Citrus Sinensis ID: 040195


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470--
TRRTGIPHQHDPSGVTSSWNNTINLCQWMGVTCGHRHQRVTELDLSNQRIGGVLSPYVGNLSFLRYINLSDNGFHGEIPQEIGNLYRLEKLELSNNSFSGTIPTNLSRCSELTHLRVANNKLEGQIPKEIGSLLKLQTLALYYNNLTGQLPDFVGNLSALQVIYIRGNSLGGKIPTTLGLLRNLVYLNVNENQFWYVSSFSGSLPFDILVNLPNLKKLCIAENNFVGSIPDSLSNASNLELLELAGNQFEGKVSIDFSSLKNLAVLNLERNNLGIGTANDLGFVTFLTNCSSLKLPHSIANLSSTMTHFYIGGNQILGIIHFGIRNLVNLIALGMQSNQLHGTIPDVIGELKNLQILSLFGNFLHGSIPSSLGNLTKLANLELSSNSLQGNIPLSVGNCQNLIGFDASHITLTGALPQQLLSITTLSLYLDLSHNLLNGSLLLQVGNLKNLILLDISGNQFSGVIPVTLSIC
cccccccccccccccccccccccccccEEEEEcccccccEEEEEccccccEEEccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccEEEccccEEEEccccccccccccccEEccccEEEEcccHHcccccccccEEccccEEEEcccHHHHcccccccccccccccccccccEEcccHHHHcccccccEEEccccEEEEcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccccccccHHHHHcccccccEEccccEEEEcccccccccccccEEEccccEEEEccccccccccccccEEcccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccEEEcccccccccccHHHHccccccEEEccccccccccccccccc
cHHHHHHHccccccccccccccccccccccEEcccccccEEEEEccccccEEcccHHHHHcccccEEEccccEEEEEcccHHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEEccccccccccccccccHHHHcccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccccHcHcccccccccccccHHHcccccccEEEEcccccccccccHHHcccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccccEEEccccEEEEEccHHHHHcccccEEEcccccccccccHHHccc
trrtgiphqhdpsgvtssWNNTINLCQWmgvtcghrhqrvteldlsnqriggvlspyvgNLSFLRYINlsdngfhgeipqeiGNLYRLeklelsnnsfsgtiptnlsrcselTHLRVANnklegqipKEIGSLLKLQTLALYYNNltgqlpdfvGNLSALQVIYIRGnslggkipttLGLLRNLVYLNVNENQFWYVssfsgslpfdilvnlpnlkklciaennfvgsipdslsnasNLELLELAGNQFEGKVSIDFSSLKNLAVLNLErnnlgigtandLGFVTFLTncsslklphsiANLSSTMTHFYIGGNQILGIIHFGIRNLVNLIALGmqsnqlhgtIPDVIGELKNLQILSLFGnflhgsipsslgnltKLANlelssnslqgniplsvgncqnligfdashitltgalpqQLLSITTLSLYLDLSHNLLNGSLLLQVGNLKNLILLDisgnqfsgvipvtlsic
trrtgiphqhdpsgvtSSWNNTINLCQWMGVTCGHRHQRVTeldlsnqriGGVLSPYVGNLSFLRYINLSDNGFHGEIPQEIGNLYRLEKLELSNNSFSGTIPTNLSRCSELTHLRVANNKLEGQIPKEIGSLLKLQTLALYYNNLTGQLPDFVGNLSALQVIYIRGNSLGGKIPTTLGLLRNLVYLNVNENQFWYVSSFSGSLPFDILVNLPNLKKLCIAENNFVGSIPDSLSNASNLELLELAGNQFEGKVSIDFSSLKNLAVLNLERNNLGIGTANDLGFVTFLTNCSSLKLPHSIANLSSTMTHFYIGGNQILGIIHFGIRNLVNLIALGMQSNQLHGTIPDVIGELKNLQILSLFGNFLHGSIPSSLGNLTKLANLELSSNSLQGNIPLSVGNCQNLIGFDASHITLTGALPQQLLSITTLSLYLDLSHNLLNGSLLLQVGNLKNLILLDisgnqfsgvipvtlsic
TRRTGIPHQHDPSGVTSSWNNTINLCQWMGVTCGHRHQRVTELDLSNQRIGGVLSPYVGNLSFLRYINLSDNGFHGEIPQEIGNLYRLEKLELSNNSFSGTIPTNLSRCSELTHLRVANNKLEGQIPKEIGSLLKLQTLALYYNNLTGQLPDFVGNLSALQVIYIRGNSLGGKIPTTLGLLRNLVYLNVNENQFWYVSSFSGSLPFDILVNLPNLKKLCIAENNFVGSIPDslsnasnlellelaGNQFEGKVSIDFSSLKNLAVLNLERNNLGIGTANDLGFVTFLTNCSSLKLPHSIANLSSTMTHFYIGGNQILGIIHFGIRNLVNLIALGMQSNQLHGTIPDVIGELKNLQILSLFGNFLHGSIPSSLGNLTKLANLELSSNSLQGNIPLSVGNCQNLIGFDASHITLTGALPQQLLSITTlslyldlshnllngslllqvgnlKNLILLDISGNQFSGVIPVTLSIC
*****************SWNNTINLCQWMGVTCGHRHQRVTELDLSNQRIGGVLSPYVGNLSFLRYINLSDNGFHGEIPQEIGNLYRLEKLELSNNSFSGTIPTNLSRCSELTHLRVANNKLEGQIPKEIGSLLKLQTLALYYNNLTGQLPDFVGNLSALQVIYIRGNSLGGKIPTTLGLLRNLVYLNVNENQFWYVSSFSGSLPFDILVNLPNLKKLCIAENNFVGSIPDSLSNASNLELLELAGNQFEGKVSIDFSSLKNLAVLNLERNNLGIGTANDLGFVTFLTNCSSLKLPHSIANLSSTMTHFYIGGNQILGIIHFGIRNLVNLIALGMQSNQLHGTIPDVIGELKNLQILSLFGNFLHGSIPSSLGNLTKLANLELSSNSLQGNIPLSVGNCQNLIGFDASHITLTGALPQQLLSITTLSLYLDLSHNLLNGSLLLQVGNLKNLILLDISGNQFSGVIPVTLS**
******PH*HDPSGVTSSWNNTINLCQWMGVTCGHRHQRVTELDLSNQRIGGVLSPYVGNLSFLRYINLSDNGFHGEIPQEIGNLYRLEKLELSNNSFSGTIPTNLSRCSELTHLRVANNKLEGQIPKEIGSLLKLQTLALYYNNLTGQLPDFVGNLSALQVIYIRGNSLGGKIPTTLGLLRNLVYLNVNENQFWYVSSFSGSLPFDILVNLPNLKKLCIAENNFVGSIPDSLSNASNLELLELAGNQFEGKVSIDFSSLKNLAVLNLERNNLGIGTANDLGFVTFLTNCSSLKLPHSIANLSSTMTHFYIGGNQILGIIHFGIRNLVNLIALGMQSNQLHGTIPDVIGELKNLQILSLFGNFLHGSIPSSLGNLTKLANLELSSNSLQGNIPLSVGNCQNLIGFDASHITLTGALPQQLLSITTLSLYLDLSHNLLNGSLLLQVGNLKNLILLDISGNQFSGVIPVTLSIC
***************TSSWNNTINLCQWMGVTCGHRHQRVTELDLSNQRIGGVLSPYVGNLSFLRYINLSDNGFHGEIPQEIGNLYRLEKLELSNNSFSGTIPTNLSRCSELTHLRVANNKLEGQIPKEIGSLLKLQTLALYYNNLTGQLPDFVGNLSALQVIYIRGNSLGGKIPTTLGLLRNLVYLNVNENQFWYVSSFSGSLPFDILVNLPNLKKLCIAENNFVGSIPDSLSNASNLELLELAGNQFEGKVSIDFSSLKNLAVLNLERNNLGIGTANDLGFVTFLTNCSSLKLPHSIANLSSTMTHFYIGGNQILGIIHFGIRNLVNLIALGMQSNQLHGTIPDVIGELKNLQILSLFGNFLHGSIPSSLGNLTKLANLELSSNSLQGNIPLSVGNCQNLIGFDASHITLTGALPQQLLSITTLSLYLDLSHNLLNGSLLLQVGNLKNLILLDISGNQFSGVIPVTLSIC
TRRTGIPHQHDPSGVTSSWNNTINLCQWMGVTCGHRHQRVTELDLSNQRIGGVLSPYVGNLSFLRYINLSDNGFHGEIPQEIGNLYRLEKLELSNNSFSGTIPTNLSRCSELTHLRVANNKLEGQIPKEIGSLLKLQTLALYYNNLTGQLPDFVGNLSALQVIYIRGNSLGGKIPTTLGLLRNLVYLNVNENQFWYVSSFSGSLPFDILVNLPNLKKLCIAENNFVGSIPDSLSNASNLELLELAGNQFEGKVSIDFSSLKNLAVLNLERNNLGIGTANDLGFVTFLTNCSSLKLPHSIANLSSTMTHFYIGGNQILGIIHFGIRNLVNLIALGMQSNQLHGTIPDVIGELKNLQILSLFGNFLHGSIPSSLGNLTKLANLELSSNSLQGNIPLSVGNCQNLIGFDASHITLTGALPQQLLSITTLSLYLDLSHNLLNGSLLLQVGNLKNLILLDISGNQFSGVIPVT*S*C
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TRRTGIPHQHDPSGVTSSWNNTINLCQWMGVTCGHRHQRVTELDLSNQRIGGVLSPYVGNLSFLRYINLSDNGFHGEIPQEIGNLYRLEKLELSNNSFSGTIPTNLSRCSELTHLRVANNKLEGQIPKEIGSLLKLQTLALYYNNLTGQLPDFVGNLSALQVIYIRGNSLGGKIPTTLGLLRNLVYLNVNENQFWYVSSFSGSLPFDILVNLPNLKKLCIAENNFVGSIPDSLSNASNLELLELAGNQFEGKVSIDFSSLKNLAVLNLERNNLGIGTANDLGFVTFLTNCSSLKLPHSIANLSSTMTHFYIGGNQILGIIHFGIRNLVNLIALGMQSNQLHGTIPDVIGELKNLQILSLFGNFLHGSIPSSLGNLTKLANLELSSNSLQGNIPLSVGNCQNLIGFDASHITLTGALPQQLLSITTLSLYLDLSHNLLNGSLLLQVGNLKNLILLDISGNQFSGVIPVTLSIC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query472 2.2.26 [Sep-21-2011]
C0LGP4 1010 Probable LRR receptor-lik yes no 0.976 0.456 0.413 5e-86
Q9SD62 1025 Putative receptor-like pr no no 0.968 0.445 0.432 1e-85
C0LGT6 1031 LRR receptor-like serine/ no no 0.966 0.442 0.381 1e-84
Q9FL28 1173 LRR receptor-like serine/ no no 0.904 0.364 0.340 6e-59
O49318 1124 Probable leucine-rich rep no no 0.927 0.389 0.345 3e-57
Q9LVP0 1102 Probable leucine-rich rep no no 0.930 0.398 0.334 9e-57
P93194 1109 Receptor-like protein kin N/A no 0.947 0.403 0.319 1e-54
Q9LHP4 1141 Receptor-like protein kin no no 0.868 0.359 0.341 2e-54
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.896 0.337 0.339 3e-54
Q9SHI2 1101 Leucine-rich repeat recep no no 0.949 0.406 0.336 2e-53
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function desciption
 Score =  318 bits (815), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 204/493 (41%), Positives = 286/493 (58%), Gaps = 32/493 (6%)

Query: 10  HDPSGVTSSWNNTINLCQWMGVTCGHRHQRVTELDLSNQRIGGVLSPYVGNLSFLRYINL 69
            D   V SSWN++  LC W GVTCG +++RVT L+L   ++GGV+SP +GNLSFL  ++L
Sbjct: 38  EDKRVVLSSWNHSFPLCNWKGVTCGRKNKRVTHLELGRLQLGGVISPSIGNLSFLVSLDL 97

Query: 70  SDNGFHGEIPQEIGNLYRLEKLELSNNSFSGTIPTNLSRCSELTHLRVANNKLEGQIPKE 129
            +N F G IPQE+G L RLE L++  N   G IP  L  CS L +LR+ +N+L G +P E
Sbjct: 98  YENFFGGTIPQEVGQLSRLEYLDMGINYLRGPIPLGLYNCSRLLNLRLDSNRLGGSVPSE 157

Query: 130 IGSLLKLQTLALYYNNLTGQLPDFVGNLSALQVIYIRGNSLGGKIPTTLGLLRNLVYLNV 189
           +GSL  L  L LY NN+ G+LP  +GNL+ L+ + +  N+L G+IP+ +  L  +  L +
Sbjct: 158 LGSLTNLVQLNLYGNNMRGKLPTSLGNLTLLEQLALSHNNLEGEIPSDVAQLTQIWSLQL 217

Query: 190 NENQF--------WYVSS----------FSGSLPFDILVNLPNLKKLCIAENNFVGSIPD 231
             N F        + +SS          FSG L  D+ + LPNL    +  N F GSIP 
Sbjct: 218 VANNFSGVFPPALYNLSSLKLLGIGYNHFSGRLRPDLGILLPNLLSFNMGGNYFTGSIPT 277

Query: 232 SLSNASNLELLELAGNQFEGKVSIDFSSLKNLAVLNLERNNLGIGTANDLGFVTFLTNCS 291
           +LSN S LE L +  N   G +   F ++ NL +L L  N+LG  ++ DL F+T LTNC+
Sbjct: 278 TLSNISTLERLGMNENNLTGSIPT-FGNVPNLKLLFLHTNSLGSDSSRDLEFLTSLTNCT 336

Query: 292 SLK------------LPHSIANLSSTMTHFYIGGNQILGIIHFGIRNLVNLIALGMQSNQ 339
            L+            LP SIANLS+ +    +GG  I G I + I NL+NL  L +  N 
Sbjct: 337 QLETLGIGRNRLGGDLPISIANLSAKLVTLDLGGTLISGSIPYDIGNLINLQKLILDQNM 396

Query: 340 LHGTIPDVIGELKNLQILSLFGNFLHGSIPSSLGNLTKLANLELSSNSLQGNIPLSVGNC 399
           L G +P  +G+L NL+ LSLF N L G IP+ +GN+T L  L+LS+N  +G +P S+GNC
Sbjct: 397 LSGPLPTSLGKLLNLRYLSLFSNRLSGGIPAFIGNMTMLETLDLSNNGFEGIVPTSLGNC 456

Query: 400 QNLIGFDASHITLTGALPQQLLSITTLSLYLDLSHNLLNGSLLLQVGNLKNLILLDISGN 459
            +L+        L G +P +++ I  L L LD+S N L GSL   +G L+NL  L +  N
Sbjct: 457 SHLLELWIGDNKLNGTIPLEIMKIQQL-LRLDMSGNSLIGSLPQDIGALQNLGTLSLGDN 515

Query: 460 QFSGVIPVTLSIC 472
           + SG +P TL  C
Sbjct: 516 KLSGKLPQTLGNC 528





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9SD62|Y3471_ARATH Putative receptor-like protein kinase At3g47110 OS=Arabidopsis thaliana GN=At3g47110 PE=3 SV=1 Back     alignment and function description
>sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query472
255585471 963 serine-threonine protein kinase, plant-t 0.978 0.479 0.476 1e-112
224097748 1032 predicted protein [Populus trichocarpa] 0.980 0.448 0.465 1e-104
224115346 1017 predicted protein [Populus trichocarpa] 0.980 0.455 0.462 1e-103
359482058 1040 PREDICTED: probable LRR receptor-like se 0.980 0.445 0.452 1e-101
147853780 1904 hypothetical protein VITISV_030954 [Viti 0.980 0.243 0.452 1e-101
255577438 1028 receptor-kinase, putative [Ricinus commu 0.976 0.448 0.432 7e-99
224119102 1007 predicted protein [Populus trichocarpa] 0.978 0.458 0.442 1e-98
255575908 988 serine-threonine protein kinase, plant-t 0.976 0.466 0.455 3e-98
356566660 1020 PREDICTED: probable LRR receptor-like se 0.968 0.448 0.433 3e-98
357505893 1003 Receptor kinase-like protein [Medicago t 0.968 0.455 0.435 1e-97
>gi|255585471|ref|XP_002533428.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223526716|gb|EEF28948.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 235/493 (47%), Positives = 315/493 (63%), Gaps = 31/493 (6%)

Query: 10  HDPSGVTSSWNNTINLCQWMGVTCGHRHQRVTELDLSNQRIGGVLSPYVGNLSFLRYINL 69
           HDP  V  SWN TI+ CQW GVTCG  H+RVT LDL + +I G +SPY+GNLSFLR +N+
Sbjct: 53  HDPFQVLRSWNETIHFCQWQGVTCGLLHRRVTVLDLHSLKISGSISPYIGNLSFLRALNI 112

Query: 70  SDNGFHGEIPQEIGNLYRLEKLELSNNSFSGTIPTNLSRCSELTHLRVANNKLEGQIPKE 129
            +N F  EIPQ+IG L RLE+L L+NNS  G IPTN+SRCS L  + +  NKLEG +P+E
Sbjct: 113 QNNSFGHEIPQQIGYLRRLEELRLNNNSVGGKIPTNISRCSNLVFISLGKNKLEGNVPEE 172

Query: 130 IGSLLKLQTLALYYNNLTGQLPDFVGNLSALQVIYIRGNSLGGKIPTTLGLLRNLVYLNV 189
           +G L  LQ L+++ N LTG +P  +GNLS LQ + +  N + G++P +LG LRNL +L++
Sbjct: 173 LGVLSNLQVLSIFGNKLTGSIPHSLGNLSQLQRLSLAENRMVGEVPNSLGWLRNLTFLSL 232

Query: 190 NENQ--------FWYVSS----------FSGSLPFDILVNLPNLKKLCIAENNFVGSIPD 231
             N+         + +SS          F G+LP DI   LPN++   I+ N F G IP 
Sbjct: 233 RSNRLSGTIPSSLFNLSSIRNLDIGENNFHGNLPSDIGFLLPNIRWFAISSNEFTGKIPV 292

Query: 232 SLSNASNLELLELAGNQFEGKVSIDFSSLKNLAVLNLERNNLGIGTANDLGFVTFLTNCS 291
           SLSNA+NLE L L  N   G+V    + L  L V +L  NNLG G A+DL F+  LTN +
Sbjct: 293 SLSNATNLESLLLLQNNLTGEVP-SLAKLDRLRVFSLTSNNLGTGKADDLSFLHSLTNTT 351

Query: 292 SLK------------LPHSIANLSSTMTHFYIGGNQILGIIHFGIRNLVNLIALGMQSNQ 339
           +L+            LP SIANLS+T+    +  N+I+G I  GI NLV+L    + +NQ
Sbjct: 352 ALEELGVNGNNFGGMLPDSIANLSTTLRILLLDNNRIIGSIPSGIENLVSLEDFEVWNNQ 411

Query: 340 LHGTIPDVIGELKNLQILSLFGNFLHGSIPSSLGNLTKLANLELSSNSLQGNIPLSVGNC 399
           L G IPD IG+L+NL +L+L  N L G IPSSLGNLT L  L +  N+L G IP  +G C
Sbjct: 412 LSGFIPDSIGKLQNLVVLALNSNMLSGHIPSSLGNLTNLIQLLVEDNNLSGRIPSDLGRC 471

Query: 400 QNLIGFDASHITLTGALPQQLLSITTLSLYLDLSHNLLNGSLLLQVGNLKNLILLDISGN 459
           QN++G   S    +G++P +++SI++LS+YLDLS N L G+L ++VGNLK+L   D+SGN
Sbjct: 472 QNMLGLSLSQNNFSGSIPPEVISISSLSIYLDLSQNNLTGTLPMEVGNLKSLSEFDVSGN 531

Query: 460 QFSGVIPVTLSIC 472
           + SG IP TL  C
Sbjct: 532 KLSGEIPRTLGSC 544




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224097748|ref|XP_002311065.1| predicted protein [Populus trichocarpa] gi|222850885|gb|EEE88432.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224115346|ref|XP_002317009.1| predicted protein [Populus trichocarpa] gi|222860074|gb|EEE97621.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359482058|ref|XP_002274540.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147853780|emb|CAN83822.1| hypothetical protein VITISV_030954 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255577438|ref|XP_002529598.1| receptor-kinase, putative [Ricinus communis] gi|223530931|gb|EEF32790.1| receptor-kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224119102|ref|XP_002331325.1| predicted protein [Populus trichocarpa] gi|222873908|gb|EEF11039.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255575908|ref|XP_002528851.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223531702|gb|EEF33525.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356566660|ref|XP_003551548.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Glycine max] Back     alignment and taxonomy information
>gi|357505893|ref|XP_003623235.1| Receptor kinase-like protein [Medicago truncatula] gi|355498250|gb|AES79453.1| Receptor kinase-like protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query472
UNIPROTKB|O24435 813 O24435 "Receptor kinase-like p 0.953 0.553 0.350 5.1e-67
TAIR|locus:2079142 1010 AT3G47570 [Arabidopsis thalian 0.947 0.442 0.368 6.2e-63
TAIR|locus:2075661 1025 AT3G47110 [Arabidopsis thalian 0.843 0.388 0.380 8.9e-63
TAIR|locus:2075631 1009 AT3G47090 [Arabidopsis thalian 0.841 0.393 0.354 7.1e-59
TAIR|locus:2149922 1031 EFR "EF-TU receptor" [Arabidop 0.896 0.410 0.332 1e-58
TAIR|locus:2079157 1011 AT3G47580 [Arabidopsis thalian 0.940 0.439 0.337 1.1e-57
UNIPROTKB|Q40640 1025 Xa21 "Receptor kinase-like pro 0.938 0.432 0.334 4.3e-57
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.955 0.384 0.322 4.5e-54
TAIR|locus:2046525 1124 AT2G33170 [Arabidopsis thalian 0.944 0.396 0.319 8.3e-54
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.951 0.400 0.329 4.3e-52
UNIPROTKB|O24435 O24435 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
 Score = 681 (244.8 bits), Expect = 5.1e-67, P = 5.1e-67
 Identities = 165/471 (35%), Positives = 238/471 (50%)

Query:    17 SSWNNTIN--LCQWMGVTCGHRH-QRVTELDLSNQRIGGVLSPYVGNLSFLRYINLSDNG 73
             +SWN + +   C W+GV CG RH  RV +L L +  + G++SP +GNLSFLR + LSDN 
Sbjct:    54 ASWNTSGHGQHCTWVGVVCGRRHPHRVVKLRLRSSNLAGIISPSLGNLSFLRTLQLSDNH 113

Query:    74 FHGEIPQEIGNLYRLEKLELSNNSFSGTIPTNLSRCSELTHLRVANNKLEGQIPKEIGSL 133
               G+IPQE+  L RL++L L+ NS SG IP  L   + L+ L + NN L G IP  +G L
Sbjct:   114 LSGKIPQELSRLSRLQQLVLNFNSLSGEIPAALGNLTSLSVLELTNNTLSGAIPSSLGKL 173

Query:   134 LKLQTLALYYNNLTGQLPDFVGNLSALQVIYIRGNSLGGKIPTTLGLLRNLVYLNVNENQ 193
               L  LAL  N L+G +P   G L  L  + +  N+L G IP  +  + +L    V  N+
Sbjct:   174 TGLTDLALAENTLSGSIPSSFGQLRRLSFLSLAFNNLSGAIPDPIWNISSLTIFEVISNK 233

Query:   194 FWYVSSFSGSLPFDILVNLPNLKKLCIAENNFVGSIPDXXXXXXXXXXXXXXGNQFEGKV 253
                    SG+LP +   NLP+L+++ +  N F G IP                N F G V
Sbjct:   234 L------SGTLPTNAFSNLPSLQEVYMYYNQFHGRIPASIGNASNISIFTIGLNSFSGVV 287

Query:   254 SIDFSSLKNLAVLNLERNNLGIGTANDLGFVTFLTNCSSLK------------LPHSIAN 301
               +   ++NL  L L          ND  F+T LTNCS+L+            LP S++N
Sbjct:   288 PPEIGRMRNLQRLELPETLSEAEETNDWKFMTALTNCSNLQEVELGGCKFGGVLPDSVSN 347

Query:   302 LSSTMTHFYIGGNQILGIIHFGIRNLVNLIALGMQSNQLHGTIPDVIGELKNLQILSLFG 361
             LSS++    I  N+I G +   I NLVNL  L + +N L G++P    +LKNL+ L++  
Sbjct:   348 LSSSLVSLSIRDNKISGSLPRDIGNLVNLQYLSLANNSLTGSLPSSFSKLKNLRRLTVDN 407

Query:   362 NFLHGSIPSSLGNLTKLANLELSSNSLQGNIPLSVGNCQNLIGFDASHITLTGALPQQLL 421
             N L GS+P ++GNLT+L N+E+  N+  G IP ++GN   L   +  H    G +P ++ 
Sbjct:   408 NKLIGSLPLTIGNLTQLTNMEVQFNAFGGTIPSTLGNLTKLFQINLGHNNFIGQIPIEIF 467

Query:   422 SITTXXXXXXXXXXXXXXXXXXXXXXXKNLILLDISGNQFSGVIPVTLSIC 472
             SI                         KN++      N+ SG  P T+  C
Sbjct:   468 SIPALSEILDVSHNNLEGSIPKEIGKLKNIVEFHADSNKLSGENPSTIGEC 518


GO:0004672 "protein kinase activity" evidence=IDA
GO:0006468 "protein phosphorylation" evidence=IDA
GO:0016567 "protein ubiquitination" evidence=IDA
GO:0042742 "defense response to bacterium" evidence=IMP
TAIR|locus:2079142 AT3G47570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075661 AT3G47110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075631 AT3G47090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149922 EFR "EF-TU receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079157 AT3G47580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40640 Xa21 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046525 AT2G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00080284
hypothetical protein (1032 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query472
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-65
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-61
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-54
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-34
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-25
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-15
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-11
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-04
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 8e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.002
PLN03210 1153 PLN03210, PLN03210, Resistant to P 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  227 bits (581), Expect = 1e-65
 Identities = 153/460 (33%), Positives = 239/460 (51%), Gaps = 35/460 (7%)

Query: 10  HDPSGVTSSWNNTINLCQWMGVTCGHRHQRVTELDLSNQRIGGVLSPYVGNLSFLRYINL 69
           +DP    S+WN++ ++C W G+TC +   RV  +DLS + I G +S  +  L +++ INL
Sbjct: 42  NDPLKYLSNWNSSADVCLWQGITCNN-SSRVVSIDLSGKNISGKISSAIFRLPYIQTINL 100

Query: 70  SDNGFHGEIPQEIGNL-YRLEKLELSNNSFSGTIPTNLSRCSELTHLRVANNKLEGQIPK 128
           S+N   G IP +I      L  L LSNN+F+G+IP        L  L ++NN L G+IP 
Sbjct: 101 SNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPN--LETLDLSNNMLSGEIPN 158

Query: 129 EIGSLLKLQTLALYYNNLTGQLPDFVGNLSALQVIYIRGNSLGGKIPTTLGLLRNL--VY 186
           +IGS   L+ L L  N L G++P+ + NL++L+ + +  N L G+IP  LG +++L  +Y
Sbjct: 159 DIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIY 218

Query: 187 LNVNENQFWYVSSFSGSLPFDILVNLPNLKKLCIAENNFVGSIPDSLSNASNLELLELAG 246
           L  N        + SG +P++I   L +L  L +  NN  G IP SL N  NL+ L L  
Sbjct: 219 LGYN--------NLSGEIPYEI-GGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQ 269

Query: 247 NQFEGKVSIDFSSLKNLAVLNLERNNLGIGTANDLGFVTFLTNCSSLKLPHSIANLSSTM 306
           N+  G +     SL+ L  L+L  N+L                  S ++P  +  L   +
Sbjct: 270 NKLSGPIPPSIFSLQKLISLDLSDNSL------------------SGEIPELVIQL-QNL 310

Query: 307 THFYIGGNQILGIIHFGIRNLVNLIALGMQSNQLHGTIPDVIGELKNLQILSLFGNFLHG 366
              ++  N   G I   + +L  L  L + SN+  G IP  +G+  NL +L L  N L G
Sbjct: 311 EILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTG 370

Query: 367 SIPSSLGNLTKLANLELSSNSLQGNIPLSVGNCQNLIGFDASHITLTGALPQQLLSITTL 426
            IP  L +   L  L L SNSL+G IP S+G C++L        + +G LP +   +  L
Sbjct: 371 EIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKL-PL 429

Query: 427 SLYLDLSHNLLNGSLLLQVGNLKNLILLDISGNQFSGVIP 466
             +LD+S+N L G +  +  ++ +L +L ++ N+F G +P
Sbjct: 430 VYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLP 469


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 472
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.95
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.93
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
KOG4237498 consensus Extracellular matrix protein slit, conta 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
KOG4237498 consensus Extracellular matrix protein slit, conta 99.82
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.81
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.71
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.71
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.71
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
KOG0617264 consensus Ras suppressor protein (contains leucine 99.54
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.28
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.25
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.2
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.15
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.09
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.08
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.02
PLN03150623 hypothetical protein; Provisional 99.02
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.01
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.95
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.95
PLN03150623 hypothetical protein; Provisional 98.91
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.9
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.89
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.88
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.84
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.8
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.74
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.71
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.63
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.57
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.55
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.5
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.31
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.31
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.27
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.27
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.25
KOG4341483 consensus F-box protein containing LRR [General fu 98.22
KOG4341483 consensus F-box protein containing LRR [General fu 98.21
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.18
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.13
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.9
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.9
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.84
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.83
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.77
PRK15386 426 type III secretion protein GogB; Provisional 97.76
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.73
PRK15386 426 type III secretion protein GogB; Provisional 97.7
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.7
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.66
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.26
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.18
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.04
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.0
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.92
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.64
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.53
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.6
KOG4308 478 consensus LRR-containing protein [Function unknown 94.48
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 94.36
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.26
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.21
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.96
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 93.81
KOG4308 478 consensus LRR-containing protein [Function unknown 93.03
KOG0473 326 consensus Leucine-rich repeat protein [Function un 90.43
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.46
smart0037026 LRR Leucine-rich repeats, outliers. 88.46
KOG0473 326 consensus Leucine-rich repeat protein [Function un 87.62
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.7e-46  Score=402.17  Aligned_cols=446  Identities=33%  Similarity=0.530  Sum_probs=337.8

Q ss_pred             CCCCCCCCCCCCCCCcccccceeeCCCCCceEEEECCCCccCcccCccccCCCCccEEeccCCcCccCcchh-hhcCCCC
Q 040195           10 HDPSGVTSSWNNTINLCQWMGVTCGHRHQRVTELDLSNQRIGGVLSPYVGNLSFLRYINLSDNGFHGEIPQE-IGNLYRL   88 (472)
Q Consensus        10 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~l~~~~~~~~~~~~l~~~~~L~~L~L~~~~~~~~~~~~-~~~l~~L   88 (472)
                      .+|.+.+++|+...+||.|.|+.|.. ..+++.|+++++.+.+..+..+..+++|++|++++|.+....|.. +..+.+|
T Consensus        42 ~~~~~~~~~w~~~~~~c~w~gv~c~~-~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L  120 (968)
T PLN00113         42 NDPLKYLSNWNSSADVCLWQGITCNN-SSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSL  120 (968)
T ss_pred             CCCcccCCCCCCCCCCCcCcceecCC-CCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCC
Confidence            46778899999888999999999974 368999999999998888888999999999999999987666655 4589999


Q ss_pred             CEEEccCcccCCCCCcccCCCCCCcEEEcccCcCcccCCccccCCCCCcEEEccccCCCCCCCccccCCCCccEEEecCC
Q 040195           89 EKLELSNNSFSGTIPTNLSRCSELTHLRVANNKLEGQIPKEIGSLLKLQTLALYYNNLTGQLPDFVGNLSALQVIYIRGN  168 (472)
Q Consensus        89 ~~L~L~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~i~~~~~~~l~~~~~L~~L~l~~~  168 (472)
                      ++|++++|.+.+..|.  ..+++|++|++++|.+.+..|..+..+++|++|++++|.+.+..|..+.++++|++|++++|
T Consensus       121 ~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n  198 (968)
T PLN00113        121 RYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASN  198 (968)
T ss_pred             CEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCC
Confidence            9999999998866664  46789999999999998788888999999999999999988888888999999999999999


Q ss_pred             ccccccccccccCCCccEEEccCCccccccccccccChhhhcCCCCccEEEcccccccccCCccCcCCCCCCEEecCCCc
Q 040195          169 SLGGKIPTTLGLLRNLVYLNVNENQFWYVSSFSGSLPFDILVNLPNLKKLCIAENNFVGSIPDSLSNASNLELLELAGNQ  248 (472)
Q Consensus       169 ~~~~~~~~~l~~~~~L~~L~l~~~~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~l~~~~~L~~L~l~~~~  248 (472)
                      .+.+..|..+..+++|+.|++++|.+.      +.+| ..+..+++|++|++++|.+.+..|..++++++|+.|++++|.
T Consensus       199 ~l~~~~p~~l~~l~~L~~L~L~~n~l~------~~~p-~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~  271 (968)
T PLN00113        199 QLVGQIPRELGQMKSLKWIYLGYNNLS------GEIP-YEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNK  271 (968)
T ss_pred             CCcCcCChHHcCcCCccEEECcCCccC------CcCC-hhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCe
Confidence            998888888999999999999998863      2233 345688899999999999888888889999999999999998


Q ss_pred             ccccccccccccCCCCeEEcCCCcCCCCCCCCcchhhhhcccCCCc---------CCchhhhccccccEEEeecccccCc
Q 040195          249 FEGKVSIDFSSLKNLAVLNLERNNLGIGTANDLGFVTFLTNCSSLK---------LPHSIANLSSTMTHFYIGGNQILGI  319 (472)
Q Consensus       249 ~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~~l~---------~~~~~~~~~~~l~~l~l~~~~~~~~  319 (472)
                      +.+..+..+..+++|++|++++|.+.......+.   .+.+++.+.         .|..+.. .++++.|++++|.+...
T Consensus       272 l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~---~l~~L~~L~l~~n~~~~~~~~~~~~-l~~L~~L~L~~n~l~~~  347 (968)
T PLN00113        272 LSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVI---QLQNLEILHLFSNNFTGKIPVALTS-LPRLQVLQLWSNKFSGE  347 (968)
T ss_pred             eeccCchhHhhccCcCEEECcCCeeccCCChhHc---CCCCCcEEECCCCccCCcCChhHhc-CCCCCEEECcCCCCcCc
Confidence            8877777888899999999999887532211111   111111111         1222222 23566666666666655


Q ss_pred             ccccccCccCcceEeccccccccCcchhhcCCCCCcEEEccCCcCccccccchhcccccCeeeccCCcccccCCcCccCC
Q 040195          320 IHFGIRNLVNLIALGMQSNQLHGTIPDVIGELKNLQILSLFGNFLHGSIPSSLGNLTKLANLELSSNSLQGNIPLSVGNC  399 (472)
Q Consensus       320 ~~~~l~~~~~L~~L~l~~~~i~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~  399 (472)
                      .+..+..+++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+..|..+..+++|+.|++++|++++.+|..+..+
T Consensus       348 ~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l  427 (968)
T PLN00113        348 IPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKL  427 (968)
T ss_pred             CChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcC
Confidence            56666666666666666666666666666666666666666666666666666666777777777777766666666667


Q ss_pred             CCCceEeecCCcccccCChhhhhhcccceEEEcCCCcccccccccccCCCCCceEeccCCeeccccCCcccc
Q 040195          400 QNLIGFDASHITLTGALPQQLLSITTLSLYLDLSHNLLNGSLLLQVGNLKNLILLDISGNQFSGVIPVTLSI  471 (472)
Q Consensus       400 ~~L~~L~ls~~~~~~~~~~~l~~~~~l~~~L~ls~n~l~~~~~~~l~~~~~L~~L~L~~n~~~~~~p~~~~~  471 (472)
                      +.|+.|++++|.+.+.++..+..+++|+ .|++++|++.+..|..+ ..++|+.|++++|++++.+|..|.+
T Consensus       428 ~~L~~L~Ls~N~l~~~~~~~~~~l~~L~-~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~  497 (968)
T PLN00113        428 PLVYFLDISNNNLQGRINSRKWDMPSLQ-MLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGS  497 (968)
T ss_pred             CCCCEEECcCCcccCccChhhccCCCCc-EEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhh
Confidence            7777777777777666666666666666 77777777766555543 3467777777777777777766543



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query472
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-32
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-32
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-13
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-08
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 2e-04
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 3e-04
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 3e-04
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 3e-04
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 3e-04
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 3e-04
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 3e-04
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 3e-04
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 3e-04
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 4e-04
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 6e-04
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 8e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 137 bits (344), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 138/465 (29%), Positives = 207/465 (44%), Gaps = 61/465 (13%) Query: 40 VTELDLSNQRIGGVLSPY--VGNLSFLRYINLSDN--GFHGEIPQEIGNLYRLEKLELSN 95 +T LDLS + G ++ +G+ S L+++N+S N F G++ + L LE L+LS Sbjct: 99 LTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGL-KLNSLEVLDLSA 157 Query: 96 NSFSGT--IPTNLSR-CSELTHLRVANNKLEGQIPKEIGSLLKLQTLALYYNNLTGQLPD 152 NS SG + LS C EL HL ++ NK+ G + ++ + L+ L + NN + +P Sbjct: 158 NSISGANVVGWVLSDGCGELKHLAISGNKISGDV--DVSRCVNLEFLDVSSNNFSTGIP- 214 Query: 153 FVGNLSALQVIYIRGNSLGGKIPTTLGLLRNLVYLNVNENQF------------WYVS-- 198 F+G+ SALQ + I GN L G + L LN++ NQF Y+S Sbjct: 215 FLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLA 274 Query: 199 --SFSGSLPFDILVNLPNLKKLCIAENNFVGSIPDXXXXXXXXXXXXXXGNQFEGKVSID 256 F+G +P + L L ++ N+F G++P N F G++ +D Sbjct: 275 ENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMD 334 Query: 257 -FSSLKNLAVLNLERNNLGIGTANDLG--FVTFLT------NCSSLKLPHSIANLSSTMT 307 ++ L VL+L N L + LT N S LP+ N +T+ Sbjct: 335 TLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQ 394 Query: 308 HFYIGGNQILGIIHFGIRNLVNLIALGMQSNQLHGTIPDVIGELKNLQILSLFGNFLHGS 367 Y+ N G I + N L++L + N L GTIP +G L L+ L L+ N L G Sbjct: 395 ELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGE 454 Query: 368 IPSSLGNLTKLANLELSSNSLQGNIPLSVGNCQNLIGFDASHITLTGALPQQLLSITTXX 427 IP L + L L L N L G IP + NC NL S+ LTG +P+ + + Sbjct: 455 IPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRL---- 510 Query: 428 XXXXXXXXXXXXXXXXXXXXXKNLILLDISGNQFSGVIPVTLSIC 472 +NL +L +S N FSG IP L C Sbjct: 511 ---------------------ENLAILKLSNNSFSGNIPAELGDC 534
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query472
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-96
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-91
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-86
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-86
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-76
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-24
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-17
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-65
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-55
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-61
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-57
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-52
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-44
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-57
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-54
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-47
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-44
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-36
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-34
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-54
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-42
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-35
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-24
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-53
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-50
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-30
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-47
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-47
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-44
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-44
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-38
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-20
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-45
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-41
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-41
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-36
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-28
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-37
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-31
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-29
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-35
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-29
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-32
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-28
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-26
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-28
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-24
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-13
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-29
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-28
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-17
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-15
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-26
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-24
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-15
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-10
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-26
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-26
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-24
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-20
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-25
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-19
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-21
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 6e-13
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-09
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-18
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-19
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-18
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-12
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-15
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-19
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-19
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-14
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 3e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-09
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 9e-07
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 8e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-07
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 3e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-10
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 9e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  304 bits (782), Expect = 7e-96
 Identities = 121/444 (27%), Positives = 207/444 (46%), Gaps = 26/444 (5%)

Query: 41  TELDLSNQRIGGVLSPYVGNLSFLRYINLSDNGFHGEIPQEIGNLYRLEKLELSNNSFSG 100
             LD+S  ++ G  S  +   + L+ +N+S N F G IP     L  L+ L L+ N F+G
Sbjct: 226 QHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTG 283

Query: 101 TIPTNLS-RCSELTHLRVANNKLEGQIPKEIGSLLKLQTLALYYNNLTGQLP-DFVGNLS 158
            IP  LS  C  LT L ++ N   G +P   GS   L++LAL  NN +G+LP D +  + 
Sbjct: 284 EIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMR 343

Query: 159 ALQVIYIRGNSLGGKIPTTLG-LLRNLVYLNVNENQFWYVSSFSGSLPFDILVN-LPNLK 216
            L+V+ +  N   G++P +L  L  +L+ L+++ N F      SG +  ++  N    L+
Sbjct: 344 GLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNF------SGPILPNLCQNPKNTLQ 397

Query: 217 KLCIAENNFVGSIPDSLSNASNLELLELAGNQFEGKVSIDFSSLKNLAVLNLERNNL--- 273
           +L +  N F G IP +LSN S L  L L+ N   G +     SL  L  L L  N L   
Sbjct: 398 ELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGE 457

Query: 274 ---GIGTANDLGFVTFLTNCSSLKLPHSIANLSSTMTHFYIGGNQILGIIHFGIRNLVNL 330
               +     L  +    N  + ++P  ++N ++ +    +  N++ G I   I  L NL
Sbjct: 458 IPQELMYVKTLETLILDFNDLTGEIPSGLSNCTN-LNWISLSNNRLTGEIPKWIGRLENL 516

Query: 331 IALGMQSNQLHGTIPDVIGELKNLQILSLFGNFLHGSIPSSLGNLTKLANLELSSNSLQG 390
             L + +N   G IP  +G+ ++L  L L  N  +G+IP+++   +      +++N + G
Sbjct: 517 AILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGK----IAANFIAG 572

Query: 391 NIPLSVGNCQNLIGFDAS--HITLTGALPQQLLSITTLSLYLDLSHNLLNGSLLLQVGNL 448
              + + N         +   +   G   +QL  ++T +   +++  +  G       N 
Sbjct: 573 KRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRN-PCNITSRVYGGHTSPTFDNN 631

Query: 449 KNLILLDISGNQFSGVIPVTLSIC 472
            +++ LD+S N  SG IP  +   
Sbjct: 632 GSMMFLDMSYNMLSGYIPKEIGSM 655


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query472
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.98
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.98
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.98
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.78
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.76
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.73
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.73
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.7
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.69
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.69
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.69
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.68
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.67
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.66
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.65
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.65
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.64
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.56
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.56
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.54
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.54
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.54
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.52
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.49
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.49
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.44
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.41
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.41
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.35
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.33
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.33
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.31
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.31
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.3
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.27
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.25
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.01
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.99
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.92
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.86
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.73
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.69
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.57
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.51
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.11
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.05
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.81
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.73
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.35
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.62
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 80.63
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2.3e-50  Score=420.43  Aligned_cols=454  Identities=30%  Similarity=0.456  Sum_probs=337.2

Q ss_pred             CCCCCCCCCCCCCCCcccccceeeCCCCCceEEEECCCCccCcc---c-----------------------CccccCCCC
Q 040195           10 HDPSGVTSSWNNTINLCQWMGVTCGHRHQRVTELDLSNQRIGGV---L-----------------------SPYVGNLSF   63 (472)
Q Consensus        10 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~l~~~~~~~~---~-----------------------~~~l~~~~~   63 (472)
                      .||. .+++|+.+.+||.|.|+.|.  ..+|+.|+++++.+.+.   .                       +..+..+++
T Consensus        25 ~~~~-~l~~W~~~~~~C~w~gv~C~--~~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~l~~~~~~~~~l~~~~~~l~~  101 (768)
T 3rgz_A           25 PDKN-LLPDWSSNKNPCTFDGVTCR--DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVSGFKCSAS  101 (768)
T ss_dssp             SCTT-SSTTCCTTSCGGGSTTEEEE--TTEEEEEECTTSCCCEEHHHHHHHTTTCTTCCEEECTTSCEEECCCCCCCCTT
T ss_pred             CCcc-cccCCCCCCCCcCCcceEEC--CCcEEEEECCCCCcCCccCccChhHhccCcccccCCcCCCcCCCchhhccCCC
Confidence            4777 89999988999999999997  47999999999877653   1                       257888899


Q ss_pred             ccEEeccCCcCccCcch--hhhcCCCCCEEEccCcccCCCCCccc-CCCCCCcEEEcccCcCcccCCcc---c-------
Q 040195           64 LRYINLSDNGFHGEIPQ--EIGNLYRLEKLELSNNSFSGTIPTNL-SRCSELTHLRVANNKLEGQIPKE---I-------  130 (472)
Q Consensus        64 L~~L~L~~~~~~~~~~~--~~~~l~~L~~L~L~~~~~~~~~~~~l-~~l~~L~~L~l~~~~~~~~~~~~---l-------  130 (472)
                      |++|+|++|.+.+..|.  .+.++++|++|++++|.+.+..|..+ .++++|++|++++|.+++..+..   +       
T Consensus       102 L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~  181 (768)
T 3rgz_A          102 LTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELK  181 (768)
T ss_dssp             CCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCC
T ss_pred             CCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCC
Confidence            99999999998876777  88999999999999998876666554 67777888888777766433332   2       


Q ss_pred             ---------------cCCCCCcEEEccccCCCCCCCccccCCCCccEEEecCCccccccccccccCCCccEEEccCCccc
Q 040195          131 ---------------GSLLKLQTLALYYNNLTGQLPDFVGNLSALQVIYIRGNSLGGKIPTTLGLLRNLVYLNVNENQFW  195 (472)
Q Consensus       131 ---------------~~l~~L~~L~l~~~~i~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~l~  195 (472)
                                     ..+++|++|++++|.+.+..|. +..+++|++|++++|.+++..+..+..+++|++|++++|.+.
T Consensus       182 ~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~  260 (768)
T 3rgz_A          182 HLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFV  260 (768)
T ss_dssp             EEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCE
T ss_pred             EEECCCCcccccCCcccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCccc
Confidence                           3456666666666666654554 677777777777777777666777777777777777777653


Q ss_pred             cccc----------------cccccChhhhcCCCCccEEEcccccccccCCccCcCCCCCCEEecCCCccccccccc-cc
Q 040195          196 YVSS----------------FSGSLPFDILVNLPNLKKLCIAENNFVGSIPDSLSNASNLELLELAGNQFEGKVSID-FS  258 (472)
Q Consensus       196 ~~~~----------------~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~-l~  258 (472)
                      ....                ..+.+|......+++|++|++++|.+++..|..++.+++|++|++++|.+.+..+.. +.
T Consensus       261 ~~~~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~  340 (768)
T 3rgz_A          261 GPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLL  340 (768)
T ss_dssp             ESCCCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHT
T ss_pred             CccCccccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHh
Confidence            2110                111222222222355555555555555555555555555555555555554333332 55


Q ss_pred             ccCCCCeEEcCCCcCCCCCCCCcchhhhhc-ccCCCcC---------Cchhhh-ccccccEEEeecccccCcccccccCc
Q 040195          259 SLKNLAVLNLERNNLGIGTANDLGFVTFLT-NCSSLKL---------PHSIAN-LSSTMTHFYIGGNQILGIIHFGIRNL  327 (472)
Q Consensus       259 ~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~-~~~~l~~---------~~~~~~-~~~~l~~l~l~~~~~~~~~~~~l~~~  327 (472)
                      .+++|++|++++|.+.......+   .... +++.+.+         +..+.. ..+++++|++++|.++...+..+..+
T Consensus       341 ~l~~L~~L~Ls~n~l~~~~p~~l---~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l  417 (768)
T 3rgz_A          341 KMRGLKVLDLSFNEFSGELPESL---TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC  417 (768)
T ss_dssp             TCTTCCEEECCSSEEEECCCTTH---HHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGC
T ss_pred             cCCCCCEEeCcCCccCccccHHH---HhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcC
Confidence            55566666666655432111111   1111 2222222         111111 13478889999888888888889999


Q ss_pred             cCcceEeccccccccCcchhhcCCCCCcEEEccCCcCccccccchhcccccCeeeccCCcccccCCcCccCCCCCceEee
Q 040195          328 VNLIALGMQSNQLHGTIPDVIGELKNLQILSLFGNFLHGSIPSSLGNLTKLANLELSSNSLQGNIPLSVGNCQNLIGFDA  407 (472)
Q Consensus       328 ~~L~~L~l~~~~i~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l  407 (472)
                      ++|++|++++|.+.+..|..++.+++|++|++++|.+.+..|..+..+++|++|++++|++++.+|..+..+++|++|++
T Consensus       418 ~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L  497 (768)
T 3rgz_A          418 SELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISL  497 (768)
T ss_dssp             TTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEEC
T ss_pred             CCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEc
Confidence            99999999999999889999999999999999999999889999999999999999999999889999999999999999


Q ss_pred             cCCcccccCChhhhhhcccceEEEcCCCcccccccccccCCCCCceEeccCCeeccccCCcccc
Q 040195          408 SHITLTGALPQQLLSITTLSLYLDLSHNLLNGSLLLQVGNLKNLILLDISGNQFSGVIPVTLSI  471 (472)
Q Consensus       408 s~~~~~~~~~~~l~~~~~l~~~L~ls~n~l~~~~~~~l~~~~~L~~L~L~~n~~~~~~p~~~~~  471 (472)
                      ++|++.+.+|..+..+++|+ .|++++|++++.+|..+.++++|+.|++++|++++.+|..+.+
T Consensus       498 ~~N~l~~~~p~~~~~l~~L~-~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~  560 (768)
T 3rgz_A          498 SNNRLTGEIPKWIGRLENLA-ILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFK  560 (768)
T ss_dssp             CSSCCCSCCCGGGGGCTTCC-EEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGT
T ss_pred             cCCccCCcCChHHhcCCCCC-EEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhc
Confidence            99999988999999999999 9999999999999999999999999999999999999988765



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 472
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-21
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-12
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-06
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 4e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 5e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 90.6 bits (223), Expect = 8e-21
 Identities = 75/287 (26%), Positives = 113/287 (39%), Gaps = 25/287 (8%)

Query: 10  HDPSGVTSSWNNTINLCQ--WMGVTC--GHRHQRVTELDLSNQRIGGV--LSPYVGNLSF 63
            +P+   SSW  T + C   W+GV C    +  RV  LDLS   +     +   + NL +
Sbjct: 19  GNPT-TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPY 77

Query: 64  LRYINLSDN-GFHGEIPQEIGNLYRLEKLELSNNSFSGTIPTNLSRCSELTHLRVANNKL 122
           L ++ +       G IP  I  L +L  L +++ + SG IP  LS+   L  L  + N L
Sbjct: 78  LNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNAL 137

Query: 123 EGQIPKEIGSLLKLQTLALYYNNLTGQLPDFVGNLSALQV-IYIRGNSLGGKIPTTLGLL 181
            G +P  I SL  L  +    N ++G +PD  G+ S L   + I  N L GKIP T   L
Sbjct: 138 SGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANL 197

Query: 182 RNLVYLNVNENQFWYVSSFSGSLPFDILVN---------------LPNLKKLCIAENNFV 226
                           S   GS      ++                 NL  L +  N   
Sbjct: 198 NLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIY 257

Query: 227 GSIPDSLSNASNLELLELAGNQFEGKVSIDFSSLKNLAVLNLERNNL 273
           G++P  L+    L  L ++ N   G++     +L+   V     N  
Sbjct: 258 GTLPQGLTQLKFLHSLNVSFNNLCGEIP-QGGNLQRFDVSAYANNKC 303


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query472
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.84
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.83
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.82
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.64
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.62
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.61
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.55
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.54
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.51
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.5
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.41
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.2
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.2
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.15
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.12
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.37
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.07
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.06
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.01
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.75
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.69
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.96  E-value=2.3e-28  Score=225.45  Aligned_cols=254  Identities=31%  Similarity=0.504  Sum_probs=174.4

Q ss_pred             CCCCCCCCCCCCCCCccc--ccceeeCCCC--CceEEEECCCCccCcc--cCccccCCCCccEEeccC-CcCccCcchhh
Q 040195           10 HDPSGVTSSWNNTINLCQ--WMGVTCGHRH--QRVTELDLSNQRIGGV--LSPYVGNLSFLRYINLSD-NGFHGEIPQEI   82 (472)
Q Consensus        10 ~~~~~~~~~~~~~~~~~~--~~~~~~~~~~--~~l~~L~l~~~~~~~~--~~~~l~~~~~L~~L~L~~-~~~~~~~~~~~   82 (472)
                      .|| ..+++|..+.+||+  |.|+.|....  .+|+.|+++++.+.+.  ++..+.++++|++|+|++ |.+.+.+|..|
T Consensus        19 ~~~-~~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i   97 (313)
T d1ogqa_          19 GNP-TTLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAI   97 (313)
T ss_dssp             TCC-GGGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGG
T ss_pred             CCC-CcCCCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCChHHhcCcccccccccccccccccccccc
Confidence            344 36899999999995  9999997543  4799999999988763  567888888888888886 56776778888


Q ss_pred             hcCCCCCEEEccCcccCCCCCcccCCCCCCcEEEcccCcCcccCCccccCCCCCcEEEccccCCCCCCCccccCCCCc-c
Q 040195           83 GNLYRLEKLELSNNSFSGTIPTNLSRCSELTHLRVANNKLEGQIPKEIGSLLKLQTLALYYNNLTGQLPDFVGNLSAL-Q  161 (472)
Q Consensus        83 ~~l~~L~~L~L~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~i~~~~~~~l~~~~~L-~  161 (472)
                      .++++|++|++++|.+.+..+..+..++.|+++++++|.+....|..+.++++++++++++|.+.+..|..+..+..+ +
T Consensus        98 ~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~  177 (313)
T d1ogqa_          98 AKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFT  177 (313)
T ss_dssp             GGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCC
T ss_pred             ccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccceeecccccccccccccccccccccc
Confidence            888888888888888877777778888888888888888776777788888888888888888777777777777665 6


Q ss_pred             EEEecCCccccccccccccCCCccEEEccCCccccccccccccChhhhcCCCCccEEEcccccccccCCccCcCCCCCCE
Q 040195          162 VIYIRGNSLGGKIPTTLGLLRNLVYLNVNENQFWYVSSFSGSLPFDILVNLPNLKKLCIAENNFVGSIPDSLSNASNLEL  241 (472)
Q Consensus       162 ~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~l~~~~~L~~  241 (472)
                      .+.++.|++++..+..+..+..+ .+++..+...      + .....+...++++.+++.++.+.+.++ .+..+++|+.
T Consensus       178 ~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~------~-~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~  248 (313)
T d1ogqa_         178 SMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLE------G-DASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNG  248 (313)
T ss_dssp             EEECCSSEEEEECCGGGGGCCCS-EEECCSSEEE------E-CCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCE
T ss_pred             ccccccccccccccccccccccc-cccccccccc------c-ccccccccccccccccccccccccccc-cccccccccc
Confidence            77777777776666666554433 4666555431      1 112223344555555555555543322 3444555555


Q ss_pred             EecCCCcccccccccccccCCCCeEEcCCCcC
Q 040195          242 LELAGNQFEGKVSIDFSSLKNLAVLNLERNNL  273 (472)
Q Consensus       242 L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~  273 (472)
                      |++++|++++..+..+.++++|++|++++|++
T Consensus       249 L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l  280 (313)
T d1ogqa_         249 LDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNL  280 (313)
T ss_dssp             EECCSSCCEECCCGGGGGCTTCCEEECCSSEE
T ss_pred             ccCccCeecccCChHHhCCCCCCEEECcCCcc
Confidence            55555555544444555555555555544443



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure