178 (768)
T ss_dssp             CTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCT
T ss_pred             CCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCC
Confidence            35677777777777655543 136667777777777776665555443355666666666666554322111        


Q ss_pred             ---------------cCCCCCccccEEEccCCcCccccchhcCCCCCCCEEEcccCccccccchhhhhCCCCCCEEEcCC
Q 040184           72 ---------------HSMTPKFQLESVALSGSGIHATFPKFLYNQHDLEYVDFSDSNLKGEFLNWLLENNTNLNTLVLRN  136 (699)
Q Consensus        72 ---------------~~~~~~~~L~~L~ls~~~i~~~~~~~l~~~~~L~~L~ls~n~~~~~~~~~~~~~l~~L~~L~Ls~  136 (699)
                                     .....+.+|++|++++|.+++.+|. +.++++|++|++++|.+++.+|..+ .++++|++|++++
T Consensus       179 ~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l-~~l~~L~~L~Ls~  256 (768)
T 3rgz_A          179 ELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAI-STCTELKLLNISS  256 (768)
T ss_dssp             TCCEEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHT-TTCSSCCEEECCS
T ss_pred             CCCEEECCCCcccccCCcccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHH-hcCCCCCEEECCC
Confidence                           1113455889999999988887776 8899999999999999987777764 8899999999999


Q ss_pred             CcCcccCCCCCCCCCCCCEEEccCccCCccCchhhhhcCCCCcEEeCcCCcccccCCccccCCCCCCEEEccCCcCCCcc
Q 040184          137 NSLSGPFRMPIQPHWHLDTLYVSKNFFQGNIPLEIGVYFPRLVYLNLSRNDFNGSIPSSIGDMNSLEALDLSHNQLTGEI  216 (699)
Q Consensus       137 n~i~~~~~~~~~~l~~L~~L~l~~n~i~~~~~~~~~~~~~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~L~~n~l~~~~  216 (699)
                      |.+.+..|..  .+++|++|++++|++++.+|..++..+++|++|++++|.+++..|..++.+++|++|++++|.+++.+
T Consensus       257 n~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~i  334 (768)
T 3rgz_A          257 NQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGEL  334 (768)
T ss_dssp             SCCEESCCCC--CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEEC
T ss_pred             CcccCccCcc--ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcC
Confidence            9998876654  88999999999999998899988887789999999999999999999999999999999999999899


Q ss_pred             chHHhhcCCCCcEEEccCCcCCccCcccccCCC-CCcEEEccCCcCCccCCccCcC--CCCCceEECCCCcCcCcCchhh
Q 040184          217 PEHLAMSCFNLEFLVLSENSLLGQLFSKKNYLR-KLVSLHLDANYFTGEIPKSLSN--CSHLEGLYMSDNNLYGNIPAWL  293 (699)
Q Consensus       217 ~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~-~L~~L~L~~n~i~~~~~~~~~~--l~~L~~L~l~~n~l~~~~~~~~  293 (699)
                      |...+..+++|++|++++|.+.+.+|..+..++ +|++|++++|.+++..+..+..  +++|+.|++++|++++..|..+
T Consensus       335 p~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l  414 (768)
T 3rgz_A          335 PMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTL  414 (768)
T ss_dssp             CHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGG
T ss_pred             CHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHH
Confidence            988777899999999999999888899888887 9999999999999888887776  8899999999999999999999


Q ss_pred             hccCCCcEEeccCCcccccCCccccCCCCCcEEEcccccCcccCCCCC-CCCCccEEEccCccccccCCcccccCCCCcc
Q 040184          294 GNLSSLYDIMMASNHLQGPIPLEFCQLNYLQILDLSENNISGSLPSCS-SHSSITQVHLSKNMLYGPLRYGTFFNRSSIV  372 (699)
Q Consensus       294 ~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~i~~~~~~~~-~~~~L~~L~l~~n~~~~~~~~~~~~~~~~L~  372 (699)
                      .++++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+..|..+ .+++|+.|++++|.+.+.++.. +..+++|+
T Consensus       415 ~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~-l~~l~~L~  493 (768)
T 3rgz_A          415 SNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSG-LSNCTNLN  493 (768)
T ss_dssp             GGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGG-GGGCTTCC
T ss_pred             hcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHH-HhcCCCCC
Confidence            999999999999999999999999999999999999999998887766 7899999999999998888776 89999999


Q ss_pred             EEECCCCCCCCCcChhhhcCCCCCEEEcccCcCCCCCCcccCCCCCCCEEECcCCcccccCCCccccCCccCCCCCCCCC
Q 040184          373 TLDLSYNSFSGYIPYWIERLTYLRYLILANNNLEGEVPIQLCRLKQLRLIDLSNNNIFGQIPGCLDNTSLHNNGDNDDSL  452 (699)
Q Consensus       373 ~L~Ls~n~i~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~ls~n~i~~~~~~~~~~~~~~~~~~~~~~~  452 (699)
                      +|++++|++++.+|.++..+++|++|++++|++.+.+|..+..+++|+.|++++|+++|.+|..+...............
T Consensus       494 ~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~  573 (768)
T 3rgz_A          494 WISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGK  573 (768)
T ss_dssp             EEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSC
T ss_pred             EEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999877653211100000000


Q ss_pred             -cccccc--------------cccccccCCCCcccccceeEEeeccee--eeeCCCCCCcccEEEccCCccCccCCcccc
Q 040184          453 -VPAFNH--------------NVRSTYSAGSSTMEKEESIMFTTKEIS--FSYKGKPLNKMYGVDLSCNKLTGEIPPQIS  515 (699)
Q Consensus       453 -~~~~~~--------------~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~  515 (699)
                       ......              ....................+......  .......+++|+.||+++|++++.+|..++
T Consensus       574 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~  653 (768)
T 3rgz_A          574 RYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIG  653 (768)
T ss_dssp             EEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGG
T ss_pred             cccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHh
Confidence             000000              000000000000000000000000000  011223468899999999999999999999


Q ss_pred             ccCccCeEEccCCcCcccCCccccCCCCCCEEeCCCCcccccCCcccccCCCCCeeecccCcCcccCCCCCcCCCCCCCC
Q 040184          516 KLTRIRALNLSHNNLTGVIPVTFSNLNQVESLDISYNNLNGKIPPQLVELNALAFFSVAHNNLSGKIPEWTAQFTTFKED  595 (699)
Q Consensus       516 ~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~l~~N~l~~~~~~~~~~~~~l~~~  595 (699)
                      .+++|+.|+|++|++++.+|..++++++|++|||++|+++|.+|..+..+++|++|++++|+++|.+|+. .++.++...
T Consensus       654 ~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~-~~~~~~~~~  732 (768)
T 3rgz_A          654 SMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEM-GQFETFPPA  732 (768)
T ss_dssp             GCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSS-SSGGGSCGG
T ss_pred             ccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCc-hhhccCCHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999986 478899999


Q ss_pred             ccCCCCCCCCCCCCCCCCCCCCCCCCcc
Q 040184          596 SYEGNPLLCGKPLPDCDVAAVPEASNEE  623 (699)
Q Consensus       596 ~~~~Np~~C~~~~~~c~~~~~~~~~~~~  623 (699)
                      ++.|||.+||.|++.|.......|+...
T Consensus       733 ~~~gN~~Lcg~~l~~C~~~~~~~~~~~~  760 (768)
T 3rgz_A          733 KFLNNPGLCGYPLPRCDPSNADGYAHHQ  760 (768)
T ss_dssp             GGCSCTEEESTTSCCCCSCC--------
T ss_pred             HhcCCchhcCCCCcCCCCCccCCCCCCC
Confidence            9999999999999899988887887444



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 699
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-17
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-16
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-07
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 3e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 7e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 84.7 bits (208), Expect = 4e-18
 Identities = 60/417 (14%), Positives = 127/417 (30%), Gaps = 69/417 (16%)

Query: 175 FPRLVYLNLSRNDFNGSIPSSIGDMNSLEALDLSHNQLTGEIPEHLAMSCFNLEFLVLSE 234
               +   L + +   ++  +  D++ +  L      +             +++ +    
Sbjct: 21  LAEKMKTVLGKTNVTDTVSQT--DLDQVTTLQADRLGIK------------SIDGV---- 62

Query: 235 NSLLGQLFSKKNYLRKLVSLHLDANYFTGEIPKSLSNCSHLEGLYMSDNNLYGNIPAWLG 294
                       YL  L  ++   N  T   P  L N + L  + M++N +    P    
Sbjct: 63  -----------EYLNNLTQINFSNNQLTDITP--LKNLTKLVDILMNNNQIADITPLANL 109

Query: 295 NLSSLYDIMMASNHLQGPIPLEFCQ------LNYLQILDLSENNISGSLPSCSSH----- 343
              +   +         P+             N +  +       S    S  +      
Sbjct: 110 TNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLK 169

Query: 344 --SSITQVHLSKNMLYGPLRYGTFFNRSSIVTLDLSYNSFSGYIPYWIERLTYLRYLILA 401
             +++T +                   +++ +L  + N  S   P  I   T L  L L 
Sbjct: 170 PLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLGIL--TNLDELSLN 227

Query: 402 NNNLEGEVPIQLCRLKQLRLIDLSNNNIFGQIP--GCLDNTSLHNNGDNDDSLVPAFNHN 459
            N L+      L  L  L  +DL+NN I    P  G    T L    +   ++ P     
Sbjct: 228 GNQLKD--IGTLASLTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISPLAG-- 283

Query: 460 VRSTYSAGSSTMEKEESIMFTTKEISFSYKGKPLNKMYGVDLSCNKLTGEIPPQISKLTR 519
                      +    ++     ++        L  +  + L  N ++   P  +S LT+
Sbjct: 284 -----------LTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISP--VSSLTK 330

Query: 520 IRALNLSHNNLTGVIPVTFSNLNQVESLDISYNNLNGKIPPQLVELNALAFFSVAHN 576
           ++ L  ++N ++     + +NL  +  L   +N ++   P  L  L  +    +   
Sbjct: 331 LQRLFFANNKVSD--VSSLANLTNINWLSAGHNQISDLTP--LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query699
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.81
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.67
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.62
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.45
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.45
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.45
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.26
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.16
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.14
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.1
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.53
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.45
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.1
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.89
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.96  E-value=1.3e-29  Score=256.52  Aligned_cols=259  Identities=31%  Similarity=0.511  Sum_probs=211.1

Q ss_pred             CCceEECCCCcCcC--cCchhhhccCCCcEEeccC-CcccccCCccccCCCCCcEEEcccccCcccCCCCCCCCCccEEE
Q 040184          274 HLEGLYMSDNNLYG--NIPAWLGNLSSLYDIMMAS-NHLQGPIPLEFCQLNYLQILDLSENNISGSLPSCSSHSSITQVH  350 (699)
Q Consensus       274 ~L~~L~l~~n~l~~--~~~~~~~~l~~L~~L~l~~-n~~~~~~~~~~~~l~~L~~L~l~~n~i~~~~~~~~~~~~L~~L~  350 (699)
                      .++.|+++++.+.+  .+|..++++++|++|++++ |.+.+.+|..+.++++|++|++++|++.+..+            
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~------------  118 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIP------------  118 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECC------------
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhcccccccccc------------
Confidence            45666666666654  3566777777777777765 66777777777777777777777777764322            


Q ss_pred             ccCccccccCCcccccCCCCccEEECCCCCCCCCcChhhhcCCCCCEEEcccCcCCCCCCcccCCCCCC-CEEECcCCcc
Q 040184          351 LSKNMLYGPLRYGTFFNRSSIVTLDLSYNSFSGYIPYWIERLTYLRYLILANNNLEGEVPIQLCRLKQL-RLIDLSNNNI  429 (699)
Q Consensus       351 l~~n~~~~~~~~~~~~~~~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L-~~L~ls~n~i  429 (699)
                                 . .+..+..|+.+++++|.+...+|..+..++.++.+++++|.+.+.+|..+..+.++ +.+++++|++
T Consensus       119 -----------~-~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l  186 (313)
T d1ogqa_         119 -----------D-FLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRL  186 (313)
T ss_dssp             -----------G-GGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEE
T ss_pred             -----------c-cccchhhhcccccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccc
Confidence                       1 25566778888888888777788888888889999999988888888888877775 8899999999


Q ss_pred             cccCCCccccCCccCCCCCCCCCcccccccccccccCCCCcccccceeEEeecceeeeeCCCCCCcccEEEccCCccCcc
Q 040184          430 FGQIPGCLDNTSLHNNGDNDDSLVPAFNHNVRSTYSAGSSTMEKEESIMFTTKEISFSYKGKPLNKMYGVDLSCNKLTGE  509 (699)
Q Consensus       430 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~  509 (699)
                      ++..|..+..+                                                      ....++++.+...+.
T Consensus       187 ~~~~~~~~~~l------------------------------------------------------~~~~l~l~~~~~~~~  212 (313)
T d1ogqa_         187 TGKIPPTFANL------------------------------------------------------NLAFVDLSRNMLEGD  212 (313)
T ss_dssp             EEECCGGGGGC------------------------------------------------------CCSEEECCSSEEEEC
T ss_pred             ccccccccccc------------------------------------------------------ccccccccccccccc
Confidence            88877665543                                                      334688999999989


Q ss_pred             CCccccccCccCeEEccCCcCcccCCccccCCCCCCEEeCCCCcccccCCcccccCCCCCeeecccCcCcccCCCCCcCC
Q 040184          510 IPPQISKLTRIRALNLSHNNLTGVIPVTFSNLNQVESLDISYNNLNGKIPPQLVELNALAFFSVAHNNLSGKIPEWTAQF  589 (699)
Q Consensus       510 ~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~l~~N~l~~~~~~~~~~~  589 (699)
                      +|..+..+++++.+++++|.+++.+| .++.+++|+.|+|++|++++.+|+.+.++++|++|++++|+++|.+|+. ..+
T Consensus       213 ~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~-~~L  290 (313)
T d1ogqa_         213 ASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG-GNL  290 (313)
T ss_dssp             CGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCS-TTG
T ss_pred             cccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCc-ccC
Confidence            99999999999999999999987655 6888999999999999999999999999999999999999999999974 578


Q ss_pred             CCCCCCccCCCCCCCCCCCCCCC
Q 040184          590 TTFKEDSYEGNPLLCGKPLPDCD  612 (699)
Q Consensus       590 ~~l~~~~~~~Np~~C~~~~~~c~  612 (699)
                      ++++.+++.||+.+||.|++.|.
T Consensus       291 ~~L~~l~l~~N~~l~g~plp~c~  313 (313)
T d1ogqa_         291 QRFDVSAYANNKCLCGSPLPACT  313 (313)
T ss_dssp             GGSCGGGTCSSSEEESTTSSCCC
T ss_pred             CCCCHHHhCCCccccCCCCCCCC
Confidence            99999999999999999998883



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure