Citrus Sinensis ID: 040206


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------
KTIKTQVKTCNISEFPDILRTQHQLEWLDLSKNQIRGRIPSWMWDIGVHTLQFLILSQNVLTSIDHLPWKNLQYLTLDSNLLQGSLPDLPPHMVQLLISNNSLTGEIPSSFCNLSSIQYLNLSNNSLSGQIPQCLGNSTLETLDLGMNNFQGSIPQTNAKGCNLTSLRLSGNHLEGPLPPSLINCVNLQFLDVGNNNLSGPIPECLGNSTRLSFLDVGNNSLSGPIPECLANSTLEILDMRMNKFSGSLPQNICKKLCFGPLPPSLVNCQYLEVLDVGNNQIDDTFLYWLDVLLQLQVLILRSNRFWGPIGKLRSRWSGHFIVRTVFPYETIEIENPKNGDLFKVKD
cccEEEccccccccccHHHHccccccEEEcccccccccccHHHHHcccccccEEEccccccccccccccccccEEEccccccccccccccccccEEEEEccEEEEcccHHHHccccccEEEccccccEEcccccccccccccEEccccEEEEEccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccEEEccccEEEEccccccccccccEEEccccccccccccccccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHHHccccEEEEcccccEEEEEcccccccccccc
ccEEEEccccccccccHHHccccccEEEEEccccccccccHHHHccccccccEEEccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccHHHccccccEEEEEccccccccccHHHcccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHcccccEEEEcccccccccccHHHccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEEEccccccccccccHcccccccc
ktiktqvktcnisefpdilRTQHQLEWLDlsknqirgripswmwdigVHTLQFLILSQNVltsidhlpwknlqyltldsnllqgslpdlpphMVQLLIsnnsltgeipssfcnlssiqylnlsnnslsgqipqclgnstletldlgmnnfqgsipqtnakgcnltslrlsgnhlegplppslincvnlqfldvgnnnlsgpipeclgnstrlsfldvgnnslsgpipeclanstLEILDMRMnkfsgslpqnickklcfgplppslvncqylevldvgnnqiddTFLYWLDVLLQLQVLILRsnrfwgpigklrsrwsghfivrtvfpyetieienpkngdlfkvkd
ktiktqvktcnisefpdilrtqHQLEWLDLSKNQIRGRIPSWMWDIGVHTLQFLILSQNVLTSIDHLPWKNLQYLTLDSNLLQGSLPDLPPHMVQLLISNNSLTGEIPSSFCNLSSIQYLNLSNNSLSGQIPQCLGNSTLETLDLGMNNFQGSIPQTNAKGCNLTSLRLSGNHLEGPLPPSLINCVNLQFLDVGNNNLSGPIPECLGNSTRLSFLDVGNNSLSGPIPECLANSTLEILDMRMNKFSGSLPQNICKKLCFGPLPPSLVNCQYLEVLDVGNNQIDDTFLYWLDVLLQLQVLILRSNRFWGPIGklrsrwsghfivrtvfpyetieienpkngdlfkvkd
KTIKTQVKTCNISEFPDILRTQHQLEWLDLSKNQIRGRIPSWMWDIGVHTLQFLILSQNVLTSIDHLPWKNLQYLTLDSNLLQGSLPDLPPHMVQLLISNNSLTGEIPSSFCNLSSIQYLNLSNNSLSGQIPQCLGNSTLETLDLGMNNFQGSIPQTNAKGCNLTSLRLSGNHLEGPLPPSLINCVNLQFLDVGNNNLSGPIPECLGNSTRLSFLDVGNNSLSGPIPECLANSTLEILDMRMNKFSGSLPQNICKKLCFGPLPPSLVNCQYLEVLDVGNNQIDDTFlywldvllqlqvlilRSNRFWGPIGKLRSRWSGHFIVRTVFPYETIEIENPKNGDLFKVKD
******VKTCNISEFPDILRTQHQLEWLDLSKNQIRGRIPSWMWDIGVHTLQFLILSQNVLTSIDHLPWKNLQYLTLDSNLLQGSLPDLPPHMVQLLISNNSLTGEIPSSFCNLSSIQYLNLSNNSLSGQIPQCLGNSTLETLDLGMNNFQGSIPQTNAKGCNLTSLRLSGNHLEGPLPPSLINCVNLQFLDVGNNNLSGPIPECLGNSTRLSFLDVGNNSLSGPIPECLANSTLEILDMRMNKFSGSLPQNICKKLCFGPLPPSLVNCQYLEVLDVGNNQIDDTFLYWLDVLLQLQVLILRSNRFWGPIGKLRSRWSGHFIVRTVFPYETIEIE************
KTIKTQVKTCNISEFPDILRTQHQLEWLDLSKNQIRGRIPSWMWDIGVHTLQFLILSQNVLTSIDHLPWKNLQYLTLDSNLLQGSLPDLPPHMVQLLISNNSLTGEIPSSFCNLSSIQYLNLSNNSLSGQIPQCLGNSTLETLDLGMNNFQGSIPQTNAKGCNLTSLRLSGNHLEGPLPPSLINCVNLQFLDVGNNNLSGPIPECLGNSTRLSFLDVGNNSLSGPIPECLANSTLEILDMRMNKFSGSLPQNICKKLCFGPLPPSLVNCQYLEVLDVGNNQIDDTFLYWLDVLLQLQVLILRSNRFWGPIGKLRSRWSGHFIVRTVFPYETIEIENPKNGDLFKV**
KTIKTQVKTCNISEFPDILRTQHQLEWLDLSKNQIRGRIPSWMWDIGVHTLQFLILSQNVLTSIDHLPWKNLQYLTLDSNLLQGSLPDLPPHMVQLLISNNSLTGEIPSSFCNLSSIQYLNLSNNSLSGQIPQCLGNSTLETLDLGMNNFQGSIPQTNAKGCNLTSLRLSGNHLEGPLPPSLINCVNLQFLDVGNNNLSGPIPECLGNSTRLSFLDVGNNSLSGPIPECLANSTLEILDMRMNKFSGSLPQNICKKLCFGPLPPSLVNCQYLEVLDVGNNQIDDTFLYWLDVLLQLQVLILRSNRFWGPIGKLRSRWSGHFIVRTVFPYETIEIENPKNGDLFKVKD
KTIKTQVKTCNISEFPDILRTQHQLEWLDLSKNQIRGRIPSWMWDIGVHTLQFLILSQNVLTSIDHLPWKNLQYLTLDSNLLQGSLPDLPPHMVQLLISNNSLTGEIPSSFCNLSSIQYLNLSNNSLSGQIPQCLGNSTLETLDLGMNNFQGSIPQTNAKGCNLTSLRLSGNHLEGPLPPSLINCVNLQFLDVGNNNLSGPIPECLGNSTRLSFLDVGNNSLSGPIPECLANSTLEILDMRMNKFSGSLPQNICKKLCFGPLPPSLVNCQYLEVLDVGNNQIDDTFLYWLDVLLQLQVLILRSNRFWGPIGKLRSRWSGHFIVRTVFPYETIEIENPKNGDLF****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KTIKTQVKTCNISEFPDILRTQHQLEWLDLSKNQIRGRIPSWMWDIGVHTLQFLILSQNVLTSIDHLPWKNLQYLTLDSNLLQGSLPDLPPHMVQLLISNNSLTGEIPSSFCNLSSIQYLNLSNNSLSGQIPQCLGNSTLETLDLGMNNFQGSIPQTNAKGCNLTSLRLSGNHLEGPLPPSLINCVNLQFLDVGNNNLSGPIPECLGNSTRLSFLDVGNNSLSGPIPECLANSTLEILDMRMNKFSGSLPQNICKKLCFGPLPPSLVNCQYLEVLDVGNNQIDDTFLYWLDVLLQLQVLILRSNRFWGPIGKLRSRWSGHFIVRTVFPYETIEIENPKNGDLFKVKD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query347 2.2.26 [Sep-21-2011]
Q8VZG8 1045 Probable LRR receptor-lik no no 0.864 0.287 0.355 2e-32
Q9C9H7 847 Receptor-like protein 12 no no 0.855 0.350 0.314 5e-32
C0LGS2 1136 Probable LRR receptor-lik no no 0.818 0.25 0.355 2e-31
O22938 890 Leucine-rich repeat recep no no 0.847 0.330 0.319 9e-30
Q9FL28 1173 LRR receptor-like serine/ no no 0.798 0.236 0.347 1e-29
Q42371 976 LRR receptor-like serine/ no no 0.855 0.304 0.347 4e-29
Q9FZ59 1088 Leucine-rich repeat recep no no 0.864 0.275 0.295 6e-29
Q8L899 1207 Systemin receptor SR160 O N/A no 0.835 0.240 0.340 9e-29
O49318 1124 Probable leucine-rich rep no no 0.853 0.263 0.338 5e-28
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.806 0.223 0.322 7e-28
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function desciption
 Score =  139 bits (351), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 116/326 (35%), Positives = 164/326 (50%), Gaps = 26/326 (7%)

Query: 12  ISEFPDILRTQHQLEWLDLSKNQIRGRIPSWMWDIGVHT-LQFLILSQNVLTSIDHLPWK 70
           + E P  L     L+ L L +N++ G IPS   +IG  T +  + +  N+LT      + 
Sbjct: 155 VGEIPPELGDLSNLDTLHLVENKLNGSIPS---EIGRLTKVTEIAIYDNLLTGPIPSSFG 211

Query: 71  NLQYLT---LDSNLLQGSLPDLP---PHMVQLLISNNSLTGEIPSSFCNLSSIQYLNLSN 124
           NL  L    L  N L GS+P      P++ +L +  N+LTG+IPSSF NL ++  LN+  
Sbjct: 212 NLTKLVNLYLFINSLSGSIPSEIGNLPNLRELCLDRNNLTGKIPSSFGNLKNVTLLNMFE 271

Query: 125 NSLSGQIPQCLGNST-LETLDLGMNNFQGSIPQTNAKGCNLTSLRLSGNHLEGPLPPSLI 183
           N LSG+IP  +GN T L+TL L  N   G IP T      L  L L  N L G +PP L 
Sbjct: 272 NQLSGEIPPEIGNMTALDTLSLHTNKLTGPIPSTLGNIKTLAVLHLYLNQLNGSIPPELG 331

Query: 184 NCVNLQFLDVGNNNLSGPIPECLGNSTRLSFLDVGNNSLSGPIPECLANST-LEILDMRM 242
              ++  L++  N L+GP+P+  G  T L +L + +N LSGPIP  +ANST L +L +  
Sbjct: 332 EMESMIDLEISENKLTGPVPDSFGKLTALEWLFLRDNQLSGPIPPGIANSTELTVLQLDT 391

Query: 243 NKFSGSLPQNICK--KL---------CFGPLPPSLVNCQYLEVLDVGNNQIDDTFLYWLD 291
           N F+G LP  IC+  KL           GP+P SL +C+ L  +    N           
Sbjct: 392 NNFTGFLPDTICRGGKLENLTLDDNHFEGPVPKSLRDCKSLIRVRFKGNSFSGDISEAFG 451

Query: 292 VLLQLQVLILRSNRFWGPIGKLRSRW 317
           V   L  + L +N F    G+L + W
Sbjct: 452 VYPTLNFIDLSNNNFH---GQLSANW 474





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|O22938|Y2182_ARATH Leucine-rich repeat receptor-like tyrosine-protein kinase At2g41820 OS=Arabidopsis thaliana GN=At2g41820 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query347
224116970 921 predicted protein [Populus trichocarpa] 0.708 0.267 0.488 9e-50
356551688 1135 PREDICTED: receptor-like protein 12-like 0.861 0.263 0.390 1e-48
147782974 1719 hypothetical protein VITISV_036826 [Viti 0.703 0.141 0.454 2e-48
359485824 973 PREDICTED: receptor-like protein 12-like 0.806 0.287 0.404 3e-47
224061455 804 predicted protein [Populus trichocarpa] 0.861 0.371 0.401 9e-47
225462116 1001 PREDICTED: receptor-like protein 12-like 0.798 0.276 0.393 2e-46
147794486 1924 hypothetical protein VITISV_000631 [Viti 0.703 0.126 0.442 3e-46
255568090 1014 serine/threonine-protein kinase bri1, pu 0.729 0.249 0.451 3e-46
224140511 894 predicted protein [Populus trichocarpa] 0.700 0.271 0.444 5e-46
449454684 1068 PREDICTED: receptor-like protein 12-like 0.835 0.271 0.416 2e-45
>gi|224116970|ref|XP_002331797.1| predicted protein [Populus trichocarpa] gi|222874493|gb|EEF11624.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  203 bits (517), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 123/252 (48%), Positives = 162/252 (64%), Gaps = 6/252 (2%)

Query: 4   KTQVKTCNISEFPDILRTQHQLEWLDLSKNQIRGRIPSWMWDIGVHTLQFLILSQNVLTS 63
           K  + +CNI EFPD L+ Q+QL +L LS N+I G IP W+   G+ +LQ+L LS N LT 
Sbjct: 432 KLALSSCNIIEFPDFLKIQNQLNFLSLSHNRIHGEIPKWLSAKGMQSLQYLDLSHNFLTI 491

Query: 64  IDHLPWKNLQYLTLDSNLLQGSLPDLPPHMVQLLISNNSLTGEIPSSFCNLSSIQYLNLS 123
           ++ LP  +LQYL L SNLLQ   P LP  M  LLI+NN LTGEIP   CN+++ Q +NLS
Sbjct: 492 VNELP-PSLQYLDLTSNLLQQPFPILPQSMYILLIANNKLTGEIPPWICNITTFQIINLS 550

Query: 124 NNSLSGQIPQCLGN--STLETLDLGMNNFQGSIPQTNAKGCNLTSLRLSGNHLEGPLPPS 181
           NNSLSG IPQCLGN  + L  L+L  N+F G+IP +  +G  + SL L+GN LEG LP S
Sbjct: 551 NNSLSGNIPQCLGNFSTELSVLNLRSNSFHGTIPGSFTEGNKIRSLDLNGNELEGSLPLS 610

Query: 182 LINCVNLQFLDVGNNNLSGPIPECLGNSTRLSFLDVGNNSLSGPI--PECLA-NSTLEIL 238
           L NC  L+ LD+GNN ++   P  L    +L  L + +N L G I  P  ++  S+L I+
Sbjct: 611 LANCKMLEVLDLGNNYINDSFPLWLQTLPKLQVLVLRSNRLHGSIGNPTAISPFSSLRII 670

Query: 239 DMRMNKFSGSLP 250
           D+  N+F G LP
Sbjct: 671 DLSHNEFIGLLP 682




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356551688|ref|XP_003544206.1| PREDICTED: receptor-like protein 12-like [Glycine max] Back     alignment and taxonomy information
>gi|147782974|emb|CAN66148.1| hypothetical protein VITISV_036826 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485824|ref|XP_003633343.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224061455|ref|XP_002300488.1| predicted protein [Populus trichocarpa] gi|222847746|gb|EEE85293.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225462116|ref|XP_002263233.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147794486|emb|CAN71611.1| hypothetical protein VITISV_000631 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255568090|ref|XP_002525021.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi|223535683|gb|EEF37348.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224140511|ref|XP_002323626.1| predicted protein [Populus trichocarpa] gi|222868256|gb|EEF05387.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449454684|ref|XP_004145084.1| PREDICTED: receptor-like protein 12-like [Cucumis sativus] gi|449471911|ref|XP_004153442.1| PREDICTED: receptor-like protein 12-like [Cucumis sativus] gi|449520982|ref|XP_004167511.1| PREDICTED: receptor-like protein 12-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query347
TAIR|locus:2046357 890 RLP23 "receptor like protein 2 0.697 0.271 0.401 3.2e-40
TAIR|locus:2046397 589 RLP22 "receptor like protein 2 0.688 0.405 0.395 4.2e-40
TAIR|locus:2086974 881 RLP41 "AT3G25010" [Arabidopsis 0.697 0.274 0.401 2.3e-39
TAIR|locus:2173777 792 RLP54 "receptor like protein 5 0.694 0.304 0.376 5.6e-39
TAIR|locus:2046535740 RLP28 "receptor like protein 2 0.697 0.327 0.389 1.9e-38
TAIR|locus:2086979 890 RLP42 "receptor like protein 4 0.694 0.270 0.399 4.6e-38
TAIR|locus:2119430 741 RLP47 "receptor like protein 4 0.694 0.325 0.387 1.9e-37
TAIR|locus:2040035 671 RLP20 "receptor like protein 2 0.685 0.354 0.373 9e-37
TAIR|locus:2205005 1019 RLP7 "AT1G47890" [Arabidopsis 0.700 0.238 0.373 2.1e-36
TAIR|locus:2829370 915 RLP40 "receptor like protein 4 0.688 0.261 0.386 2.1e-36
TAIR|locus:2046357 RLP23 "receptor like protein 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 437 (158.9 bits), Expect = 3.2e-40, P = 3.2e-40
 Identities = 102/254 (40%), Positives = 148/254 (58%)

Query:     7 VKTCNISEFPDILRTQHQLEWLDLSKNQIRGRIPSWMWDIGVHTLQFLILSQNVLT---- 62
             ++ C+I+EFP+IL+T  +L ++D+S N+++G+IP W+W + +  LQ + L  N  T    
Sbjct:   397 LRHCDINEFPNILKTLKELVYIDISNNRMKGKIPEWLWSLPL--LQSVTLGNNYFTGFQG 454

Query:    63 SIDHLPWKNLQYLTLDSNLLQGSLPDLPPHMVQLLISNNSLTGEIPSSFCNLSSIQYLNL 122
             S + L   ++  L LDSN  +G+LPDLP  +    +++NS T EIP S CN SS+  ++L
Sbjct:   455 SAEILVNSSVLLLYLDSNNFEGALPDLPLSIKGFGVASNSFTSEIPLSICNRSSLAAIDL 514

Query:   123 SNNSLSGQIPQCLGNSTLETLDLGMNNFQGSIPQTNAKGCNLTSLRLSGNHLEGPLPPSL 182
             S N+ +G IP CL N  LE + L  NN +GSIP     G +L +L +S N L G LP S 
Sbjct:   515 SYNNFTGPIPPCLRN--LELVYLRNNNLEGSIPDALCDGASLRTLDVSHNRLTGKLPRSF 572

Query:   183 INCVNLQFLDVGNNNLSGPIPECLGNSTRLSFLDVGNNSLSGPI--PEC--LANSTLEIL 238
             +NC +L+FL V NN +    P  L     L  L + +N   GPI  P    L    L I 
Sbjct:   573 VNCSSLKFLSVINNRIEDTFPFWLKALPNLQVLTLRSNRFYGPISPPHQGPLGFPELRIF 632

Query:   239 DMRMNKFSGSLPQN 252
             ++  NKF+GSLP N
Sbjct:   633 EISDNKFTGSLPPN 646


GO:0005576 "extracellular region" evidence=ISM
GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009617 "response to bacterium" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0035304 "regulation of protein dephosphorylation" evidence=RCA
TAIR|locus:2046397 RLP22 "receptor like protein 22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086974 RLP41 "AT3G25010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173777 RLP54 "receptor like protein 54" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046535 RLP28 "receptor like protein 28" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086979 RLP42 "receptor like protein 42" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119430 RLP47 "receptor like protein 47" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040035 RLP20 "receptor like protein 20" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2829370 RLP40 "receptor like protein 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pm.C_scaffold_182000003
hypothetical protein (921 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-35
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-34
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-33
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-32
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-31
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-30
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-19
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-18
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-12
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-09
PLN03210 1153 PLN03210, PLN03210, Resistant to P 8e-07
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 2e-06
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 4e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 6e-06
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 8e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  134 bits (340), Expect = 8e-35
 Identities = 103/303 (33%), Positives = 143/303 (47%), Gaps = 50/303 (16%)

Query: 25  LEWLDLSKNQIRGRIPSWMWDIGVHTLQFLILSQNVLT-----SIDHLPWKNLQYLTLDS 79
           L  LDL  N + G IPS + ++    LQ+L L QN L+     SI  L  + L  L L  
Sbjct: 238 LNHLDLVYNNLTGPIPSSLGNLK--NLQYLFLYQNKLSGPIPPSIFSL--QKLISLDLSD 293

Query: 80  NLLQGSLPDLPPHMVQL----LISNNSLTGEIPSSFCNLSSIQYLNLSNNSLSGQIPQCL 135
           N L G +P+L   +  L    L SNN  TG+IP +  +L  +Q L L +N  SG+IP+ L
Sbjct: 294 NSLSGEIPELVIQLQNLEILHLFSNN-FTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNL 352

Query: 136 G-NSTLETLDLGMNNFQGSIPQTNAKGCNLTSLRLSGNHLEGPLPPSLINC-----VNLQ 189
           G ++ L  LDL  NN  G IP+      NL  L L  N LEG +P SL  C     V LQ
Sbjct: 353 GKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQ 412

Query: 190 -------------------FLDVGNNNLSGPIPECLGNSTRLSFLDVGNNSLSGPIPECL 230
                              FLD+ NNNL G I     +   L  L +  N   G +P+  
Sbjct: 413 DNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF 472

Query: 231 ANSTLEILDMRMNKFSGSLPQ-----------NICKKLCFGPLPPSLVNCQYLEVLDVGN 279
            +  LE LD+  N+FSG++P+            + +    G +P  L +C+ L  LD+ +
Sbjct: 473 GSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSH 532

Query: 280 NQI 282
           NQ+
Sbjct: 533 NQL 535


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 347
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.93
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.89
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.88
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.88
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.86
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.85
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.84
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.82
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.82
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
KOG4237498 consensus Extracellular matrix protein slit, conta 99.79
KOG4237498 consensus Extracellular matrix protein slit, conta 99.78
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.69
KOG0617264 consensus Ras suppressor protein (contains leucine 99.56
KOG0617264 consensus Ras suppressor protein (contains leucine 99.54
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.36
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.33
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.3
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.22
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.17
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.14
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.13
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.12
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.12
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.07
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.07
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.99
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.95
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.85
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.8
PLN03150623 hypothetical protein; Provisional 98.77
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.71
PLN03150623 hypothetical protein; Provisional 98.68
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.67
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.66
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.59
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.52
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.49
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.48
KOG4341483 consensus F-box protein containing LRR [General fu 98.4
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.4
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.4
PRK15386426 type III secretion protein GogB; Provisional 98.21
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.2
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.16
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.14
PRK15386426 type III secretion protein GogB; Provisional 98.11
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.11
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.01
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.01
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.98
KOG4341483 consensus F-box protein containing LRR [General fu 97.96
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.9
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.83
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.73
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.18
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.11
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.0
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.94
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.86
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.66
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.37
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.79
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.32
KOG4308 478 consensus LRR-containing protein [Function unknown 95.03
KOG1947 482 consensus Leucine rich repeat proteins, some prote 94.35
KOG4308478 consensus LRR-containing protein [Function unknown 94.02
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.57
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 93.31
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 93.07
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.85
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.63
smart0037026 LRR Leucine-rich repeats, outliers. 91.42
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.42
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 88.63
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 82.61
KOG3763585 consensus mRNA export factor TAP/MEX67 [RNA proces 80.75
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.7e-32  Score=269.75  Aligned_cols=251  Identities=37%  Similarity=0.557  Sum_probs=183.1

Q ss_pred             CceEEEecCCCCC-CCChhhhcCCCccEEeccCCcccccCChhhhhcCCCcccEEEcCCCcCCC-CCCCCCCCCcEEEcc
Q 040206            1 KTIKTQVKTCNIS-EFPDILRTQHQLEWLDLSKNQIRGRIPSWMWDIGVHTLQFLILSQNVLTS-IDHLPWKNLQYLTLD   78 (347)
Q Consensus         1 ~l~~l~l~~~~~~-~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~-~~~~~~~~L~~L~l~   78 (347)
                      +++.|+++++.+. .++.++..+++|+.|++++|.+.+.+|..++. .+++|++|++++|.+++ ++...+++|++|+++
T Consensus        70 ~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~-~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls  148 (968)
T PLN00113         70 RVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFT-TSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLS  148 (968)
T ss_pred             cEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhc-cCCCCCEEECcCCccccccCccccCCCCEEECc
Confidence            3678999999888 67788999999999999999998888888774 45899999999998864 344667888888888


Q ss_pred             CCCCCccCCC---CCCCccEEEcccCcccccCCccccCCCCccEEEcccCcccccCCccc-CCccccEEECCCCcccccc
Q 040206           79 SNLLQGSLPD---LPPHMVQLLISNNSLTGEIPSSFCNLSSIQYLNLSNNSLSGQIPQCL-GNSTLETLDLGMNNFQGSI  154 (347)
Q Consensus        79 ~~~~~~~~~~---~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~-~~~~L~~L~l~~~~~~~~~  154 (347)
                      +|.+.+..+.   .+++|++|++++|.+....|..+.++++|++|++++|.+.+..+..+ .+.+|+.|++++|.+....
T Consensus       149 ~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~  228 (968)
T PLN00113        149 NNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEI  228 (968)
T ss_pred             CCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcC
Confidence            8887754443   24788888888888777777778888888888888887765554443 4567777777777776667


Q ss_pred             CccCCCCCCccEEEccCCcccCCCccccccCCCCcEEEccCCcccCCCCccccCCCCCCeEEecCCccccCcCcccc-cc
Q 040206          155 PQTNAKGCNLTSLRLSGNHLEGPLPPSLINCVNLQFLDVGNNNLSGPIPECLGNSTRLSFLDVGNNSLSGPIPECLA-NS  233 (347)
Q Consensus       155 ~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~n~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~-~~  233 (347)
                      |..+..+++|++|++++|.++...|..++.+++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+..+..+. .+
T Consensus       229 p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~  308 (968)
T PLN00113        229 PYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQ  308 (968)
T ss_pred             ChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCC
Confidence            77777777777777777777666666677777777777777776666666666666777777766666655444332 25


Q ss_pred             CCcEEEcccCcccccCChh
Q 040206          234 TLEILDMRMNKFSGSLPQN  252 (347)
Q Consensus       234 ~L~~L~L~~~~~~~~~~~~  252 (347)
                      +|+.|++++|.+.+.+|..
T Consensus       309 ~L~~L~l~~n~~~~~~~~~  327 (968)
T PLN00113        309 NLEILHLFSNNFTGKIPVA  327 (968)
T ss_pred             CCcEEECCCCccCCcCChh
Confidence            5666666666665544443



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 3e-23
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-05
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-23
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 7e-12
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-13
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 7e-10
1g9u_A454 Crystal Structure Of Yopm-leucine Rich Effector Pro 6e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 105 bits (263), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 96/284 (33%), Positives = 141/284 (49%), Gaps = 22/284 (7%) Query: 23 HQLEWLDLSKNQIRGR-IPSWMWDIGVHTLQFLILSQNVLTS-IDHLPWKNLQYLTLDSN 80 + LE LDLS N I G + W+ G L+ L +S N ++ +D NL++L + SN Sbjct: 151 NSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSN 210 Query: 81 LLQGSLPDLP--PHMVQLLISNNSLTGEIPSSFCNLSSIQYLNLSNNSLSGQIPQCLGNS 138 +P L + L IS N L+G+ + + ++ LN+S+N G IP L Sbjct: 211 NFSTGIPFLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPP-LPLK 269 Query: 139 TLETLDLGMNNFQGSIPQTNAKGCN-LTSLRLSGNHLEGPLPPSLINCVNLQFLDVGNNN 197 +L+ L L N F G IP + C+ LT L LSGNH G +PP +C L+ L + +NN Sbjct: 270 SLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNN 329 Query: 198 LSGPIP-ECLGNSTRLSFLDVGNNSLSGPIPECLAN--STLEILDMRMNKFSGSL----- 249 SG +P + L L LD+ N SG +PE L N ++L LD+ N FSG + Sbjct: 330 FSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLC 389 Query: 250 --PQNICKKLCF------GPLPPSLVNCQYLEVLDVGNNQIDDT 285 P+N ++L G +PP+L NC L L + N + T Sbjct: 390 QNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGT 433
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1G9U|A Chain A, Crystal Structure Of Yopm-leucine Rich Effector Protein From Yersinia Pestis Length = 454 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query347
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-76
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-62
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-50
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-47
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-45
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-44
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-35
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-56
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-53
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-53
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-48
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-37
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-29
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-42
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-40
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-39
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-36
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-35
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-34
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-39
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-38
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-35
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-34
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-24
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-17
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-39
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-37
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-32
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-31
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-30
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-25
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-23
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-37
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-36
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-34
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-30
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-20
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-16
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-35
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-31
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-27
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-27
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-26
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-26
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-26
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-15
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-34
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-34
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-32
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-31
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-30
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-29
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-27
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-30
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-25
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-27
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-26
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-26
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-23
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-27
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-18
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-27
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-26
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-17
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 2e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-26
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-23
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-21
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-26
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-23
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-17
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-26
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-24
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-22
1o6v_A 466 Internalin A; bacterial infection, extracellular r 9e-20
1o6v_A 466 Internalin A; bacterial infection, extracellular r 7e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-26
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-23
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-22
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-19
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-19
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-19
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-16
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-13
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-20
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-23
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-22
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-18
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-18
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-17
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-18
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-18
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-14
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-19
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-19
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-16
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-12
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-13
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-13
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-17
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-12
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-17
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-16
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-14
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-12
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-11
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-10
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 9e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 7e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  249 bits (638), Expect = 1e-76
 Identities = 95/318 (29%), Positives = 140/318 (44%), Gaps = 23/318 (7%)

Query: 14  EFPDILRTQHQLEWLDLSKNQIRGRIPSWMWDIGVHTLQFLILSQNVLT-----SIDHLP 68
             P    +   LE L LS N   G +P       +  L+ L LS N  +     S+ +L 
Sbjct: 309 AVPPFFGSCSLLESLALSSNNFSGELPMDTLL-KMRGLKVLDLSFNEFSGELPESLTNL- 366

Query: 69  WKNLQYLTLDSNLLQGSLPD-----LPPHMVQLLISNNSLTGEIPSSFCNLSSIQYLNLS 123
             +L  L L SN   G +           + +L + NN  TG+IP +  N S +  L+LS
Sbjct: 367 SASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 426

Query: 124 NNSLSGQIPQCLGN-STLETLDLGMNNFQGSIPQTNAKGCNLTSLRLSGNHLEGPLPPSL 182
            N LSG IP  LG+ S L  L L +N  +G IPQ       L +L L  N L G +P  L
Sbjct: 427 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGL 486

Query: 183 INCVNLQFLDVGNNNLSGPIPECLGNSTRLSFLDVGNNSLSGPIPECLAN-STLEILDMR 241
            NC NL ++ + NN L+G IP+ +G    L+ L + NNS SG IP  L +  +L  LD+ 
Sbjct: 487 SNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLN 546

Query: 242 MNKFSGSLPQNICKK-------LCFGPLPPSLVNCQYLEVLDVGNNQIDDTFLY--WLDV 292
            N F+G++P  + K+          G     + N    +      N ++   +    L+ 
Sbjct: 547 TNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNR 606

Query: 293 LLQLQVLILRSNRFWGPI 310
           L       + S  + G  
Sbjct: 607 LSTRNPCNITSRVYGGHT 624


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query347
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.98
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.98
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.98
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.97
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.97
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.83
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.83
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.83
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.81
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.79
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.79
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.78
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.73
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.63
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.6
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.56
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.56
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.54
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.52
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.52
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.5
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.47
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.41
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.37
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.36
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.34
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.3
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.26
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.26
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.25
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.22
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.21
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.16
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.15
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.01
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.98
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.97
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.96
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.87
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.85
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.82
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.62
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.53
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.31
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.25
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.95
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.9
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.86
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.43
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.04
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.02
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=7.4e-36  Score=286.99  Aligned_cols=325  Identities=31%  Similarity=0.434  Sum_probs=232.7

Q ss_pred             ceEEEecCCCCC-CCChhhhcCCCccEEeccCCcccccCChhhhhcCCCcccEEEcCCCcCCCC-CC--CCCC-CCcEEE
Q 040206            2 TIKTQVKTCNIS-EFPDILRTQHQLEWLDLSKNQIRGRIPSWMWDIGVHTLQFLILSQNVLTSI-DH--LPWK-NLQYLT   76 (347)
Q Consensus         2 l~~l~l~~~~~~-~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~-~~--~~~~-~L~~L~   76 (347)
                      |++|++++|.+. .+|..+.++++|++|++++|.+.+.+|...+. .+++|++|++++|.+++. +.  ..++ +|++|+
T Consensus       296 L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~-~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~  374 (768)
T 3rgz_A          296 LTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLL-KMRGLKVLDLSFNEFSGELPESLTNLSASLLTLD  374 (768)
T ss_dssp             CSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHT-TCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEE
T ss_pred             CCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHh-cCCCCCEEeCcCCccCccccHHHHhhhcCCcEEE
Confidence            556666666666 56666666777777777777666666655222 336677777777666532 22  2233 677777


Q ss_pred             ccCCCCCccCCCC-----CCCccEEEcccCcccccCCccccCCCCccEEEcccCcccccCCccc-CCccccEEECCCCcc
Q 040206           77 LDSNLLQGSLPDL-----PPHMVQLLISNNSLTGEIPSSFCNLSSIQYLNLSNNSLSGQIPQCL-GNSTLETLDLGMNNF  150 (347)
Q Consensus        77 l~~~~~~~~~~~~-----~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~-~~~~L~~L~l~~~~~  150 (347)
                      +++|.+.+..+..     +++|++|++++|.+.+..|..+..+++|++|++++|.+.+..+..+ .+++|+.|++++|.+
T Consensus       375 Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l  454 (768)
T 3rgz_A          375 LSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNML  454 (768)
T ss_dssp             CCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCC
T ss_pred             ccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcc
Confidence            7777665433222     3568888888888877777888888888888888888876555544 556888888888888


Q ss_pred             ccccCccCCCCCCccEEEccCCcccCCCccccccCCCCcEEEccCCcccCCCCccccCCCCCCeEEecCCccccCcCccc
Q 040206          151 QGSIPQTNAKGCNLTSLRLSGNHLEGPLPPSLINCVNLQFLDVGNNNLSGPIPECLGNSTRLSFLDVGNNSLSGPIPECL  230 (347)
Q Consensus       151 ~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~n~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~  230 (347)
                      .+..|..+..+++|++|++++|.++...|..+..+++|+.|++++|.+.+..|.++..+++|+.|++++|.+.+..+..+
T Consensus       455 ~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l  534 (768)
T 3rgz_A          455 EGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAEL  534 (768)
T ss_dssp             CSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGG
T ss_pred             cCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHH
Confidence            77788888888888888888888887778888888888888888888887888888888888888888888876666554


Q ss_pred             cc-cCCcEEEcccCcccccCChhhhcc-----------------------------------------------------
Q 040206          231 AN-STLEILDMRMNKFSGSLPQNICKK-----------------------------------------------------  256 (347)
Q Consensus       231 ~~-~~L~~L~L~~~~~~~~~~~~~~~~-----------------------------------------------------  256 (347)
                      .. ++|+.|++++|.+.+.+|..+...                                                     
T Consensus       535 ~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~  614 (768)
T 3rgz_A          535 GDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCN  614 (768)
T ss_dssp             GGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSC
T ss_pred             cCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccc
Confidence            43 788888888888887777654321                                                     


Q ss_pred             ----------------------------ccccCCCcCccCCCCCcEEEccCCccCCccchhhhhccCCCEEEcccceeec
Q 040206          257 ----------------------------LCFGPLPPSLVNCQYLEVLDVGNNQIDDTFLYWLDVLLQLQVLILRSNRFWG  308 (347)
Q Consensus       257 ----------------------------~~~~~l~~~~~~~~~L~~L~L~~n~i~~~~~~~~~~l~~L~~l~L~~n~~~~  308 (347)
                                                  .-.+.+|..++.+++|+.|+|++|.+++..|..++.+++|+.|||++|.++|
T Consensus       615 l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g  694 (768)
T 3rgz_A          615 ITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDG  694 (768)
T ss_dssp             TTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEE
T ss_pred             cccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccC
Confidence                                        0113456667777777777777777777777777777778888888888887


Q ss_pred             ccCCccccceeeeeeEeec
Q 040206          309 PIGKLRSRWSGHFIVRTVF  327 (347)
Q Consensus       309 ~~~~~~~~~~~~~~~~~~~  327 (347)
                      .+|..+..+..+..+....
T Consensus       695 ~ip~~l~~l~~L~~L~ls~  713 (768)
T 3rgz_A          695 RIPQAMSALTMLTEIDLSN  713 (768)
T ss_dssp             CCCGGGGGCCCCSEEECCS
T ss_pred             cCChHHhCCCCCCEEECcC
Confidence            7777777766665555443



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 347
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 78.5 bits (192), Expect = 9e-17
 Identities = 53/213 (24%), Positives = 80/213 (37%), Gaps = 15/213 (7%)

Query: 10  CNISEFPDILRTQHQLEWLDLSKNQIRGRIPSWMWDIGVHTLQFLILSQNVLTSIDHLP- 68
            N      +L     LE L  + NQI    P  +       L  L L+ N L  I  L  
Sbjct: 184 SNKVSDISVLAKLTNLESLIATNNQISDITPLGIL----TNLDELSLNGNQLKDIGTLAS 239

Query: 69  WKNLQYLTLDSNLLQGSLP-DLPPHMVQLLISNNSLTGEIPSSFCNLSSIQYLNLSNNSL 127
             NL  L L +N +    P      + +L +  N ++   P     L+++  L L+ N  
Sbjct: 240 LTNLTDLDLANNQISNLAPLSGLTKLTELKLGANQISNISP--LAGLTALTNLELNENQ- 296

Query: 128 SGQIPQCLGNSTLETLDLGMNNFQGSIPQTNAKGCNLTSLRLSGNHLEGPLPPSLINCVN 187
              I        L  L L  NN     P ++     L  L  + N +      SL N  N
Sbjct: 297 LEDISPISNLKNLTYLTLYFNNISDISPVSSLT--KLQRLFFANNKVSDV--SSLANLTN 352

Query: 188 LQFLDVGNNNLSGPIPECLGNSTRLSFLDVGNN 220
           + +L  G+N +S   P  L N TR++ L + + 
Sbjct: 353 INWLSAGHNQISDLTP--LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query347
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.8
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.64
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.62
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.58
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.55
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.55
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.5
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.45
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.38
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.15
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.11
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.32
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.07
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.81
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.81
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.8
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.31
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.94  E-value=4.8e-25  Score=193.30  Aligned_cols=281  Identities=23%  Similarity=0.244  Sum_probs=208.2

Q ss_pred             CceEEEecCCCCCCCChhhhcCCCccEEeccCCcccccCChhhhhcCCCcccEEEcCCCcCCCCCC-CCCCCCcEEEccC
Q 040206            1 KTIKTQVKTCNISEFPDILRTQHQLEWLDLSKNQIRGRIPSWMWDIGVHTLQFLILSQNVLTSIDH-LPWKNLQYLTLDS   79 (347)
Q Consensus         1 ~l~~l~l~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~-~~~~~L~~L~l~~   79 (347)
                      ++++|++++++++.++ .++++++|++|++++|+++ .+++ +.  .+++|++|++++|.+..+.. ..+++|+.|++++
T Consensus        45 ~l~~L~l~~~~I~~l~-gl~~L~nL~~L~Ls~N~l~-~l~~-l~--~L~~L~~L~L~~n~i~~i~~l~~l~~L~~L~~~~  119 (384)
T d2omza2          45 QVTTLQADRLGIKSID-GVEYLNNLTQINFSNNQLT-DITP-LK--NLTKLVDILMNNNQIADITPLANLTNLTGLTLFN  119 (384)
T ss_dssp             TCCEEECCSSCCCCCT-TGGGCTTCCEEECCSSCCC-CCGG-GT--TCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCS
T ss_pred             CCCEEECCCCCCCCcc-ccccCCCCCEEeCcCCcCC-CCcc-cc--CCcccccccccccccccccccccccccccccccc
Confidence            4789999999999875 4889999999999999998 4543 44  45999999999999988775 7889999999998


Q ss_pred             CCCCccCCCC-CCCccEEEcccCcc-----------------------------------------cccCCccccCCCCc
Q 040206           80 NLLQGSLPDL-PPHMVQLLISNNSL-----------------------------------------TGEIPSSFCNLSSI  117 (347)
Q Consensus        80 ~~~~~~~~~~-~~~L~~L~l~~~~~-----------------------------------------~~~~~~~~~~l~~L  117 (347)
                      +......... ...+.......+.+                                         .......+..++++
T Consensus       120 ~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~  199 (384)
T d2omza2         120 NQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNL  199 (384)
T ss_dssp             SCCCCCGGGTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCCCCGGGGGCTTC
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccchhhhhcccccccccccccccccccccccccccc
Confidence            8776422211 12222222211111                                         01122345567889


Q ss_pred             cEEEcccCcccccCCcccCCccccEEECCCCccccccCccCCCCCCccEEEccCCcccCCCccccccCCCCcEEEccCCc
Q 040206          118 QYLNLSNNSLSGQIPQCLGNSTLETLDLGMNNFQGSIPQTNAKGCNLTSLRLSGNHLEGPLPPSLINCVNLQFLDVGNNN  197 (347)
Q Consensus       118 ~~L~l~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~n~  197 (347)
                      +.++++++.+....+ ....++|+++++++|.+..  ...+..+++++.+++++|.++..  ..+..+++|+.++++++.
T Consensus       200 ~~l~l~~n~i~~~~~-~~~~~~L~~L~l~~n~l~~--~~~l~~l~~L~~L~l~~n~l~~~--~~~~~~~~L~~L~l~~~~  274 (384)
T d2omza2         200 ESLIATNNQISDITP-LGILTNLDELSLNGNQLKD--IGTLASLTNLTDLDLANNQISNL--APLSGLTKLTELKLGANQ  274 (384)
T ss_dssp             SEEECCSSCCCCCGG-GGGCTTCCEEECCSSCCCC--CGGGGGCTTCSEEECCSSCCCCC--GGGTTCTTCSEEECCSSC
T ss_pred             ceeeccCCccCCCCc-ccccCCCCEEECCCCCCCC--cchhhcccccchhccccCccCCC--CcccccccCCEeeccCcc
Confidence            999999988875543 3456789999999998763  23567788999999999988744  347888999999999998


Q ss_pred             ccCCCCccccCCCCCCeEEecCCccccCcCccccccCCcEEEcccCcccccCChhhhccccccCCCcCccCCCCCcEEEc
Q 040206          198 LSGPIPECLGNSTRLSFLDVGNNSLSGPIPECLANSTLEILDMRMNKFSGSLPQNICKKLCFGPLPPSLVNCQYLEVLDV  277 (347)
Q Consensus       198 ~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~L~~L~L  277 (347)
                      +.+.  ..+..++.++.+.+..|.+.+ .......++++.+++++|.+++              ++ .+..+++|++|++
T Consensus       275 l~~~--~~~~~~~~l~~l~~~~n~l~~-~~~~~~~~~l~~L~ls~n~l~~--------------l~-~l~~l~~L~~L~L  336 (384)
T d2omza2         275 ISNI--SPLAGLTALTNLELNENQLED-ISPISNLKNLTYLTLYFNNISD--------------IS-PVSSLTKLQRLFF  336 (384)
T ss_dssp             CCCC--GGGTTCTTCSEEECCSSCCSC-CGGGGGCTTCSEEECCSSCCSC--------------CG-GGGGCTTCCEEEC
T ss_pred             cCCC--Ccccccccccccccccccccc-ccccchhcccCeEECCCCCCCC--------------Cc-ccccCCCCCEEEC
Confidence            8743  246778888999998888774 3344455788999999998884              32 2677888999999


Q ss_pred             cCCccCCccchhhhhccCCCEEEcccceeecccC
Q 040206          278 GNNQIDDTFLYWLDVLLQLQVLILRSNRFWGPIG  311 (347)
Q Consensus       278 ~~n~i~~~~~~~~~~l~~L~~l~L~~n~~~~~~~  311 (347)
                      ++|.+++..  .+..+++|++|++++|++++-.|
T Consensus       337 ~~n~l~~l~--~l~~l~~L~~L~l~~N~l~~l~~  368 (384)
T d2omza2         337 ANNKVSDVS--SLANLTNINWLSAGHNQISDLTP  368 (384)
T ss_dssp             CSSCCCCCG--GGGGCTTCCEEECCSSCCCBCGG
T ss_pred             CCCCCCCCh--hHcCCCCCCEEECCCCcCCCChh
Confidence            999887632  47888999999999999887543



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure