Citrus Sinensis ID: 040234


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------
MGGLGKTTLARVVYDLISHEFDGSSFLADVREKCDKEGSVISLQKQLLSDLLKLADNNIRNVYDGINMLRVRLRRKKVLVVIDDAAHPDHLRRLVGEPDWFGPGSRIIITTRNEHLLKLHPVKKVYKLEALTYDEAFRLLCLKAFDTHKPLEEYVELAESVVRICHCQKSTLNALMSVSYTVSHLLLTLCLKLMQYMLCPFILFVYLLFFSVGLQNMPPSDKYGNMHSPQREYSIVVPGSEIPEWFEYQNNEGSSITISTPPKTYKNSKLVGYVVCCVFRVPKYSLPYYHPLWPQYPVHELSINRKGTTSGLCSIYLRKQFGQAMSDHLFLYYQNRERISKVTFDSPSGLVLKRCGVHPIYVHQGDKLTKQLIPFGI
cccccHHHHHHHHHHHHHccccEEEEccccccHHcccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHccccccccccEEEEEcccccccccccccEEEEcccccHHHHHHHHcHHccccccccHHHHHHHHHHHccccccHHHHHHHHcccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccccccccccEEEEEcccccccccccccccccEEEEEccccccccccEEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccEEEEEEEcccccEEEEEEEEEEEcccccccccccccccc
cccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccEEccHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHccccccccccEEEEEEccHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHEEEEcccccccccccccccccccccEEEEEEcccccHHHHHccccccccEEEEccccccccccEEEEEEEEEEEccccccccccccccccccccccEEccccccccccEEEEEEEEEEEccEEEEEEcccccEEEEEEcccccEEEEEccEEEEEEccHHHHHHHcccccc
MGGLGKTTLARVVYDLIShefdgssflaDVREKCDKEGSVISLQKQLLSDLLKLADNNIRNVYDGINMLRVRLRRKKVLVViddaahpdhlrrlvgepdwfgpgsriIITTRNEhllklhpvkkvyKLEALTYDEAFRLLCLKAFDTHKPLEEYVELAESVVRICHCQKSTLNALMSVSYTVSHLLLTLCLKLMQYMLCPFILFVYLLFFSVglqnmppsdkygnmhspqreysivvpgseipewfeyqnnegssitistppktyknsklvGYVVCCvfrvpkyslpyyhplwpqypvhelsinrkgttsgLCSIYLRKQFGQAMSDHLFLYYQnreriskvtfdspsglvlkrcgvhpiyvhqgdkltkqlipfgi
MGGLGKTTLARVVYDLISHEFDGSSFLADVREKCDKEGSVISLQKQLLSDLLKLADNNIRNVYDGINMLRVRLRRKKVLVViddaahpdhlrrlvgepdwfgpGSRIIITtrnehllklhpVKKVYKLEALTYDEAFRLLCLKAFDTHKPLEEYVELAESVVRICHCQKSTLNALMSVSYTVSHLLLTLCLKLMQYMLCPFILFVYLLFFSVGLQNMPPSDKYGNMHSPQREYSIVVPGSEIPEWFEYQNNEGSSITISTPPKTYKNSKLVGYVVCCVFRVPKYSLPYYHPLWPQYPVHELSINRKGTTSGLCSIYLRKQFGQAMSDHLFLYYQNRERISKVTFDSPSGLVLKRCGVHpiyvhqgdkltkqlipfgi
MGGLGKTTLARVVYDLISHEFDGSSFLADVREKCDKEGSVIslqkqllsdllkladnnIRNVYDGINMlrvrlrrkkvlvvIDDAAHPDHLRRLVGEPDWFGPGSRIIITTRNEHLLKLHPVKKVYKLEALTYDEAFRLLCLKAFDTHKPLEEYVELAESVVRICHCQKSTLNALMSVSYTVSHLLLTLCLKLMQYMLCPFILFVYLLFFSVGLQNMPPSDKYGNMHSPQREYSIVVPGSEIPEWFEYQNNEGSSITISTPPKTYKNSKLVGYVVCCVFRVPKYSLPYYHPLWPQYPVHELSINRKGTTSGLCSIYLRKQFGQAMSDHLFLYYQNRERISKVTFDSPSGLVLKRCGVHPIYVHQGDKLTKQLIPFGI
******TTLARVVYDLISHEFDGSSFLADVREKCDKEGSVISLQKQLLSDLLKLADNNIRNVYDGINMLRVRLRRKKVLVVIDDAAHPDHLRRLVGEPDWFGPGSRIIITTRNEHLLKLHPVKKVYKLEALTYDEAFRLLCLKAFDTHKPLEEYVELAESVVRICHCQKSTLNALMSVSYTVSHLLLTLCLKLMQYMLCPFILFVYLLFFSVGLQ*****************YSIVVPGSEIPEWFEYQNN****ITIST*PKTYKNSKLVGYVVCCVFRVPKYSLPYYHPLWPQYPVHELSINRKGTTSGLCSIYLRKQFGQAMSDHLFLYYQNRERISKVTFDSPSGLVLKRCGVHPIYVHQGDKLTKQLI****
MGGLGKTTLARVVYDLISHEFDGSSFLADVREKCDKEGSVISLQKQLLSDLLKLADNNIRNVYDGINMLRVRLRRKKVLVVIDDAAHPDHLRRLVGEPDWFGPGSRIIITTRNEHLLKLHPVKKVYKLEALTYDEAFRLLCLKAFDTHKPLEEYVELAESVVRICHCQKSTLNALMSVSYTVSHLLLTLCLKLMQYMLCPFILFVYLLFFSVGLQNMPPSDKYGNMHSPQREYSIVVPGSEIPEWFEYQNNEGSSITISTPPKTYKNSKLVGYVVCCVFRVPKYSLPYYHPLWPQYPVHELSINRKGTTSGLCSIYLRKQFGQAMSDHLFLYYQNRERISKVTFDSPSGLVLKRCGVHPIYVHQGDKLTKQLIPFGI
MGGLGKTTLARVVYDLISHEFDGSSFLADVREKCDKEGSVISLQKQLLSDLLKLADNNIRNVYDGINMLRVRLRRKKVLVVIDDAAHPDHLRRLVGEPDWFGPGSRIIITTRNEHLLKLHPVKKVYKLEALTYDEAFRLLCLKAFDTHKPLEEYVELAESVVRICHCQKSTLNALMSVSYTVSHLLLTLCLKLMQYMLCPFILFVYLLFFSVGLQNMPPSDKYGNMHSPQREYSIVVPGSEIPEWFEYQNNEGSSITISTPPKTYKNSKLVGYVVCCVFRVPKYSLPYYHPLWPQYPVHELSINRKGTTSGLCSIYLRKQFGQAMSDHLFLYYQNRERISKVTFDSPSGLVLKRCGVHPIYVHQGDKLTKQLIPFGI
**GLGKTTLARVVYDLISHEFDGSSFLADVREKCDKEGSVISLQKQLLSDLLKLADNNIRNVYDGINMLRVRLRRKKVLVVIDDAAHPDHLRRLVGEPDWFGPGSRIIITTRNEHLLKLHPVKKVYKLEALTYDEAFRLLCLKAFDTHKPLEEYVELAESVVRICHCQKSTLNALMSVSYTVSHLLLTLCLKLMQYMLCPFILFVYLLFFSVGLQNMPPSDKYGNMHSPQREYSIVVPGSEIPEWFEYQNNEGSSITISTPPKTYKNSKLVGYVVCCVFRVPKYSLPYYHPLWPQYPVHELSINRKGTTSGLCSIYLRKQFGQAMSDHLFLYYQNRERISKVTFDSPSGLVLKRCGVHPIYVHQGDKLTKQLIPFGI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGLGKTTLARVVYDLISHEFDGSSFLADVREKCDKEGSVISLQKQLLSDLLKLADNNIRNVYDGINMLRVRLRRKKVLVVIDDAAHPDHLRRLVGEPDWFGPGSRIIITTRNEHLLKLHPVKKVYKLEALTYDEAFRLLCLKAFDTHKPLEEYVELAESVVRICHCQKSTLNALMSVSYTVSHLLLTLCLKLMQYMLCPFILFVYLLFFSVGLQNMPPSDKYGNMHSPQREYSIVVPGSEIPEWFEYQNNEGSSITISTPPKTYKNSKLVGYVVCCVFRVPKYSLPYYHPLWPQYPVHELSINRKGTTSGLCSIYLRKQFGQAMSDHLFLYYQNRERISKVTFDSPSGLVLKRCGVHPIYVHQGDKLTKQLIPFGI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query377 2.2.26 [Sep-21-2011]
Q40392 1144 TMV resistance protein N N/A no 0.413 0.136 0.437 4e-27
O23530 1301 Protein SUPPRESSOR OF npr no no 0.419 0.121 0.331 6e-20
O82500 1095 Putative disease resistan no no 0.405 0.139 0.339 7e-20
Q9FL92 1372 Probable WRKY transcripti no no 0.445 0.122 0.323 4e-19
Q9FH83 1288 Probable WRKY transcripti no no 0.336 0.098 0.372 8e-17
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.413 0.096 0.329 7e-14
Q9SZ67 1895 Probable WRKY transcripti no no 0.464 0.092 0.289 3e-13
Q9XIF0 906 Putative disease resistan no no 0.419 0.174 0.297 9e-08
Q9FG91 848 Probable disease resistan no no 0.450 0.200 0.262 5e-05
Q8W3K0 1138 Probable disease resistan no no 0.400 0.132 0.253 0.0002
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score =  122 bits (307), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 74/169 (43%), Positives = 108/169 (63%), Gaps = 13/169 (7%)

Query: 1   MGGLGKTTLARVVYDLI------SHEFDGSSFLADVREKCDKEGSVISLQKQLLSDLLKL 54
           MGG+GKTT+AR ++D +      S++FDG+ FL D++E  +K G + SLQ  LLS+LL+ 
Sbjct: 217 MGGVGKTTIARAIFDTLLGRMDSSYQFDGACFLKDIKE--NKRG-MHSLQNALLSELLR- 272

Query: 55  ADNNIRNVYDGINMLRVRLRRKKVLVVIDDAAHPDH-LRRLVGEPDWFGPGSRIIITTRN 113
              N  N  DG + +  RLR KKVL+V+DD  + DH L  L G+ DWFG GSRIIITTR+
Sbjct: 273 EKANYNNEEDGKHQMASRLRSKKVLIVLDDIDNKDHYLEYLAGDLDWFGNGSRIIITTRD 332

Query: 114 EHLLKLHPVKKVYKLEALTYDEAFRLLCLKAFDTHKPLEEYVELAESVV 162
           +HL++ + +  +Y++ AL   E+ +L    AF    P E + +L+  VV
Sbjct: 333 KHLIEKNDI--IYEVTALPDHESIQLFKQHAFGKEVPNENFEKLSLEVV 379




Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|Q9XIF0|DRL13_ARATH Putative disease resistance protein At1g59780 OS=Arabidopsis thaliana GN=At1g59780 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG91|DRL32_ARATH Probable disease resistance protein At5g43730 OS=Arabidopsis thaliana GN=At5g43730 PE=2 SV=1 Back     alignment and function description
>sp|Q8W3K0|DRL9_ARATH Probable disease resistance protein At1g58602 OS=Arabidopsis thaliana GN=At1g58602 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query377
22947641171 putative citrus disease resistance prote 0.429 0.947 0.598 4e-47
22947648172 putative citrus disease resistance prote 0.432 0.947 0.588 2e-46
62361219175 resistance protein PLTR [Arachis hypogae 0.432 0.931 0.490 1e-37
255547494 1082 TMV resistance protein N, putative [Rici 0.480 0.167 0.469 3e-37
222066084174 NBS-LLR resistance protein [Gossypium ar 0.429 0.931 0.554 8e-37
222066088174 NBS-LLR resistance protein [Gossypium ar 0.429 0.931 0.554 9e-37
399920191 1320 TIR-NBS-LRR [Rosa rugosa] 0.432 0.123 0.512 1e-36
222066074171 NBS-LLR resistance protein [Gossypium ar 0.429 0.947 0.554 1e-36
332002068173 NBS-LRR-like protein [Malus baccata] 0.456 0.994 0.480 2e-36
22324566176 PR-protein [Capsicum annuum] 0.429 0.920 0.460 4e-36
>gi|22947641|gb|AAN08166.1| putative citrus disease resistance protein Pt6 [Citrus maxima x Citrus trifoliata] Back     alignment and taxonomy information
 Score =  195 bits (495), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 97/162 (59%), Positives = 123/162 (75%)

Query: 2   GGLGKTTLARVVYDLISHEFDGSSFLADVREKCDKEGSVISLQKQLLSDLLKLADNNIRN 61
           GG+GKTTLARVVYDLISHEF+GSSFLADVREK + +GSVIS Q+QLL ++LK   ++I N
Sbjct: 1   GGVGKTTLARVVYDLISHEFEGSSFLADVREKFENKGSVISFQRQLLFEILKFEKDSIWN 60

Query: 62  VYDGINMLRVRLRRKKVLVVIDDAAHPDHLRRLVGEPDWFGPGSRIIITTRNEHLLKLHP 121
           V DGIN+L  RL+ KKVL+VIDD      L  L G+ +WFG GSRII+T+R+EHLLK H 
Sbjct: 61  VGDGINILGSRLQHKKVLLVIDDVVDIKQLEYLAGKREWFGSGSRIIVTSRDEHLLKTHG 120

Query: 122 VKKVYKLEALTYDEAFRLLCLKAFDTHKPLEEYVELAESVVR 163
           + ++YK   L Y +A +L  +KAF   KPLEE V+L+E V+R
Sbjct: 121 MDEIYKPNELNYHDALQLFNMKAFKIQKPLEECVQLSEGVLR 162




Source: Citrus maxima x Citrus trifoliata

Species: Citrus maxima x Citrus trifoliata

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|22947648|gb|AAN08167.1| putative citrus disease resistance protein Pt12 [Citrus maxima x Citrus trifoliata] Back     alignment and taxonomy information
>gi|62361219|gb|AAX81288.1| resistance protein PLTR [Arachis hypogaea] Back     alignment and taxonomy information
>gi|255547494|ref|XP_002514804.1| TMV resistance protein N, putative [Ricinus communis] gi|223545855|gb|EEF47358.1| TMV resistance protein N, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|222066084|emb|CAX28550.1| NBS-LLR resistance protein [Gossypium arboreum] Back     alignment and taxonomy information
>gi|222066088|emb|CAX28552.1| NBS-LLR resistance protein [Gossypium arboreum] gi|222066094|emb|CAX28555.1| NBS-LLR resistance protein [Gossypium arboreum] Back     alignment and taxonomy information
>gi|399920191|gb|AFP55538.1| TIR-NBS-LRR [Rosa rugosa] Back     alignment and taxonomy information
>gi|222066074|emb|CAX28545.1| NBS-LLR resistance protein [Gossypium arboreum] Back     alignment and taxonomy information
>gi|332002068|gb|AED99177.1| NBS-LRR-like protein [Malus baccata] Back     alignment and taxonomy information
>gi|22324566|gb|AAM95614.1|AF525138_1 PR-protein [Capsicum annuum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query377
UNIPROTKB|Q40392 1144 N "TMV resistance protein N" [ 0.413 0.136 0.337 9.1e-19
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.275 0.080 0.390 2.2e-16
TAIR|locus:2205824 1384 AT1G27170 [Arabidopsis thalian 0.432 0.117 0.286 2e-15
TAIR|locus:2160487 1085 AT5G41550 [Arabidopsis thalian 0.222 0.077 0.369 8.8e-14
TAIR|locus:2156579 1190 AT5G48770 [Arabidopsis thalian 0.416 0.131 0.289 1.2e-13
TAIR|locus:2195468 1017 AT1G63880 [Arabidopsis thalian 0.222 0.082 0.380 1.4e-13
TAIR|locus:2164486 1104 AT5G40910 [Arabidopsis thalian 0.222 0.076 0.357 2.1e-13
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.220 0.041 0.421 2.3e-13
TAIR|locus:2175075 1068 AT5G41750 [Arabidopsis thalian 0.222 0.078 0.369 4.8e-13
TAIR|locus:2146228 1245 AT5G18350 [Arabidopsis thalian 0.220 0.066 0.373 5.3e-13
UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] Back     alignment and assigned GO terms
 Score = 223 (83.6 bits), Expect = 9.1e-19, Sum P(2) = 9.1e-19
 Identities = 57/169 (33%), Positives = 87/169 (51%)

Query:     1 MGGLGKTTLARVVYDLI------SHEFDGSSFLADVREKCDKEGSVIXXXXXXXXXXXXX 54
             MGG+GKTT+AR ++D +      S++FDG+ FL D++E  +K G  +             
Sbjct:   217 MGGVGKTTIARAIFDTLLGRMDSSYQFDGACFLKDIKE--NKRG--MHSLQNALLSELLR 272

Query:    55 XXXXIRNVYDGINMXXXXXXXXXXXXXIDDAAHPDH-LRRLVGEPDWFGPGSRIIITTRN 113
                   N  DG +              +DD  + DH L  L G+ DWFG GSRIIITTR+
Sbjct:   273 EKANYNNEEDGKHQMASRLRSKKVLIVLDDIDNKDHYLEYLAGDLDWFGNGSRIIITTRD 332

Query:   114 EHLLKLHPVKKVYKLEALTYDEAFRLLCLKAFDTHKPLEEYVELAESVV 162
             +HL++ + +  +Y++ AL   E+ +L    AF    P E + +L+  VV
Sbjct:   333 KHLIEKNDI--IYEVTALPDHESIQLFKQHAFGKEVPNENFEKLSLEVV 379


GO:0005515 "protein binding" evidence=IPI
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160487 AT5G41550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156579 AT5G48770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195468 AT1G63880 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164486 AT5G40910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175075 AT5G41750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146228 AT5G18350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.I.3722.1
tir-nbs-lrr resistance protein (524 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query377
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-23
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 2e-19
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
 Score =  102 bits (255), Expect = 1e-23
 Identities = 53/169 (31%), Positives = 86/169 (50%), Gaps = 14/169 (8%)

Query: 3   GLGKTTLARVVYDLISHEFDGSSFLADV----------REKCDKEGSVISLQKQLLSDLL 52
           G+GKTT+AR ++  +S +F  S F+                 D     + LQ+  LS++L
Sbjct: 217 GIGKTTIARALFSRLSRQFQSSVFIDRAFISKSMEIYSSANPDDYNMKLHLQRAFLSEIL 276

Query: 53  KLADNNIRNVYDGINMLRVRLRRKKVLVVIDDAAHPDHLRRLVGEPDWFGPGSRIIITTR 112
              D  I      +  +  RL+ +KVL+ IDD    D L  L G+  WFG GSRII+ T+
Sbjct: 277 DKKDIKI----YHLGAMEERLKHRKVLIFIDDLDDQDVLDALAGQTQWFGSGSRIIVITK 332

Query: 113 NEHLLKLHPVKKVYKLEALTYDEAFRLLCLKAFDTHKPLEEYVELAESV 161
           ++H L+ H +  +Y++   + + A  + C  AF  + P + ++ELA  V
Sbjct: 333 DKHFLRAHGIDHIYEVCLPSNELALEMFCRSAFKKNSPPDGFMELASEV 381


syringae 6; Provisional. Length = 1153

>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 377
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.97
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.95
PLN032101153 Resistant to P. syringae 6; Provisional 99.08
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.96
COG3903414 Predicted ATPase [General function prediction only 98.93
PF05729166 NACHT: NACHT domain 98.92
PRK04841 903 transcriptional regulator MalT; Provisional 98.83
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.67
COG2256436 MGS1 ATPase related to the helicase subunit of the 98.59
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.58
PRK06893229 DNA replication initiation factor; Validated 98.58
TIGR02928365 orc1/cdc6 family replication initiation protein. M 98.49
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.4
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.32
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.3
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 98.24
PRK13342413 recombination factor protein RarA; Reviewed 98.24
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.23
PF13173128 AAA_14: AAA domain 98.19
PRK14087450 dnaA chromosomal replication initiation protein; P 98.17
PRK08727233 hypothetical protein; Validated 98.17
PRK09087226 hypothetical protein; Validated 98.17
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.1
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.08
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 98.01
PRK14088440 dnaA chromosomal replication initiation protein; P 98.0
PRK05642234 DNA replication initiation factor; Validated 97.99
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 97.95
PLN03025319 replication factor C subunit; Provisional 97.95
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 97.94
PRK12402337 replication factor C small subunit 2; Reviewed 97.93
PRK08084235 DNA replication initiation factor; Provisional 97.93
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 97.92
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 97.91
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 97.91
TIGR00362405 DnaA chromosomal replication initiator protein Dna 97.9
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 97.88
PRK05564313 DNA polymerase III subunit delta'; Validated 97.86
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 97.86
PRK00149450 dnaA chromosomal replication initiation protein; R 97.86
PRK07471365 DNA polymerase III subunit delta'; Validated 97.85
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 97.84
PRK07940394 DNA polymerase III subunit delta'; Validated 97.84
PRK12422445 chromosomal replication initiation protein; Provis 97.79
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 97.78
PRK09112351 DNA polymerase III subunit delta'; Validated 97.77
PRK05707328 DNA polymerase III subunit delta'; Validated 97.77
PRK13341 725 recombination factor protein RarA/unknown domain f 97.75
PRK14086617 dnaA chromosomal replication initiation protein; P 97.73
PRK04195482 replication factor C large subunit; Provisional 97.71
PRK08903227 DnaA regulatory inactivator Hda; Validated 97.71
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 97.7
PTZ001121164 origin recognition complex 1 protein; Provisional 97.69
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 97.69
KOG2028554 consensus ATPase related to the helicase subunit o 97.67
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 97.67
cd01128249 rho_factor Transcription termination factor rho is 97.64
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 97.62
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 97.62
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 97.61
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 97.6
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 97.59
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.58
PRK09376416 rho transcription termination factor Rho; Provisio 97.57
PRK00440319 rfc replication factor C small subunit; Reviewed 97.53
PRK06620214 hypothetical protein; Validated 97.53
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 97.52
COG0593408 DnaA ATPase involved in DNA replication initiation 97.5
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 97.45
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 97.45
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 97.42
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 97.42
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 97.41
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 97.39
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 97.35
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 97.33
PRK08116268 hypothetical protein; Validated 97.33
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 97.33
PRK04132846 replication factor C small subunit; Provisional 97.3
PRK08769319 DNA polymerase III subunit delta'; Validated 97.3
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 97.28
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 97.26
PF14516331 AAA_35: AAA-like domain 97.25
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 97.23
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 97.18
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 97.15
CHL00181287 cbbX CbbX; Provisional 97.14
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 97.09
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 97.09
PF00004132 AAA: ATPase family associated with various cellula 97.09
TIGR00767415 rho transcription termination factor Rho. Members 97.07
PRK07993334 DNA polymerase III subunit delta'; Validated 97.04
PRK06871325 DNA polymerase III subunit delta'; Validated 97.03
PRK03992389 proteasome-activating nucleotidase; Provisional 97.03
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 97.03
PRK06090319 DNA polymerase III subunit delta'; Validated 96.99
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 96.97
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 96.96
smart00382148 AAA ATPases associated with a variety of cellular 96.9
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 96.9
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 96.87
COG3899 849 Predicted ATPase [General function prediction only 96.85
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 96.84
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 96.82
CHL00176638 ftsH cell division protein; Validated 96.81
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 96.8
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 96.8
PRK07399314 DNA polymerase III subunit delta'; Validated 96.79
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 96.77
PHA02544316 44 clamp loader, small subunit; Provisional 96.73
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 96.72
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 96.68
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 96.66
PRK08181269 transposase; Validated 96.62
PRK06964342 DNA polymerase III subunit delta'; Validated 96.54
PRK06921266 hypothetical protein; Provisional 96.47
PRK12377248 putative replication protein; Provisional 96.45
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 96.43
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 96.37
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 96.36
PRK06526254 transposase; Provisional 96.34
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 96.34
PRK08058329 DNA polymerase III subunit delta'; Validated 96.31
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 96.24
PRK09183259 transposase/IS protein; Provisional 96.22
PRK12608380 transcription termination factor Rho; Provisional 96.2
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 96.13
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 96.11
PRK07952244 DNA replication protein DnaC; Validated 96.1
PRK08699325 DNA polymerase III subunit delta'; Validated 96.07
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 96.06
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 96.06
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 95.96
PRK10536262 hypothetical protein; Provisional 95.93
CHL00195489 ycf46 Ycf46; Provisional 95.93
PRK06835329 DNA replication protein DnaC; Validated 95.86
COG1484254 DnaC DNA replication protein [DNA replication, rec 95.81
PHA00729226 NTP-binding motif containing protein 95.8
PRK08939306 primosomal protein DnaI; Reviewed 95.77
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 95.76
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 95.67
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 95.67
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 95.66
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 95.63
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 95.59
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 95.59
KOG2543438 consensus Origin recognition complex, subunit 5 [R 95.54
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 95.5
PRK09361225 radB DNA repair and recombination protein RadB; Pr 95.49
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 95.43
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 95.42
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 95.32
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 95.27
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 95.23
TIGR02237209 recomb_radB DNA repair and recombination protein R 95.22
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 95.17
PRK10865857 protein disaggregation chaperone; Provisional 95.15
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 95.14
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 95.12
PRK04296190 thymidine kinase; Provisional 95.06
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 95.05
COG0470325 HolB ATPase involved in DNA replication [DNA repli 95.05
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 95.04
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 95.04
PRK08118167 topology modulation protein; Reviewed 95.04
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 95.01
cd00983325 recA RecA is a bacterial enzyme which has roles in 94.99
CHL00095 821 clpC Clp protease ATP binding subunit 94.94
PRK07276290 DNA polymerase III subunit delta'; Validated 94.92
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 94.9
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 94.88
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 94.86
cd01393226 recA_like RecA is a bacterial enzyme which has rol 94.85
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 94.75
TIGR02012321 tigrfam_recA protein RecA. This model describes or 94.75
PTZ00202550 tuzin; Provisional 94.67
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 94.66
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 94.58
PRK09354349 recA recombinase A; Provisional 94.57
PRK11331459 5-methylcytosine-specific restriction enzyme subun 94.57
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 94.48
cd01394218 radB RadB. The archaeal protein radB shares simila 94.46
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 94.46
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 94.46
PRK05541176 adenylylsulfate kinase; Provisional 94.45
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 94.42
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 94.42
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 94.41
PRK10865 857 protein disaggregation chaperone; Provisional 94.41
COG1618179 Predicted nucleotide kinase [Nucleotide transport 94.33
TIGR00763775 lon ATP-dependent protease La. This protein is ind 94.26
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 94.15
COG2255332 RuvB Holliday junction resolvasome, helicase subun 94.1
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 94.08
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 94.05
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 93.99
PRK07261171 topology modulation protein; Provisional 93.99
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 93.87
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 93.8
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 93.69
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 93.62
PRK06762166 hypothetical protein; Provisional 93.56
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 93.55
PF00006215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 93.52
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 93.43
COG4088261 Predicted nucleotide kinase [Nucleotide transport 93.41
PRK12597461 F0F1 ATP synthase subunit beta; Provisional 93.36
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 93.29
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 93.25
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 93.23
PF00154322 RecA: recA bacterial DNA recombination protein; In 93.22
PRK06067234 flagellar accessory protein FlaH; Validated 93.17
CHL00095821 clpC Clp protease ATP binding subunit 93.16
PRK09280463 F0F1 ATP synthase subunit beta; Validated 93.16
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 93.08
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 93.05
PF10443431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 92.96
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 92.93
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 92.92
cd03115173 SRP The signal recognition particle (SRP) mediates 92.9
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 92.88
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 92.86
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 92.71
TIGR01039461 atpD ATP synthase, F1 beta subunit. The sequences 92.71
PRK07132299 DNA polymerase III subunit delta'; Validated 92.58
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 92.51
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 92.45
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 92.38
PRK08233182 hypothetical protein; Provisional 92.34
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 92.26
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 92.22
KOG2228408 consensus Origin recognition complex, subunit 4 [R 92.2
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 92.18
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 92.16
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 92.12
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 92.12
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 92.11
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 92.07
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 92.06
PRK04328249 hypothetical protein; Provisional 91.99
PRK08533230 flagellar accessory protein FlaH; Reviewed 91.91
KOG0731774 consensus AAA+-type ATPase containing the peptidas 91.91
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 91.68
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 91.67
COG2884223 FtsE Predicted ATPase involved in cell division [C 91.64
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 91.63
PRK04301317 radA DNA repair and recombination protein RadA; Va 91.47
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 91.35
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 91.31
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 91.29
PRK10867433 signal recognition particle protein; Provisional 91.21
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 91.16
PF07726131 AAA_3: ATPase family associated with various cellu 91.13
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 91.05
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 91.04
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 90.96
PRK00771437 signal recognition particle protein Srp54; Provisi 90.94
KOG1514767 consensus Origin recognition complex, subunit 1, a 90.93
PRK03839180 putative kinase; Provisional 90.89
PF07015231 VirC1: VirC1 protein; InterPro: IPR009744 This fam 90.88
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 90.73
TIGR00959428 ffh signal recognition particle protein. This mode 90.6
TIGR02236310 recomb_radA DNA repair and recombination protein R 90.56
KOG1969 877 consensus DNA replication checkpoint protein CHL12 90.56
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 90.53
KOG3022300 consensus Predicted ATPase, nucleotide-binding [Ce 90.46
cd03216163 ABC_Carb_Monos_I This family represents the domain 90.37
COG1192259 Soj ATPases involved in chromosome partitioning [C 90.35
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 90.31
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 90.28
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 90.28
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 90.28
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 90.24
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 90.24
PRK09519 790 recA DNA recombination protein RecA; Reviewed 90.17
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 90.16
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 90.14
PRK10875615 recD exonuclease V subunit alpha; Provisional 90.04
cd03246173 ABCC_Protease_Secretion This family represents the 90.02
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 90.01
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 90.01
CHL00060494 atpB ATP synthase CF1 beta subunit 90.0
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 89.91
PRK00625173 shikimate kinase; Provisional 89.86
PRK11823446 DNA repair protein RadA; Provisional 89.76
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 89.72
COG5635 824 Predicted NTPase (NACHT family) [Signal transducti 89.65
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 89.64
PRK08972444 fliI flagellum-specific ATP synthase; Validated 89.58
PTZ00088229 adenylate kinase 1; Provisional 89.58
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 89.55
PRK05917290 DNA polymerase III subunit delta'; Validated 89.54
PRK12678672 transcription termination factor Rho; Provisional 89.52
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 89.52
PRK13947171 shikimate kinase; Provisional 89.47
PRK14974336 cell division protein FtsY; Provisional 89.38
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 89.38
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 89.22
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 89.18
PRK05922434 type III secretion system ATPase; Validated 89.18
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 89.16
PRK00131175 aroK shikimate kinase; Reviewed 89.16
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 89.16
PF01656195 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai 89.11
CHL00206 2281 ycf2 Ycf2; Provisional 88.99
CHL00059485 atpA ATP synthase CF1 alpha subunit 88.79
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 88.77
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 88.75
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 88.65
cd02034116 CooC The accessory protein CooC, which contains a 88.62
PHA02518211 ParA-like protein; Provisional 88.6
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 88.59
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 88.56
PTZ00301210 uridine kinase; Provisional 88.52
TIGR02239316 recomb_RAD51 DNA repair protein RAD51. This eukary 88.49
PRK06002450 fliI flagellum-specific ATP synthase; Validated 88.46
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 88.43
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptatio 88.43
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 88.38
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 88.37
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 88.36
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 88.36
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 88.34
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 88.33
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 88.16
KOG0736953 consensus Peroxisome assembly factor 2 containing 88.16
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 88.14
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 88.03
TIGR01817534 nifA Nif-specific regulatory protein. This model r 88.02
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 87.84
TIGR03324497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a 87.84
cd02036179 MinD Bacterial cell division requires the formatio 87.79
PTZ00035337 Rad51 protein; Provisional 87.7
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 87.58
cd01124187 KaiC KaiC is a circadian clock protein primarily f 87.55
PRK09302509 circadian clock protein KaiC; Reviewed 87.51
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 87.47
TIGR03496411 FliI_clade1 flagellar protein export ATPase FliI. 87.46
PF1324576 AAA_19: Part of AAA domain 87.42
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 87.41
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 87.39
TIGR00064272 ftsY signal recognition particle-docking protein F 87.27
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 87.26
COG1149284 MinD superfamily P-loop ATPase containing an inser 87.14
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 87.13
PRK06936439 type III secretion system ATPase; Provisional 87.13
PRK06217183 hypothetical protein; Validated 86.99
PRK13233275 nifH nitrogenase reductase; Reviewed 86.95
PLN03186342 DNA repair protein RAD51 homolog; Provisional 86.9
cd03282204 ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS 86.85
PRK09281502 F0F1 ATP synthase subunit alpha; Validated 86.7
COG1157441 FliI Flagellar biosynthesis/type III secretory pat 86.69
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 86.66
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 86.64
TIGR00962501 atpA proton translocating ATP synthase, F1 alpha s 86.62
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 86.6
cd01136326 ATPase_flagellum-secretory_path_III Flagellum-spec 86.54
PF06564243 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p 86.49
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 86.38
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 86.35
cd03111106 CpaE_like This protein family consists of proteins 86.34
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 86.23
PRK06696223 uridine kinase; Validated 86.14
PRK08927442 fliI flagellum-specific ATP synthase; Validated 86.1
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 86.07
PRK08149428 ATP synthase SpaL; Validated 86.04
PRK13849231 putative crown gall tumor protein VirC1; Provision 86.03
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 86.03
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 86.02
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 86.01
TIGR02974329 phageshock_pspF psp operon transcriptional activat 86.0
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 85.97
cd01134369 V_A-ATPase_A V/A-type ATP synthase catalytic subun 85.94
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 85.9
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 85.87
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 85.86
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 85.81
PTZ00185574 ATPase alpha subunit; Provisional 85.8
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 85.78
PRK13343502 F0F1 ATP synthase subunit alpha; Provisional 85.77
PRK14526211 adenylate kinase; Provisional 85.74
PRK13975196 thymidylate kinase; Provisional 85.73
PRK06793432 fliI flagellum-specific ATP synthase; Validated 85.68
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 85.59
PRK06547172 hypothetical protein; Provisional 85.57
PRK13231264 nitrogenase reductase-like protein; Reviewed 85.57
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 85.55
TIGR01281268 DPOR_bchL light-independent protochlorophyllide re 85.54
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 85.54
PF08303168 tRNA_lig_kinase: tRNA ligase kinase domain; InterP 85.47
PRK13946184 shikimate kinase; Provisional 85.46
TIGR01041458 ATP_syn_B_arch ATP synthase archaeal, B subunit. A 85.42
PRK13949169 shikimate kinase; Provisional 85.42
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 85.31
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 85.29
PRK00889175 adenylylsulfate kinase; Provisional 85.23
PRK13948182 shikimate kinase; Provisional 85.17
PRK10037250 cell division protein; Provisional 85.13
TIGR03498418 FliI_clade3 flagellar protein export ATPase FliI. 85.07
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 85.04
TIGR01969251 minD_arch cell division ATPase MinD, archaeal. Thi 85.03
PRK11545163 gntK gluconate kinase 1; Provisional 85.03
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 85.02
PRK05973237 replicative DNA helicase; Provisional 84.93
PRK04040188 adenylate kinase; Provisional 84.82
smart00487201 DEXDc DEAD-like helicases superfamily. 84.79
PF07088484 GvpD: GvpD gas vesicle protein; InterPro: IPR00978 84.78
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 84.76
PRK03846198 adenylylsulfate kinase; Provisional 84.75
PRK13833323 conjugal transfer protein TrbB; Provisional 84.73
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 84.71
cd02040270 NifH NifH gene encodes component II (iron protein) 84.66
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 84.65
PRK03731171 aroL shikimate kinase II; Reviewed 84.63
PRK07667193 uridine kinase; Provisional 84.61
PRK05480209 uridine/cytidine kinase; Provisional 84.61
COG2842297 Uncharacterized ATPase, putative transposase [Gene 84.59
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 84.51
PRK05595444 replicative DNA helicase; Provisional 84.49
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 84.48
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 84.44
TIGR00665434 DnaB replicative DNA helicase. This model describe 84.36
cd02032267 Bchl_like This family of proteins contains bchL an 84.34
TIGR00235207 udk uridine kinase. Model contains a number of lon 84.34
PRK07594433 type III secretion system ATPase SsaN; Validated 84.22
TIGR01040466 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th 84.13
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 84.12
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 84.03
PRK13230279 nitrogenase reductase-like protein; Reviewed 83.81
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 83.81
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 83.77
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 83.75
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 83.74
PRK11608326 pspF phage shock protein operon transcriptional ac 83.51
PRK13764602 ATPase; Provisional 83.46
cd03110179 Fer4_NifH_child This protein family's function is 83.46
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 83.42
COG0703172 AroK Shikimate kinase [Amino acid transport and me 83.42
PF02374305 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ 83.41
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 83.4
PRK05057172 aroK shikimate kinase I; Reviewed 83.4
KOG2383467 consensus Predicted ATPase [General function predi 83.39
PRK13894319 conjugal transfer ATPase TrbB; Provisional 83.31
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 83.25
PRK13185270 chlL protochlorophyllide reductase iron-sulfur ATP 83.24
PRK10646153 ADP-binding protein; Provisional 83.23
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 83.18
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein Y 83.03
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 83.01
COG3265161 GntK Gluconate kinase [Carbohydrate transport and 82.91
TIGR03497413 FliI_clade2 flagellar protein export ATPase FliI. 82.86
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 82.85
COG0055468 AtpD F0F1-type ATP synthase, beta subunit [Energy 82.83
PRK09099441 type III secretion system ATPase; Provisional 82.78
COG1485367 Predicted ATPase [General function prediction only 82.78
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 82.72
PRK14532188 adenylate kinase; Provisional 82.71
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 82.67
TIGR02533486 type_II_gspE general secretory pathway protein E. 82.65
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 82.65
cd03287222 ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS 82.54
PRK04196460 V-type ATP synthase subunit B; Provisional 82.38
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 82.37
PRK09165497 replicative DNA helicase; Provisional 82.35
COG3910233 Predicted ATPase [General function prediction only 82.27
TIGR01287275 nifH nitrogenase iron protein. This model describe 82.26
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 82.22
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 82.22
PRK05022509 anaerobic nitric oxide reductase transcription reg 82.2
PRK14529223 adenylate kinase; Provisional 82.14
COG0003322 ArsA Predicted ATPase involved in chromosome parti 82.13
TIGR01968261 minD_bact septum site-determining protein MinD. Th 82.09
PRK13235274 nifH nitrogenase reductase; Reviewed 82.07
PRK13232273 nifH nitrogenase reductase; Reviewed 81.99
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 81.94
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 81.9
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 81.86
PRK12339197 2-phosphoglycerate kinase; Provisional 81.85
cd03285222 ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS 81.83
PRK06761282 hypothetical protein; Provisional 81.72
COG0488530 Uup ATPase components of ABC transporters with dup 81.68
cd02117212 NifH_like This family contains the NifH (iron prot 81.46
PRK14530215 adenylate kinase; Provisional 81.28
TIGR01026440 fliI_yscN ATPase FliI/YscN family. This family of 81.19
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 81.13
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 80.93
PRK05688451 fliI flagellum-specific ATP synthase; Validated 80.87
COG0802149 Predicted ATPase or kinase [General function predi 80.81
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t 80.7
KOG0734752 consensus AAA+-type ATPase containing the peptidas 80.63
PRK04182180 cytidylate kinase; Provisional 80.6
PRK15453290 phosphoribulokinase; Provisional 80.45
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 80.44
PRK08472434 fliI flagellum-specific ATP synthase; Validated 80.43
PRK08506472 replicative DNA helicase; Provisional 80.39
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 80.23
PRK06820440 type III secretion system ATPase; Validated 80.14
PRK07721438 fliI flagellum-specific ATP synthase; Validated 80.11
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 80.11
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=3.8e-33  Score=287.31  Aligned_cols=214  Identities=23%  Similarity=0.235  Sum_probs=184.4

Q ss_pred             CCCCcHHHHHHHHHc--h-hccccccceEEecchhhcccccCHHHHHHHHHHHHhhccc-cCccchhhhHHHHHHHhcCc
Q 040234            1 MGGLGKTTLARVVYD--L-ISHEFDGSSFLADVREKCDKEGSVISLQKQLLSDLLKLAD-NNIRNVYDGINMLRVRLRRK   76 (377)
Q Consensus         1 mgGiGKTtLA~~v~~--~-~~~~f~~~~w~~~~~~~~~~~~~~~~~~~~i~~~l~~~~~-~~~~~~~~~~~~l~~~l~~k   76 (377)
                      |||+||||||+++++  . ++.+|+..+|++ ||+.+    +...++.+|+..++.... ....+.++.+..+.+.|.++
T Consensus       187 MGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~-VSk~f----~~~~iq~~Il~~l~~~~~~~~~~~~~~~~~~i~~~L~~k  261 (889)
T KOG4658|consen  187 MGGVGKTTLARQIFNKFDEVGNHFDGVIWVV-VSKEF----TTRKIQQTILERLGLLDEEWEDKEEDELASKLLNLLEGK  261 (889)
T ss_pred             CCcccHHHHHHHHhcccchhcccCceEEEEE-Ecccc----cHHhHHHHHHHHhccCCcccchhhHHHHHHHHHHHhccC
Confidence            899999999999999  3 889999999999 99988    999999999999876322 22234478889999999999


Q ss_pred             eEEEEEeCCCChhhhhHhhCCCCCCCCCCeEEEEecchhHHhh-CCCCCeeecCCCChhhhHHHHHHHhcCC-CCCchhH
Q 040234           77 KVLVVIDDAAHPDHLRRLVGEPDWFGPGSRIIITTRNEHLLKL-HPVKKVYKLEALTYDEAFRLLCLKAFDT-HKPLEEY  154 (377)
Q Consensus        77 ~~LLVLDdv~~~~~~~~l~~~l~~~~~gs~IIvTTR~~~v~~~-~~~~~~~~l~~L~~~ea~~L~~~~~~~~-~~~~~~~  154 (377)
                      |+||||||||+..+|+.+..++|....||+|++|||++.|+.. +++...++++.|+++|||+||.+.++.. ...++..
T Consensus       262 rfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i  341 (889)
T KOG4658|consen  262 RFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDI  341 (889)
T ss_pred             ceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccccccccCccccHHHHHHhhccccccccccH
Confidence            9999999999999999999999988889999999999999998 7778899999999999999999999876 4455668


Q ss_pred             HHHHHHHHHHhCCCCchhhHHHHHhhhhchh-HHHHHHHHHhhccC-----chhHHHHHHHHHhhcccCCCCC
Q 040234          155 VELAESVVRICHCQKSTLNALMSVSYTVSHL-LLTLCLKLMQYMLC-----PFILFVYLLFFSVGLQNMPPSD  221 (377)
Q Consensus       155 ~~~~~~I~~~c~G~~lplal~~~~~~l~~~~-~~~~~~~L~~~~~~-----~~~~~~~~~~l~~Sy~~L~~~~  221 (377)
                      +++|++++++|+|  ||||+.++|+.+..+. ..+|....+.....     +.....+..++.+||+.||+.-
T Consensus       342 ~~lak~v~~kC~G--LPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~l  412 (889)
T KOG4658|consen  342 EELAKEVAEKCGG--LPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEEL  412 (889)
T ss_pred             HHHHHHHHHHhCC--hHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhHHH
Confidence            9999999999999  9999999999998765 44677775544222     2335689999999999999544



>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>KOG3022 consensus Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>CHL00060 atpB ATP synthase CF1 beta subunit Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG5635 Predicted NTPase (NACHT family) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>CHL00059 atpA ATP synthase CF1 alpha subunit Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK13233 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes Back     alignment and domain information
>PRK09281 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein Back     alignment and domain information
>PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK13343 F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK13231 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases [] Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK10037 cell division protein; Provisional Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>TIGR01969 minD_arch cell division ATPase MinD, archaeal Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF07088 GvpD: GvpD gas vesicle protein; InterPro: IPR009788 This family consists of several archaeal GvpD gas vesicle proteins Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>COG2842 Uncharacterized ATPase, putative transposase [General function prediction only] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK13230 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>KOG2383 consensus Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03497 FliI_clade2 flagellar protein export ATPase FliI Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG0055 AtpD F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes Back     alignment and domain information
>PRK04196 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>COG3910 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01968 minD_bact septum site-determining protein MinD Back     alignment and domain information
>PRK13235 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK13232 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG0802 Predicted ATPase or kinase [General function prediction only] Back     alignment and domain information
>TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK08472 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK06820 type III secretion system ATPase; Validated Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query377
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-26
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 3e-25
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 4e-25
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 1e-10
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score =  110 bits (276), Expect = 2e-26
 Identities = 69/451 (15%), Positives = 144/451 (31%), Gaps = 133/451 (29%)

Query: 1   MGGLGKTTLARVVY--DLISHEFDGSSFLADVREKCDKEGSVISLQKQLLSDL---LKLA 55
           + G GKT +A  V     +  + D   F  +++  C+   +V+ + ++LL  +       
Sbjct: 158 VLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLK-NCNSPETVLEMLQKLLYQIDPNWTSR 216

Query: 56  DNNIRNVYDGINMLRVRLRR-------KKVLVVIDDAAHPDHLRRLVGEPDWFGPGSRII 108
            ++  N+   I+ ++  LRR       +  L+V+ +  +           + F    +I+
Sbjct: 217 SDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQNAKAW-------NAFNLSCKIL 269

Query: 109 ITTRNEHLLKLHPVKKVYKL------EALTYDEAFRLLCLKAFDTHKPLEEYVELAESVV 162
           +TTR + +           +        LT DE   LL LK  D         +L   V+
Sbjct: 270 LTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLL-LKYLDC-----RPQDLPREVL 323

Query: 163 RICHCQKSTLNALMSVSYTVSHLLLTLCLKLMQYMLCPFILFVYLLF------FSVGLQN 216
                               +   L++  + ++  L  +  + ++            L  
Sbjct: 324 TT------------------NPRRLSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNV 365

Query: 217 MPPSDKYGNMHSPQREY----SIVVPGSEIPE------WFEYQNNEGSSITISTPPKTYK 266
           + P++         R+     S+  P + IP       WF+   ++   +          
Sbjct: 366 LEPAE--------YRKMFDRLSVFPPSAHIPTILLSLIWFDVIKSDVMVVV--------- 408

Query: 267 NSKLVGYVVCCVFRVPKYSLPYYHPLW--------PQYPVHELSINRKGTTSGLCS---- 314
            +KL  Y    V + PK S      ++         +Y +H   ++         S    
Sbjct: 409 -NKLHKY--SLVEKQPKESTISIPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLI 465

Query: 315 -------IY------LRKQFGQAMSDHLF--LYY-----QNRERISKVTFDSPSGLV--- 351
                   Y      L K         LF  ++      + + R     +++   ++   
Sbjct: 466 PPYLDQYFYSHIGHHL-KNIEHPERMTLFRMVFLDFRFLEQKIRHDSTAWNASGSILNTL 524

Query: 352 --LKR-----CGVHPIYVHQGDKLTKQLIPF 375
             LK      C   P Y    ++L   ++ F
Sbjct: 525 QQLKFYKPYICDNDPKY----ERLVNAILDF 551


>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query377
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.96
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.93
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.91
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.89
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.22
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 99.09
2fna_A357 Conserved hypothetical protein; structural genomic 99.01
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 98.89
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 98.89
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 98.89
2v1u_A387 Cell division control protein 6 homolog; DNA repli 98.85
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 98.78
2chg_A226 Replication factor C small subunit; DNA-binding pr 98.68
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 98.37
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 98.21
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.11
2chq_A319 Replication factor C small subunit; DNA-binding pr 98.1
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 98.07
3bos_A242 Putative DNA replication factor; P-loop containing 98.0
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 97.96
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 97.87
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 97.85
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 97.84
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 97.67
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 97.6
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 97.58
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 97.55
3pvs_A447 Replication-associated recombination protein A; ma 97.54
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 97.5
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 97.49
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 97.46
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 97.45
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 97.45
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 97.4
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 97.36
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 97.35
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 97.34
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.28
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 97.28
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.23
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.14
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 97.09
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 97.05
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 96.98
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 96.98
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 96.74
2gno_A305 DNA polymerase III, gamma subunit-related protein; 96.7
2r62_A268 Cell division protease FTSH homolog; ATPase domain 96.49
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 96.3
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 96.26
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.22
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 96.17
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 96.15
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.12
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 96.06
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.06
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 96.06
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 95.99
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 95.98
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 95.97
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 95.93
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 95.87
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 95.87
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 95.78
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 95.68
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 95.68
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 95.55
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 95.53
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 95.47
2cvh_A220 DNA repair and recombination protein RADB; filamen 95.27
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 95.17
1ojl_A304 Transcriptional regulatory protein ZRAR; response 95.14
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 95.13
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 95.08
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 95.07
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 95.05
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 94.73
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 94.67
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 94.66
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 94.3
3co5_A143 Putative two-component system transcriptional RES 94.28
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 94.18
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 93.94
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 93.48
1xp8_A366 RECA protein, recombinase A; recombination, radior 93.43
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 93.39
3ice_A422 Transcription termination factor RHO; transcriptio 93.21
3io5_A333 Recombination and repair protein; storage dimer, i 93.17
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 93.17
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 93.14
2qgz_A308 Helicase loader, putative primosome component; str 92.84
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 92.83
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 92.8
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 92.79
2ck3_D482 ATP synthase subunit beta\, mitochondrial; hydrola 92.47
4a74_A231 DNA repair and recombination protein RADA; hydrola 92.42
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 92.33
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 92.31
2z43_A324 DNA repair and recombination protein RADA; archaea 92.15
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 92.12
1u94_A356 RECA protein, recombinase A; homologous recombinat 91.87
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 91.8
1fx0_B498 ATP synthase beta chain; latent ATPase, thermal st 91.65
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 91.65
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 91.43
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 91.3
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 90.95
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 90.74
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 90.64
3l0o_A427 Transcription termination factor RHO; helicase, RH 90.58
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 90.35
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 90.04
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 89.89
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 89.85
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 89.85
1vma_A306 Cell division protein FTSY; TM0570, structural gen 89.74
3vr4_D465 V-type sodium ATPase subunit D; V-ATPase, rotary m 89.71
2eyu_A261 Twitching motility protein PILT; pilus retraction 89.68
2r6a_A454 DNAB helicase, replicative helicase; replication, 89.28
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 89.22
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 89.21
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 88.82
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 88.82
3vaa_A199 Shikimate kinase, SK; structural genomics, center 88.71
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 88.54
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 88.51
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 88.22
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 87.96
1fx0_A507 ATP synthase alpha chain; latent ATPase, thermal s 87.89
2c61_A469 A-type ATP synthase non-catalytic subunit B; hydro 87.88
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 87.86
1via_A175 Shikimate kinase; structural genomics, transferase 87.78
3oaa_A513 ATP synthase subunit alpha; rossmann fold, hydrola 87.5
3gqb_B464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 87.36
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 87.3
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 87.21
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 87.16
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 87.08
2ck3_A510 ATP synthase subunit alpha\, mitochondrial; hydrol 87.07
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 86.97
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 86.72
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 86.68
3cwq_A209 Para family chromosome partitioning protein; alpha 86.5
1kag_A173 SKI, shikimate kinase I; transferase, structural g 86.44
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 86.37
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 86.19
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 86.15
2qe7_A502 ATP synthase subunit alpha; blockage of ATP hydrol 86.04
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 85.5
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 85.44
2ewv_A372 Twitching motility protein PILT; pilus retraction 85.31
2r9v_A515 ATP synthase subunit alpha; TM1612, structural gen 85.29
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 85.29
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 85.14
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 85.1
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 85.05
2vli_A183 Antibiotic resistance protein; transferase, tunica 85.04
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 84.96
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 84.78
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 84.73
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 84.64
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 84.63
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 84.4
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 84.26
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 84.22
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 83.97
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 83.91
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 83.77
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 83.76
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 83.63
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 83.48
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 83.44
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 83.21
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 83.2
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 83.14
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 83.06
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 82.93
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 82.78
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 82.74
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 82.69
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 82.68
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 82.62
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 82.5
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 82.36
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 82.24
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 82.24
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 82.21
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 82.14
2xxa_A433 Signal recognition particle protein; protein trans 82.01
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 81.98
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 81.84
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 81.83
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 81.79
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 81.74
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 81.71
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 81.63
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 81.55
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 81.49
3end_A307 Light-independent protochlorophyllide reductase ir 81.35
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 81.24
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 81.21
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 81.0
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 81.0
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 80.99
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 80.9
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 80.88
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 80.7
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 80.54
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 80.46
1xjc_A169 MOBB protein homolog; structural genomics, midwest 80.45
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 80.43
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 80.27
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 80.19
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 80.14
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 80.14
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 80.11
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 80.09
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=99.96  E-value=3.4e-30  Score=257.52  Aligned_cols=207  Identities=16%  Similarity=0.154  Sum_probs=155.9

Q ss_pred             CCCCcHHHHHHHHHc----hhccccccceEEecchhhcccccCHHHHHHHHHHHHhhccc-cCc-----cchhhhHHHHH
Q 040234            1 MGGLGKTTLARVVYD----LISHEFDGSSFLADVREKCDKEGSVISLQKQLLSDLLKLAD-NNI-----RNVYDGINMLR   70 (377)
Q Consensus         1 mgGiGKTtLA~~v~~----~~~~~f~~~~w~~~~~~~~~~~~~~~~~~~~i~~~l~~~~~-~~~-----~~~~~~~~~l~   70 (377)
                      |||+||||||+++|+    +++.+|+.++|++ +++... . ++..++..++.+++.... ...     .+.+.+...++
T Consensus       160 ~gGvGKTtLA~~v~~~~~~~~~~~F~~~~wv~-vs~~~~-~-~~~~~~~~il~~l~~~~~~~~~~~~~~~~~~~l~~~l~  236 (549)
T 2a5y_B          160 RAGSGKSVIASQALSKSDQLIGINYDSIVWLK-DSGTAP-K-STFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMIC  236 (549)
T ss_dssp             STTSSHHHHHHHHHHHCSSTBTTTBSEEEEEE-CCCCST-T-HHHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHhhhHHHhccCCcEEEEE-ECCCCC-C-CHHHHHHHHHHHHhcCcccccccccccccHHHHHHHHH
Confidence            799999999999995    7899999999996 776532 1 678999999999876422 111     23344688999


Q ss_pred             HHhcCc-eEEEEEeCCCChhhhhHhhCCCCCCCCCCeEEEEecchhHHhhCC-CCCeeecCCCChhhhHHHHHHHhcCCC
Q 040234           71 VRLRRK-KVLVVIDDAAHPDHLRRLVGEPDWFGPGSRIIITTRNEHLLKLHP-VKKVYKLEALTYDEAFRLLCLKAFDTH  148 (377)
Q Consensus        71 ~~l~~k-~~LLVLDdv~~~~~~~~l~~~l~~~~~gs~IIvTTR~~~v~~~~~-~~~~~~l~~L~~~ea~~L~~~~~~~~~  148 (377)
                      +.|+++ |+||||||||+.+++ .+. .    .+||+||||||++.++..+. ....++|++|++++|++||.++++...
T Consensus       237 ~~L~~~kr~LlVLDdv~~~~~~-~~~-~----~~gs~ilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~a~~~~  310 (549)
T 2a5y_B          237 NALIDRPNTLFVFDDVVQEETI-RWA-Q----ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMP  310 (549)
T ss_dssp             HHHTTSTTEEEEEEEECCHHHH-HHH-H----HTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC
T ss_pred             HHHcCCCcEEEEEECCCCchhh-ccc-c----cCCCEEEEEcCCHHHHHHcCCCCeEEECCCCCHHHHHHHHHHHhcCCC
Confidence            999996 999999999998865 222 1    37999999999999988775 446799999999999999999987653


Q ss_pred             CCchhHHHHHHHHHHHhCCCCchhhHHHHHhhhhchhHHHHHHHHHhhccCchhHHHHHHHHHhhcccCCCCC
Q 040234          149 KPLEEYVELAESVVRICHCQKSTLNALMSVSYTVSHLLLTLCLKLMQYMLCPFILFVYLLFFSVGLQNMPPSD  221 (377)
Q Consensus       149 ~~~~~~~~~~~~I~~~c~G~~lplal~~~~~~l~~~~~~~~~~~L~~~~~~~~~~~~~~~~l~~Sy~~L~~~~  221 (377)
                      . .+.+.+++++|+++|||  +|||++++|+.+..+. .++...+...... .....+.+++.+||+.||+..
T Consensus       311 ~-~~~~~~~~~~I~~~c~G--lPLAl~~~g~~l~~~~-w~~~~~l~~~l~~-~~~~~i~~~l~~Sy~~L~~~l  378 (549)
T 2a5y_B          311 V-GEKEEDVLNKTIELSSG--NPATLMMFFKSCEPKT-FEKMAQLNNKLES-RGLVGVECITPYSYKSLAMAL  378 (549)
T ss_dssp             ---CHHHHHHHHHHHHHTT--CHHHHHHHHTTCCSSS-HHHHHHHHHHHHH-HCSSTTCCCSSSSSSSHHHHH
T ss_pred             C-chhHHHHHHHHHHHhCC--ChHHHHHHHHHhccch-HHHHHHhHHHhhc-ccHHHHHHHHhcccccccHHH
Confidence            2 46778899999999999  9999999999987763 2333333221100 001235567778888876654



>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 377
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 1e-20
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
 Score = 88.3 bits (218), Expect = 1e-20
 Identities = 27/175 (15%), Positives = 54/175 (30%), Gaps = 18/175 (10%)

Query: 1   MGGLGKTTLARVVYD----LISHEFDGSSFLADVREKCDKEGSVISLQKQLLSDLLKLAD 56
             G GK+ +A         LI   +D   +L        K    +     L+        
Sbjct: 52  RAGSGKSVIASQALSKSDQLIGINYDSIVWL-KDSGTAPKSTFDLFTDILLMLKSEDDLL 110

Query: 57  N-----NIRNVYDGINMLRVRLRRKKVLVVIDDAAHPDHLRRLVGEPDWFGPGSRIIITT 111
           N     ++ +V     +    + R   L V DD    + +R             R ++TT
Sbjct: 111 NFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRW------AQELRLRCLVTT 164

Query: 112 RNEHLLK-LHPVKKVYKLEALTYDEAFRLLCLKAFDTHKPLEEYVELAESVVRIC 165
           R+  +        +  ++ +L  DE +  L           E+  ++    + + 
Sbjct: 165 RDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVG-EKEEDVLNKTIELS 218


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query377
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.97
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.42
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.02
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 97.94
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 97.89
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 97.89
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 97.82
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 97.79
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 97.78
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 97.65
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 97.65
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 97.48
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.42
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 97.28
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.25
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.12
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.08
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 97.05
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 96.8
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.73
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.73
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.72
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.56
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 95.14
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 94.8
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 94.58
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 94.28
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 94.23
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 94.16
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 94.15
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 93.95
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 93.93
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 93.73
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 93.6
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 93.24
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 93.15
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 92.98
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 92.68
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 92.63
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 92.57
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 92.49
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 92.19
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 91.79
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 91.74
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 91.74
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 91.59
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 91.58
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 91.41
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 91.33
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 90.93
d2qy9a2211 GTPase domain of the signal recognition particle r 90.71
d1xpua3289 Transcription termination factor Rho, ATPase domai 90.46
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 90.14
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 90.02
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 90.0
d1okkd2207 GTPase domain of the signal recognition particle r 89.9
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 89.26
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 89.25
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 89.24
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 89.24
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 88.92
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 88.91
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 88.74
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 88.38
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 88.27
d1ls1a2207 GTPase domain of the signal sequence recognition p 88.12
d1j8yf2211 GTPase domain of the signal sequence recognition p 88.07
d1vmaa2213 GTPase domain of the signal recognition particle r 87.95
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 87.62
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 87.59
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 87.56
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 87.54
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 87.41
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 87.33
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 87.14
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 86.95
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 86.92
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 86.83
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 86.5
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 85.86
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 85.47
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 85.23
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 84.83
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 84.81
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 84.59
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 84.58
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 84.28
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 84.23
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 84.18
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 84.12
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 84.03
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 83.89
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 83.75
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 83.39
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 81.84
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 81.39
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 81.28
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 81.26
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 81.03
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
Probab=99.97  E-value=7.3e-32  Score=244.19  Aligned_cols=205  Identities=13%  Similarity=0.087  Sum_probs=152.3

Q ss_pred             CCCCcHHHHHHHHHch----hccccccceEEecchhhcccccCHHHHHHHH---HHHHhhcccc------CccchhhhHH
Q 040234            1 MGGLGKTTLARVVYDL----ISHEFDGSSFLADVREKCDKEGSVISLQKQL---LSDLLKLADN------NIRNVYDGIN   67 (377)
Q Consensus         1 mgGiGKTtLA~~v~~~----~~~~f~~~~w~~~~~~~~~~~~~~~~~~~~i---~~~l~~~~~~------~~~~~~~~~~   67 (377)
                      |||+||||||++++++    ...+|+..+|+. +++.+    +...+...+   +..+......      ..........
T Consensus        52 mgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~-vs~~~----~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  126 (277)
T d2a5yb3          52 RAGSGKSVIASQALSKSDQLIGINYDSIVWLK-DSGTA----PKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRM  126 (277)
T ss_dssp             STTSSHHHHHHHHHHHCSSTBTTTBSEEEEEE-CCCCS----TTHHHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHhhhhhhhhcCceEEEEE-ecCCC----CHHHHHHHHHHHHHHhcchhhcCCccchhhhhHHHHHH
Confidence            8999999999999984    566688889988 66655    444444443   3332222111      1112223344


Q ss_pred             HHHHHhcCceEEEEEeCCCChhhhhHhhCCCCCCCCCCeEEEEecchhHHhhCCC-CCeeecCCCChhhhHHHHHHHhcC
Q 040234           68 MLRVRLRRKKVLVVIDDAAHPDHLRRLVGEPDWFGPGSRIIITTRNEHLLKLHPV-KKVYKLEALTYDEAFRLLCLKAFD  146 (377)
Q Consensus        68 ~l~~~l~~k~~LLVLDdv~~~~~~~~l~~~l~~~~~gs~IIvTTR~~~v~~~~~~-~~~~~l~~L~~~ea~~L~~~~~~~  146 (377)
                      .+.+.+.++++|+||||||+.++++.+..      .||+||||||++.++..+.. ...|+|++|+.+||++||.++++.
T Consensus       127 ~~~~~L~~kr~LlVLDDv~~~~~~~~~~~------~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~  200 (277)
T d2a5yb3         127 ICNALIDRPNTLFVFDDVVQEETIRWAQE------LRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMP  200 (277)
T ss_dssp             HHHHHTTSTTEEEEEEEECCHHHHHHHHH------TTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCC
T ss_pred             HHHHHhccCCeeEecchhhHHhhhhhhcc------cCceEEEEeehHHHHHhcCCCCceEECCCCCHHHHHHHHHHHhCC
Confidence            57778899999999999999999987753      47899999999999887654 367999999999999999998876


Q ss_pred             CCCCchhHHHHHHHHHHHhCCCCchhhHHHHHhhhhchhHHHHHHHHHhhccCchhHHHHHHHHHhhcccCCCCC
Q 040234          147 THKPLEEYVELAESVVRICHCQKSTLNALMSVSYTVSHLLLTLCLKLMQYMLCPFILFVYLLFFSVGLQNMPPSD  221 (377)
Q Consensus       147 ~~~~~~~~~~~~~~I~~~c~G~~lplal~~~~~~l~~~~~~~~~~~L~~~~~~~~~~~~~~~~l~~Sy~~L~~~~  221 (377)
                      ... .+..++++++|+++|||  +|||++++|+.+..+...+|....+++....  ...+.+++.+||+.||+.-
T Consensus       201 ~~~-~~~~~~~~~~iv~~c~G--lPLAl~~ig~~l~~k~~~~~~~~~~~L~~~~--~~~v~~il~~sY~~L~~~l  270 (277)
T d2a5yb3         201 MPV-GEKEEDVLNKTIELSSG--NPATLMMFFKSCEPKTFEKMAQLNNKLESRG--LVGVECITPYSYKSLAMAL  270 (277)
T ss_dssp             CC---CHHHHHHHHHHHHHTT--CHHHHHHHHTTCCSSSHHHHHHHHHHHHHHC--SSTTCCCSSSSSSSHHHHH
T ss_pred             ccC-chhhHHHHHHHHHHhCC--CHHHHHHHHHHhccCCHHHHHHHHHHHhcCc--HHHHHHHHHHHHhcccHHH
Confidence            543 34457889999999999  9999999999999888777766544443211  1247788889999998753



>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure