Citrus Sinensis ID: 040234
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 377 | ||||||
| 22947641 | 171 | putative citrus disease resistance prote | 0.429 | 0.947 | 0.598 | 4e-47 | |
| 22947648 | 172 | putative citrus disease resistance prote | 0.432 | 0.947 | 0.588 | 2e-46 | |
| 62361219 | 175 | resistance protein PLTR [Arachis hypogae | 0.432 | 0.931 | 0.490 | 1e-37 | |
| 255547494 | 1082 | TMV resistance protein N, putative [Rici | 0.480 | 0.167 | 0.469 | 3e-37 | |
| 222066084 | 174 | NBS-LLR resistance protein [Gossypium ar | 0.429 | 0.931 | 0.554 | 8e-37 | |
| 222066088 | 174 | NBS-LLR resistance protein [Gossypium ar | 0.429 | 0.931 | 0.554 | 9e-37 | |
| 399920191 | 1320 | TIR-NBS-LRR [Rosa rugosa] | 0.432 | 0.123 | 0.512 | 1e-36 | |
| 222066074 | 171 | NBS-LLR resistance protein [Gossypium ar | 0.429 | 0.947 | 0.554 | 1e-36 | |
| 332002068 | 173 | NBS-LRR-like protein [Malus baccata] | 0.456 | 0.994 | 0.480 | 2e-36 | |
| 22324566 | 176 | PR-protein [Capsicum annuum] | 0.429 | 0.920 | 0.460 | 4e-36 |
| >gi|22947641|gb|AAN08166.1| putative citrus disease resistance protein Pt6 [Citrus maxima x Citrus trifoliata] | Back alignment and taxonomy information |
|---|
Score = 195 bits (495), Expect = 4e-47, Method: Compositional matrix adjust.
Identities = 97/162 (59%), Positives = 123/162 (75%)
Query: 2 GGLGKTTLARVVYDLISHEFDGSSFLADVREKCDKEGSVISLQKQLLSDLLKLADNNIRN 61
GG+GKTTLARVVYDLISHEF+GSSFLADVREK + +GSVIS Q+QLL ++LK ++I N
Sbjct: 1 GGVGKTTLARVVYDLISHEFEGSSFLADVREKFENKGSVISFQRQLLFEILKFEKDSIWN 60
Query: 62 VYDGINMLRVRLRRKKVLVVIDDAAHPDHLRRLVGEPDWFGPGSRIIITTRNEHLLKLHP 121
V DGIN+L RL+ KKVL+VIDD L L G+ +WFG GSRII+T+R+EHLLK H
Sbjct: 61 VGDGINILGSRLQHKKVLLVIDDVVDIKQLEYLAGKREWFGSGSRIIVTSRDEHLLKTHG 120
Query: 122 VKKVYKLEALTYDEAFRLLCLKAFDTHKPLEEYVELAESVVR 163
+ ++YK L Y +A +L +KAF KPLEE V+L+E V+R
Sbjct: 121 MDEIYKPNELNYHDALQLFNMKAFKIQKPLEECVQLSEGVLR 162
|
Source: Citrus maxima x Citrus trifoliata Species: Citrus maxima x Citrus trifoliata Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|22947648|gb|AAN08167.1| putative citrus disease resistance protein Pt12 [Citrus maxima x Citrus trifoliata] | Back alignment and taxonomy information |
|---|
| >gi|62361219|gb|AAX81288.1| resistance protein PLTR [Arachis hypogaea] | Back alignment and taxonomy information |
|---|
| >gi|255547494|ref|XP_002514804.1| TMV resistance protein N, putative [Ricinus communis] gi|223545855|gb|EEF47358.1| TMV resistance protein N, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|222066084|emb|CAX28550.1| NBS-LLR resistance protein [Gossypium arboreum] | Back alignment and taxonomy information |
|---|
| >gi|222066088|emb|CAX28552.1| NBS-LLR resistance protein [Gossypium arboreum] gi|222066094|emb|CAX28555.1| NBS-LLR resistance protein [Gossypium arboreum] | Back alignment and taxonomy information |
|---|
| >gi|399920191|gb|AFP55538.1| TIR-NBS-LRR [Rosa rugosa] | Back alignment and taxonomy information |
|---|
| >gi|222066074|emb|CAX28545.1| NBS-LLR resistance protein [Gossypium arboreum] | Back alignment and taxonomy information |
|---|
| >gi|332002068|gb|AED99177.1| NBS-LRR-like protein [Malus baccata] | Back alignment and taxonomy information |
|---|
| >gi|22324566|gb|AAM95614.1|AF525138_1 PR-protein [Capsicum annuum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 377 | ||||||
| UNIPROTKB|Q40392 | 1144 | N "TMV resistance protein N" [ | 0.413 | 0.136 | 0.337 | 9.1e-19 | |
| TAIR|locus:2175991 | 1294 | AT5G17680 [Arabidopsis thalian | 0.275 | 0.080 | 0.390 | 2.2e-16 | |
| TAIR|locus:2205824 | 1384 | AT1G27170 [Arabidopsis thalian | 0.432 | 0.117 | 0.286 | 2e-15 | |
| TAIR|locus:2160487 | 1085 | AT5G41550 [Arabidopsis thalian | 0.222 | 0.077 | 0.369 | 8.8e-14 | |
| TAIR|locus:2156579 | 1190 | AT5G48770 [Arabidopsis thalian | 0.416 | 0.131 | 0.289 | 1.2e-13 | |
| TAIR|locus:2195468 | 1017 | AT1G63880 [Arabidopsis thalian | 0.222 | 0.082 | 0.380 | 1.4e-13 | |
| TAIR|locus:2164486 | 1104 | AT5G40910 [Arabidopsis thalian | 0.222 | 0.076 | 0.357 | 2.1e-13 | |
| TAIR|locus:2094498 | 1981 | AT3G25510 [Arabidopsis thalian | 0.220 | 0.041 | 0.421 | 2.3e-13 | |
| TAIR|locus:2175075 | 1068 | AT5G41750 [Arabidopsis thalian | 0.222 | 0.078 | 0.369 | 4.8e-13 | |
| TAIR|locus:2146228 | 1245 | AT5G18350 [Arabidopsis thalian | 0.220 | 0.066 | 0.373 | 5.3e-13 |
| UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] | Back alignment and assigned GO terms |
|---|
Score = 223 (83.6 bits), Expect = 9.1e-19, Sum P(2) = 9.1e-19
Identities = 57/169 (33%), Positives = 87/169 (51%)
Query: 1 MGGLGKTTLARVVYDLI------SHEFDGSSFLADVREKCDKEGSVIXXXXXXXXXXXXX 54
MGG+GKTT+AR ++D + S++FDG+ FL D++E +K G +
Sbjct: 217 MGGVGKTTIARAIFDTLLGRMDSSYQFDGACFLKDIKE--NKRG--MHSLQNALLSELLR 272
Query: 55 XXXXIRNVYDGINMXXXXXXXXXXXXXIDDAAHPDH-LRRLVGEPDWFGPGSRIIITTRN 113
N DG + +DD + DH L L G+ DWFG GSRIIITTR+
Sbjct: 273 EKANYNNEEDGKHQMASRLRSKKVLIVLDDIDNKDHYLEYLAGDLDWFGNGSRIIITTRD 332
Query: 114 EHLLKLHPVKKVYKLEALTYDEAFRLLCLKAFDTHKPLEEYVELAESVV 162
+HL++ + + +Y++ AL E+ +L AF P E + +L+ VV
Sbjct: 333 KHLIEKNDI--IYEVTALPDHESIQLFKQHAFGKEVPNENFEKLSLEVV 379
|
|
| TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2160487 AT5G41550 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2156579 AT5G48770 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2195468 AT1G63880 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2164486 AT5G40910 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2175075 AT5G41750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2146228 AT5G18350 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| gw1.I.3722.1 | tir-nbs-lrr resistance protein (524 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 377 | |||
| PLN03210 | 1153 | PLN03210, PLN03210, Resistant to P | 1e-23 | |
| pfam00931 | 285 | pfam00931, NB-ARC, NB-ARC domain | 2e-19 |
| >gnl|CDD|215633 PLN03210, PLN03210, Resistant to P | Back alignment and domain information |
|---|
Score = 102 bits (255), Expect = 1e-23
Identities = 53/169 (31%), Positives = 86/169 (50%), Gaps = 14/169 (8%)
Query: 3 GLGKTTLARVVYDLISHEFDGSSFLADV----------REKCDKEGSVISLQKQLLSDLL 52
G+GKTT+AR ++ +S +F S F+ D + LQ+ LS++L
Sbjct: 217 GIGKTTIARALFSRLSRQFQSSVFIDRAFISKSMEIYSSANPDDYNMKLHLQRAFLSEIL 276
Query: 53 KLADNNIRNVYDGINMLRVRLRRKKVLVVIDDAAHPDHLRRLVGEPDWFGPGSRIIITTR 112
D I + + RL+ +KVL+ IDD D L L G+ WFG GSRII+ T+
Sbjct: 277 DKKDIKI----YHLGAMEERLKHRKVLIFIDDLDDQDVLDALAGQTQWFGSGSRIIVITK 332
Query: 113 NEHLLKLHPVKKVYKLEALTYDEAFRLLCLKAFDTHKPLEEYVELAESV 161
++H L+ H + +Y++ + + A + C AF + P + ++ELA V
Sbjct: 333 DKHFLRAHGIDHIYEVCLPSNELALEMFCRSAFKKNSPPDGFMELASEV 381
|
syringae 6; Provisional. Length = 1153 |
| >gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 377 | |||
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 100.0 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 99.97 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.95 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.08 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 98.96 | |
| COG3903 | 414 | Predicted ATPase [General function prediction only | 98.93 | |
| PF05729 | 166 | NACHT: NACHT domain | 98.92 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 98.83 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 98.67 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 98.59 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 98.58 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 98.58 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 98.49 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 98.4 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 98.32 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 98.3 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 98.24 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 98.24 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 98.23 | |
| PF13173 | 128 | AAA_14: AAA domain | 98.19 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 98.17 | |
| PRK08727 | 233 | hypothetical protein; Validated | 98.17 | |
| PRK09087 | 226 | hypothetical protein; Validated | 98.17 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 98.1 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 98.08 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 98.01 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 98.0 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 97.99 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 97.95 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 97.95 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 97.94 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 97.93 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 97.93 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 97.92 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 97.91 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 97.91 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 97.9 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 97.88 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 97.86 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 97.86 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 97.86 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 97.85 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 97.84 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 97.84 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 97.79 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 97.78 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 97.77 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 97.77 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 97.75 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 97.73 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 97.71 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 97.71 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 97.7 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 97.69 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 97.69 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 97.67 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 97.67 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 97.64 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 97.62 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 97.62 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 97.61 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 97.6 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 97.59 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.58 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 97.57 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 97.53 | |
| PRK06620 | 214 | hypothetical protein; Validated | 97.53 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 97.52 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 97.5 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 97.45 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 97.45 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 97.42 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 97.42 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 97.41 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 97.39 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 97.35 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 97.33 | |
| PRK08116 | 268 | hypothetical protein; Validated | 97.33 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 97.33 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 97.3 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 97.3 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 97.28 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.26 | |
| PF14516 | 331 | AAA_35: AAA-like domain | 97.25 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 97.23 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 97.18 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 97.15 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 97.14 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 97.09 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 97.09 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 97.09 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 97.07 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 97.04 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 97.03 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 97.03 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 97.03 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 96.99 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 96.97 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 96.96 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 96.9 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 96.9 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 96.87 | |
| COG3899 | 849 | Predicted ATPase [General function prediction only | 96.85 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 96.84 | |
| cd01133 | 274 | F1-ATPase_beta F1 ATP synthase beta subunit, nucle | 96.82 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 96.81 | |
| COG1373 | 398 | Predicted ATPase (AAA+ superfamily) [General funct | 96.8 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 96.8 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 96.79 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 96.77 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 96.73 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 96.72 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 96.68 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 96.66 | |
| PRK08181 | 269 | transposase; Validated | 96.62 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 96.54 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 96.47 | |
| PRK12377 | 248 | putative replication protein; Provisional | 96.45 | |
| COG3267 | 269 | ExeA Type II secretory pathway, component ExeA (pr | 96.43 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 96.37 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 96.36 | |
| PRK06526 | 254 | transposase; Provisional | 96.34 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 96.34 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 96.31 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 96.24 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 96.22 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 96.2 | |
| KOG2227 | 529 | consensus Pre-initiation complex, subunit CDC6, AA | 96.13 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 96.11 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 96.1 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 96.07 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 96.06 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 96.06 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 95.96 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 95.93 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 95.93 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 95.86 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 95.81 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 95.8 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 95.77 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 95.76 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 95.67 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 95.67 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 95.66 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 95.63 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 95.59 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 95.59 | |
| KOG2543 | 438 | consensus Origin recognition complex, subunit 5 [R | 95.54 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 95.5 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 95.49 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 95.43 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 95.42 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 95.32 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 95.27 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 95.23 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 95.22 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 95.17 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 95.15 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 95.14 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 95.12 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 95.06 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 95.05 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 95.05 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 95.04 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 95.04 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 95.04 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 95.01 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 94.99 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 94.94 | |
| PRK07276 | 290 | DNA polymerase III subunit delta'; Validated | 94.92 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 94.9 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 94.88 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 94.86 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 94.85 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 94.75 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 94.75 | |
| PTZ00202 | 550 | tuzin; Provisional | 94.67 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 94.66 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 94.58 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 94.57 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 94.57 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 94.48 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 94.46 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 94.46 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 94.46 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 94.45 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 94.42 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 94.42 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 94.41 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 94.41 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 94.33 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 94.26 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 94.15 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 94.1 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 94.08 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 94.05 | |
| PF07693 | 325 | KAP_NTPase: KAP family P-loop domain; InterPro: IP | 93.99 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 93.99 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 93.87 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 93.8 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 93.69 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 93.62 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 93.56 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 93.55 | |
| PF00006 | 215 | ATP-synt_ab: ATP synthase alpha/beta family, nucle | 93.52 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 93.43 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 93.41 | |
| PRK12597 | 461 | F0F1 ATP synthase subunit beta; Provisional | 93.36 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 93.29 | |
| PF03969 | 362 | AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 | 93.25 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 93.23 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 93.22 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 93.17 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 93.16 | |
| PRK09280 | 463 | F0F1 ATP synthase subunit beta; Validated | 93.16 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 93.08 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 93.05 | |
| PF10443 | 431 | RNA12: RNA12 protein; InterPro: IPR018850 Mitochon | 92.96 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 92.93 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 92.92 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 92.9 | |
| cd01135 | 276 | V_A-ATPase_B V/A-type ATP synthase (non-catalytic) | 92.88 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 92.86 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 92.71 | |
| TIGR01039 | 461 | atpD ATP synthase, F1 beta subunit. The sequences | 92.71 | |
| PRK07132 | 299 | DNA polymerase III subunit delta'; Validated | 92.58 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 92.51 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 92.45 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 92.38 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 92.34 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 92.26 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 92.22 | |
| KOG2228 | 408 | consensus Origin recognition complex, subunit 4 [R | 92.2 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 92.18 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 92.16 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 92.12 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 92.12 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 92.11 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 92.07 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 92.06 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 91.99 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 91.91 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 91.91 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 91.68 | |
| PLN03187 | 344 | meiotic recombination protein DMC1 homolog; Provis | 91.67 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 91.64 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 91.63 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 91.47 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 91.35 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 91.31 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 91.29 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 91.21 | |
| TIGR03305 | 449 | alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit | 91.16 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 91.13 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 91.05 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 91.04 | |
| TIGR03575 | 340 | selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti | 90.96 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 90.94 | |
| KOG1514 | 767 | consensus Origin recognition complex, subunit 1, a | 90.93 | |
| PRK03839 | 180 | putative kinase; Provisional | 90.89 | |
| PF07015 | 231 | VirC1: VirC1 protein; InterPro: IPR009744 This fam | 90.88 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 90.73 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 90.6 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 90.56 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 90.56 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 90.53 | |
| KOG3022 | 300 | consensus Predicted ATPase, nucleotide-binding [Ce | 90.46 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 90.37 | |
| COG1192 | 259 | Soj ATPases involved in chromosome partitioning [C | 90.35 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 90.31 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 90.28 | |
| TIGR02238 | 313 | recomb_DMC1 meiotic recombinase Dmc1. This model d | 90.28 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 90.28 | |
| cd01132 | 274 | F1_ATPase_alpha F1 ATP synthase alpha, central dom | 90.24 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 90.24 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 90.17 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 90.16 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 90.14 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 90.04 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 90.02 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 90.01 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 90.01 | |
| CHL00060 | 494 | atpB ATP synthase CF1 beta subunit | 90.0 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 89.91 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 89.86 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 89.76 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 89.72 | |
| COG5635 | 824 | Predicted NTPase (NACHT family) [Signal transducti | 89.65 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 89.64 | |
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 89.58 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 89.58 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 89.55 | |
| PRK05917 | 290 | DNA polymerase III subunit delta'; Validated | 89.54 | |
| PRK12678 | 672 | transcription termination factor Rho; Provisional | 89.52 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 89.52 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 89.47 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 89.38 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 89.38 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 89.22 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 89.18 | |
| PRK05922 | 434 | type III secretion system ATPase; Validated | 89.18 | |
| KOG2035 | 351 | consensus Replication factor C, subunit RFC3 [Cell | 89.16 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 89.16 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 89.16 | |
| PF01656 | 195 | CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai | 89.11 | |
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 88.99 | |
| CHL00059 | 485 | atpA ATP synthase CF1 alpha subunit | 88.79 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 88.77 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 88.75 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 88.65 | |
| cd02034 | 116 | CooC The accessory protein CooC, which contains a | 88.62 | |
| PHA02518 | 211 | ParA-like protein; Provisional | 88.6 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 88.59 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 88.56 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 88.52 | |
| TIGR02239 | 316 | recomb_RAD51 DNA repair protein RAD51. This eukary | 88.49 | |
| PRK06002 | 450 | fliI flagellum-specific ATP synthase; Validated | 88.46 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 88.43 | |
| cd02037 | 169 | MRP-like MRP (Multiple Resistance and pH adaptatio | 88.43 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 88.38 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 88.37 | |
| COG3640 | 255 | CooC CO dehydrogenase maturation factor [Cell divi | 88.36 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 88.36 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 88.34 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 88.33 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 88.16 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 88.16 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 88.14 | |
| cd02042 | 104 | ParA ParA and ParB of Caulobacter crescentus belon | 88.03 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 88.02 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 87.84 | |
| TIGR03324 | 497 | alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a | 87.84 | |
| cd02036 | 179 | MinD Bacterial cell division requires the formatio | 87.79 | |
| PTZ00035 | 337 | Rad51 protein; Provisional | 87.7 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 87.58 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 87.55 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 87.51 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 87.47 | |
| TIGR03496 | 411 | FliI_clade1 flagellar protein export ATPase FliI. | 87.46 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 87.42 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 87.41 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 87.39 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 87.27 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 87.26 | |
| COG1149 | 284 | MinD superfamily P-loop ATPase containing an inser | 87.14 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 87.13 | |
| PRK06936 | 439 | type III secretion system ATPase; Provisional | 87.13 | |
| PRK06217 | 183 | hypothetical protein; Validated | 86.99 | |
| PRK13233 | 275 | nifH nitrogenase reductase; Reviewed | 86.95 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 86.9 | |
| cd03282 | 204 | ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS | 86.85 | |
| PRK09281 | 502 | F0F1 ATP synthase subunit alpha; Validated | 86.7 | |
| COG1157 | 441 | FliI Flagellar biosynthesis/type III secretory pat | 86.69 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 86.66 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 86.64 | |
| TIGR00962 | 501 | atpA proton translocating ATP synthase, F1 alpha s | 86.62 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 86.6 | |
| cd01136 | 326 | ATPase_flagellum-secretory_path_III Flagellum-spec | 86.54 | |
| PF06564 | 243 | YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p | 86.49 | |
| PF02367 | 123 | UPF0079: Uncharacterised P-loop hydrolase UPF0079; | 86.38 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 86.35 | |
| cd03111 | 106 | CpaE_like This protein family consists of proteins | 86.34 | |
| PF01202 | 158 | SKI: Shikimate kinase; InterPro: IPR000623 Shikima | 86.23 | |
| PRK06696 | 223 | uridine kinase; Validated | 86.14 | |
| PRK08927 | 442 | fliI flagellum-specific ATP synthase; Validated | 86.1 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 86.07 | |
| PRK08149 | 428 | ATP synthase SpaL; Validated | 86.04 | |
| PRK13849 | 231 | putative crown gall tumor protein VirC1; Provision | 86.03 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 86.03 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 86.02 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 86.01 | |
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 86.0 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 85.97 | |
| cd01134 | 369 | V_A-ATPase_A V/A-type ATP synthase catalytic subun | 85.94 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 85.9 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 85.87 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 85.86 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 85.81 | |
| PTZ00185 | 574 | ATPase alpha subunit; Provisional | 85.8 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 85.78 | |
| PRK13343 | 502 | F0F1 ATP synthase subunit alpha; Provisional | 85.77 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 85.74 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 85.73 | |
| PRK06793 | 432 | fliI flagellum-specific ATP synthase; Validated | 85.68 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 85.59 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 85.57 | |
| PRK13231 | 264 | nitrogenase reductase-like protein; Reviewed | 85.57 | |
| KOG0728 | 404 | consensus 26S proteasome regulatory complex, ATPas | 85.55 | |
| TIGR01281 | 268 | DPOR_bchL light-independent protochlorophyllide re | 85.54 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 85.54 | |
| PF08303 | 168 | tRNA_lig_kinase: tRNA ligase kinase domain; InterP | 85.47 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 85.46 | |
| TIGR01041 | 458 | ATP_syn_B_arch ATP synthase archaeal, B subunit. A | 85.42 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 85.42 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 85.31 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 85.29 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 85.23 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 85.17 | |
| PRK10037 | 250 | cell division protein; Provisional | 85.13 | |
| TIGR03498 | 418 | FliI_clade3 flagellar protein export ATPase FliI. | 85.07 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 85.04 | |
| TIGR01969 | 251 | minD_arch cell division ATPase MinD, archaeal. Thi | 85.03 | |
| PRK11545 | 163 | gntK gluconate kinase 1; Provisional | 85.03 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 85.02 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 84.93 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 84.82 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 84.79 | |
| PF07088 | 484 | GvpD: GvpD gas vesicle protein; InterPro: IPR00978 | 84.78 | |
| COG2401 | 593 | ABC-type ATPase fused to a predicted acetyltransfe | 84.76 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 84.75 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 84.73 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 84.71 | |
| cd02040 | 270 | NifH NifH gene encodes component II (iron protein) | 84.66 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 84.65 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 84.63 | |
| PRK07667 | 193 | uridine kinase; Provisional | 84.61 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 84.61 | |
| COG2842 | 297 | Uncharacterized ATPase, putative transposase [Gene | 84.59 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 84.51 | |
| PRK05595 | 444 | replicative DNA helicase; Provisional | 84.49 | |
| PF02223 | 186 | Thymidylate_kin: Thymidylate kinase; InterPro: IPR | 84.48 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 84.44 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 84.36 | |
| cd02032 | 267 | Bchl_like This family of proteins contains bchL an | 84.34 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 84.34 | |
| PRK07594 | 433 | type III secretion system ATPase SsaN; Validated | 84.22 | |
| TIGR01040 | 466 | V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th | 84.13 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 84.12 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 84.03 | |
| PRK13230 | 279 | nitrogenase reductase-like protein; Reviewed | 83.81 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 83.81 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 83.77 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 83.75 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 83.74 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 83.51 | |
| PRK13764 | 602 | ATPase; Provisional | 83.46 | |
| cd03110 | 179 | Fer4_NifH_child This protein family's function is | 83.46 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 83.42 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 83.42 | |
| PF02374 | 305 | ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_ | 83.41 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 83.4 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 83.4 | |
| KOG2383 | 467 | consensus Predicted ATPase [General function predi | 83.39 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 83.31 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 83.25 | |
| PRK13185 | 270 | chlL protochlorophyllide reductase iron-sulfur ATP | 83.24 | |
| PRK10646 | 153 | ADP-binding protein; Provisional | 83.23 | |
| COG0125 | 208 | Tmk Thymidylate kinase [Nucleotide transport and m | 83.18 | |
| TIGR03371 | 246 | cellulose_yhjQ cellulose synthase operon protein Y | 83.03 | |
| PF04548 | 212 | AIG1: AIG1 family; InterPro: IPR006703 This entry | 83.01 | |
| COG3265 | 161 | GntK Gluconate kinase [Carbohydrate transport and | 82.91 | |
| TIGR03497 | 413 | FliI_clade2 flagellar protein export ATPase FliI. | 82.86 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 82.85 | |
| COG0055 | 468 | AtpD F0F1-type ATP synthase, beta subunit [Energy | 82.83 | |
| PRK09099 | 441 | type III secretion system ATPase; Provisional | 82.78 | |
| COG1485 | 367 | Predicted ATPase [General function prediction only | 82.78 | |
| smart00534 | 185 | MUTSac ATPase domain of DNA mismatch repair MUTS f | 82.72 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 82.71 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 82.67 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 82.65 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 82.65 | |
| cd03287 | 222 | ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS | 82.54 | |
| PRK04196 | 460 | V-type ATP synthase subunit B; Provisional | 82.38 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 82.37 | |
| PRK09165 | 497 | replicative DNA helicase; Provisional | 82.35 | |
| COG3910 | 233 | Predicted ATPase [General function prediction only | 82.27 | |
| TIGR01287 | 275 | nifH nitrogenase iron protein. This model describe | 82.26 | |
| KOG1051 | 898 | consensus Chaperone HSP104 and related ATP-depende | 82.22 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 82.22 | |
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 82.2 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 82.14 | |
| COG0003 | 322 | ArsA Predicted ATPase involved in chromosome parti | 82.13 | |
| TIGR01968 | 261 | minD_bact septum site-determining protein MinD. Th | 82.09 | |
| PRK13235 | 274 | nifH nitrogenase reductase; Reviewed | 82.07 | |
| PRK13232 | 273 | nifH nitrogenase reductase; Reviewed | 81.99 | |
| KOG0924 | 1042 | consensus mRNA splicing factor ATP-dependent RNA h | 81.94 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 81.9 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 81.86 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 81.85 | |
| cd03285 | 222 | ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS | 81.83 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 81.72 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 81.68 | |
| cd02117 | 212 | NifH_like This family contains the NifH (iron prot | 81.46 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 81.28 | |
| TIGR01026 | 440 | fliI_yscN ATPase FliI/YscN family. This family of | 81.19 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 81.13 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 80.93 | |
| PRK05688 | 451 | fliI flagellum-specific ATP synthase; Validated | 80.87 | |
| COG0802 | 149 | Predicted ATPase or kinase [General function predi | 80.81 | |
| TIGR03018 | 207 | pepcterm_TyrKin exopolysaccharide/PEPCTERM locus t | 80.7 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 80.63 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 80.6 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 80.45 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 80.44 | |
| PRK08472 | 434 | fliI flagellum-specific ATP synthase; Validated | 80.43 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 80.39 | |
| KOG1970 | 634 | consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 | 80.23 | |
| PRK06820 | 440 | type III secretion system ATPase; Validated | 80.14 | |
| PRK07721 | 438 | fliI flagellum-specific ATP synthase; Validated | 80.11 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 80.11 |
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.8e-33 Score=287.31 Aligned_cols=214 Identities=23% Similarity=0.235 Sum_probs=184.4
Q ss_pred CCCCcHHHHHHHHHc--h-hccccccceEEecchhhcccccCHHHHHHHHHHHHhhccc-cCccchhhhHHHHHHHhcCc
Q 040234 1 MGGLGKTTLARVVYD--L-ISHEFDGSSFLADVREKCDKEGSVISLQKQLLSDLLKLAD-NNIRNVYDGINMLRVRLRRK 76 (377)
Q Consensus 1 mgGiGKTtLA~~v~~--~-~~~~f~~~~w~~~~~~~~~~~~~~~~~~~~i~~~l~~~~~-~~~~~~~~~~~~l~~~l~~k 76 (377)
|||+||||||+++++ . ++.+|+..+|++ ||+.+ +...++.+|+..++.... ....+.++.+..+.+.|.++
T Consensus 187 MGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~-VSk~f----~~~~iq~~Il~~l~~~~~~~~~~~~~~~~~~i~~~L~~k 261 (889)
T KOG4658|consen 187 MGGVGKTTLARQIFNKFDEVGNHFDGVIWVV-VSKEF----TTRKIQQTILERLGLLDEEWEDKEEDELASKLLNLLEGK 261 (889)
T ss_pred CCcccHHHHHHHHhcccchhcccCceEEEEE-Ecccc----cHHhHHHHHHHHhccCCcccchhhHHHHHHHHHHHhccC
Confidence 899999999999999 3 889999999999 99988 999999999999876322 22234478889999999999
Q ss_pred eEEEEEeCCCChhhhhHhhCCCCCCCCCCeEEEEecchhHHhh-CCCCCeeecCCCChhhhHHHHHHHhcCC-CCCchhH
Q 040234 77 KVLVVIDDAAHPDHLRRLVGEPDWFGPGSRIIITTRNEHLLKL-HPVKKVYKLEALTYDEAFRLLCLKAFDT-HKPLEEY 154 (377)
Q Consensus 77 ~~LLVLDdv~~~~~~~~l~~~l~~~~~gs~IIvTTR~~~v~~~-~~~~~~~~l~~L~~~ea~~L~~~~~~~~-~~~~~~~ 154 (377)
|+||||||||+..+|+.+..++|....||+|++|||++.|+.. +++...++++.|+++|||+||.+.++.. ...++..
T Consensus 262 rfllvLDDIW~~~dw~~I~~~~p~~~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i 341 (889)
T KOG4658|consen 262 RFLLVLDDIWEEVDWDKIGVPFPSRENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDI 341 (889)
T ss_pred ceEEEEecccccccHHhcCCCCCCccCCeEEEEEeccHhhhhccccCCccccccccCccccHHHHHHhhccccccccccH
Confidence 9999999999999999999999988889999999999999998 7778899999999999999999999876 4455668
Q ss_pred HHHHHHHHHHhCCCCchhhHHHHHhhhhchh-HHHHHHHHHhhccC-----chhHHHHHHHHHhhcccCCCCC
Q 040234 155 VELAESVVRICHCQKSTLNALMSVSYTVSHL-LLTLCLKLMQYMLC-----PFILFVYLLFFSVGLQNMPPSD 221 (377)
Q Consensus 155 ~~~~~~I~~~c~G~~lplal~~~~~~l~~~~-~~~~~~~L~~~~~~-----~~~~~~~~~~l~~Sy~~L~~~~ 221 (377)
+++|++++++|+| ||||+.++|+.+..+. ..+|....+..... +.....+..++.+||+.||+.-
T Consensus 342 ~~lak~v~~kC~G--LPLAl~viG~~ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~l 412 (889)
T KOG4658|consen 342 EELAKEVAEKCGG--LPLALNVLGGLLACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEEL 412 (889)
T ss_pred HHHHHHHHHHhCC--hHHHHHHHHHHhcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhHHH
Confidence 9999999999999 9999999999998765 44677775544222 2335689999999999999544
|
|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >COG3903 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF14516 AAA_35: AAA-like domain | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG3899 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK07276 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12597 F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK09280 F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01039 atpD ATP synthase, F1 beta subunit | Back alignment and domain information |
|---|
| >PRK07132 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >PLN03187 meiotic recombination protein DMC1 homolog; Provisional | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PF07015 VirC1: VirC1 protein; InterPro: IPR009744 This family consists of several bacterial VirC1 proteins | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >KOG3022 consensus Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >CHL00060 atpB ATP synthase CF1 beta subunit | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG5635 Predicted NTPase (NACHT family) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05917 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK12678 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >PRK05922 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >CHL00059 atpA ATP synthase CF1 alpha subunit | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >PHA02518 ParA-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02239 recomb_RAD51 DNA repair protein RAD51 | Back alignment and domain information |
|---|
| >PRK06002 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha | Back alignment and domain information |
|---|
| >cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell | Back alignment and domain information |
|---|
| >PTZ00035 Rad51 protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >TIGR03496 FliI_clade1 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >PRK06936 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13233 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK09281 F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd01136 ATPase_flagellum-secretory_path_III Flagellum-specific ATPase/type III secretory pathway virulence-related protein | Back alignment and domain information |
|---|
| >PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon | Back alignment and domain information |
|---|
| >PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster | Back alignment and domain information |
|---|
| >PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >PRK08927 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >PRK08149 ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >PRK13849 putative crown gall tumor protein VirC1; Provisional | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PTZ00185 ATPase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >PRK13343 F0F1 ATP synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06793 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13231 nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases [] | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10037 cell division protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03498 FliI_clade3 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >TIGR01969 minD_arch cell division ATPase MinD, archaeal | Back alignment and domain information |
|---|
| >PRK11545 gntK gluconate kinase 1; Provisional | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PF07088 GvpD: GvpD gas vesicle protein; InterPro: IPR009788 This family consists of several archaeal GvpD gas vesicle proteins | Back alignment and domain information |
|---|
| >COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >COG2842 Uncharacterized ATPase, putative transposase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >cd02032 Bchl_like This family of proteins contains bchL and chlL | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PRK07594 type III secretion system ATPase SsaN; Validated | Back alignment and domain information |
|---|
| >TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PRK13230 nitrogenase reductase-like protein; Reviewed | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >cd03110 Fer4_NifH_child This protein family's function is unkown | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF02374 ArsA_ATPase: Anion-transporting ATPase; PDB: 2WOO_A 3IBG_B 3SJA_A 3H84_B 3SJD_A 3ZS9_A 3A37_A 2WOJ_A 3SJC_B 3A36_B | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >KOG2383 consensus Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10646 ADP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ | Back alignment and domain information |
|---|
| >PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria | Back alignment and domain information |
|---|
| >COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03497 FliI_clade2 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG0055 AtpD F0F1-type ATP synthase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09099 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >COG1485 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK04196 V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09165 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >COG3910 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01287 nifH nitrogenase iron protein | Back alignment and domain information |
|---|
| >KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01968 minD_bact septum site-determining protein MinD | Back alignment and domain information |
|---|
| >PRK13235 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK13232 nifH nitrogenase reductase; Reviewed | Back alignment and domain information |
|---|
| >KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01026 fliI_yscN ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK05688 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >COG0802 Predicted ATPase or kinase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >PRK08472 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK06820 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >PRK07721 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 377 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-26 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 3e-25 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 4e-25 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 1e-10 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 110 bits (276), Expect = 2e-26
Identities = 69/451 (15%), Positives = 144/451 (31%), Gaps = 133/451 (29%)
Query: 1 MGGLGKTTLARVVY--DLISHEFDGSSFLADVREKCDKEGSVISLQKQLLSDL---LKLA 55
+ G GKT +A V + + D F +++ C+ +V+ + ++LL +
Sbjct: 158 VLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLK-NCNSPETVLEMLQKLLYQIDPNWTSR 216
Query: 56 DNNIRNVYDGINMLRVRLRR-------KKVLVVIDDAAHPDHLRRLVGEPDWFGPGSRII 108
++ N+ I+ ++ LRR + L+V+ + + + F +I+
Sbjct: 217 SDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQNAKAW-------NAFNLSCKIL 269
Query: 109 ITTRNEHLLKLHPVKKVYKL------EALTYDEAFRLLCLKAFDTHKPLEEYVELAESVV 162
+TTR + + + LT DE LL LK D +L V+
Sbjct: 270 LTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLL-LKYLDC-----RPQDLPREVL 323
Query: 163 RICHCQKSTLNALMSVSYTVSHLLLTLCLKLMQYMLCPFILFVYLLF------FSVGLQN 216
+ L++ + ++ L + + ++ L
Sbjct: 324 TT------------------NPRRLSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNV 365
Query: 217 MPPSDKYGNMHSPQREY----SIVVPGSEIPE------WFEYQNNEGSSITISTPPKTYK 266
+ P++ R+ S+ P + IP WF+ ++ +
Sbjct: 366 LEPAE--------YRKMFDRLSVFPPSAHIPTILLSLIWFDVIKSDVMVVV--------- 408
Query: 267 NSKLVGYVVCCVFRVPKYSLPYYHPLW--------PQYPVHELSINRKGTTSGLCS---- 314
+KL Y V + PK S ++ +Y +H ++ S
Sbjct: 409 -NKLHKY--SLVEKQPKESTISIPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLI 465
Query: 315 -------IY------LRKQFGQAMSDHLF--LYY-----QNRERISKVTFDSPSGLV--- 351
Y L K LF ++ + + R +++ ++
Sbjct: 466 PPYLDQYFYSHIGHHL-KNIEHPERMTLFRMVFLDFRFLEQKIRHDSTAWNASGSILNTL 524
Query: 352 --LKR-----CGVHPIYVHQGDKLTKQLIPF 375
LK C P Y ++L ++ F
Sbjct: 525 QQLKFYKPYICDNDPKY----ERLVNAILDF 551
|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 377 | |||
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 99.96 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 99.93 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 99.91 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 99.89 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 99.22 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 99.09 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 99.01 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 98.89 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 98.89 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 98.89 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 98.85 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 98.78 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 98.68 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 98.37 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 98.21 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 98.11 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 98.1 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 98.07 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 98.0 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 97.96 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 97.87 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 97.85 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 97.84 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 97.67 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 97.6 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 97.58 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 97.55 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 97.54 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 97.5 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 97.49 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 97.46 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 97.45 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 97.45 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 97.4 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 97.36 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 97.35 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 97.34 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.28 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 97.28 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 97.23 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 97.14 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 97.09 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 97.05 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 96.98 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 96.98 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 96.74 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 96.7 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 96.49 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 96.3 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 96.26 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 96.22 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 96.17 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 96.15 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 96.12 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 96.06 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 96.06 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 96.06 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 95.99 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 95.98 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 95.97 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 95.93 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 95.87 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 95.87 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 95.78 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 95.68 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 95.68 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 95.55 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 95.53 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 95.47 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 95.27 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 95.17 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 95.14 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 95.13 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 95.08 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 95.07 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 95.05 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 94.73 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 94.67 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 94.66 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 94.3 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 94.28 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 94.18 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 93.94 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 93.48 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 93.43 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 93.39 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 93.21 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 93.17 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 93.17 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 93.14 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 92.84 | |
| 1jr3_D | 343 | DNA polymerase III, delta subunit; processivity, p | 92.83 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 92.8 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 92.79 | |
| 2ck3_D | 482 | ATP synthase subunit beta\, mitochondrial; hydrola | 92.47 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 92.42 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 92.33 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 92.31 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 92.15 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 92.12 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 91.87 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 91.8 | |
| 1fx0_B | 498 | ATP synthase beta chain; latent ATPase, thermal st | 91.65 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 91.65 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 91.43 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 91.3 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 90.95 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 90.74 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 90.64 | |
| 3l0o_A | 427 | Transcription termination factor RHO; helicase, RH | 90.58 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 90.35 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 90.04 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 89.89 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 89.85 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 89.85 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 89.74 | |
| 3vr4_D | 465 | V-type sodium ATPase subunit D; V-ATPase, rotary m | 89.71 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 89.68 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 89.28 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 89.22 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 89.21 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 88.82 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 88.82 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 88.71 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 88.54 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 88.51 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 88.22 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 87.96 | |
| 1fx0_A | 507 | ATP synthase alpha chain; latent ATPase, thermal s | 87.89 | |
| 2c61_A | 469 | A-type ATP synthase non-catalytic subunit B; hydro | 87.88 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 87.86 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 87.78 | |
| 3oaa_A | 513 | ATP synthase subunit alpha; rossmann fold, hydrola | 87.5 | |
| 3gqb_B | 464 | V-type ATP synthase beta chain; A3B3, V-ATPase, AT | 87.36 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 87.3 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 87.21 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 87.16 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 87.08 | |
| 2ck3_A | 510 | ATP synthase subunit alpha\, mitochondrial; hydrol | 87.07 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 86.97 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 86.72 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 86.68 | |
| 3cwq_A | 209 | Para family chromosome partitioning protein; alpha | 86.5 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 86.44 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 86.37 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 86.19 | |
| 3ea0_A | 245 | ATPase, para family; alpha-beta-alpha sandwich, st | 86.15 | |
| 2qe7_A | 502 | ATP synthase subunit alpha; blockage of ATP hydrol | 86.04 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 85.5 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 85.44 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 85.31 | |
| 2r9v_A | 515 | ATP synthase subunit alpha; TM1612, structural gen | 85.29 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 85.29 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 85.14 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 85.1 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 85.05 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 85.04 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 84.96 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 84.78 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 84.73 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 84.64 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 84.63 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 84.4 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 84.26 | |
| 1cp2_A | 269 | CP2, nitrogenase iron protein; oxidoreductase; 1.9 | 84.22 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 83.97 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 83.91 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 83.77 | |
| 3kjh_A | 254 | CO dehydrogenase/acetyl-COA synthase complex, acce | 83.76 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 83.63 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 83.48 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 83.44 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 83.21 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 83.2 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 83.14 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 83.06 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 82.93 | |
| 1g3q_A | 237 | MIND ATPase, cell division inhibitor; alpha-beta-a | 82.78 | |
| 3ch4_B | 202 | Pmkase, phosphomevalonate kinase; parallel beta-sh | 82.74 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 82.69 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 82.68 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 82.62 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 82.5 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 82.36 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 82.24 | |
| 3k9g_A | 267 | PF-32 protein; ssgcid, SBRI, decode biostructures, | 82.24 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 82.21 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 82.14 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 82.01 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 81.98 | |
| 2ph1_A | 262 | Nucleotide-binding protein; alpha-beta protein, st | 81.84 | |
| 3q9l_A | 260 | Septum site-determining protein MIND; ATPase, bact | 81.83 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 81.79 | |
| 2afh_E | 289 | Nitrogenase iron protein 1; nitrogen fixation, iro | 81.74 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 81.71 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 81.63 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 81.55 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 81.49 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 81.35 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 81.24 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 81.21 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 81.0 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 81.0 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 80.99 | |
| 3zq6_A | 324 | Putative arsenical pump-driving ATPase; tail-ancho | 80.9 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 80.88 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 80.7 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 80.54 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 80.46 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 80.45 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 80.43 | |
| 1hyq_A | 263 | MIND, cell division inhibitor (MIND-1); MINC, FTSZ | 80.27 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 80.19 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 80.14 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 80.14 | |
| 2oze_A | 298 | ORF delta'; para, walker type atpases, DNA segrega | 80.11 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 80.09 |
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
Probab=99.96 E-value=3.4e-30 Score=257.52 Aligned_cols=207 Identities=16% Similarity=0.154 Sum_probs=155.9
Q ss_pred CCCCcHHHHHHHHHc----hhccccccceEEecchhhcccccCHHHHHHHHHHHHhhccc-cCc-----cchhhhHHHHH
Q 040234 1 MGGLGKTTLARVVYD----LISHEFDGSSFLADVREKCDKEGSVISLQKQLLSDLLKLAD-NNI-----RNVYDGINMLR 70 (377)
Q Consensus 1 mgGiGKTtLA~~v~~----~~~~~f~~~~w~~~~~~~~~~~~~~~~~~~~i~~~l~~~~~-~~~-----~~~~~~~~~l~ 70 (377)
|||+||||||+++|+ +++.+|+.++|++ +++... . ++..++..++.+++.... ... .+.+.+...++
T Consensus 160 ~gGvGKTtLA~~v~~~~~~~~~~~F~~~~wv~-vs~~~~-~-~~~~~~~~il~~l~~~~~~~~~~~~~~~~~~~l~~~l~ 236 (549)
T 2a5y_B 160 RAGSGKSVIASQALSKSDQLIGINYDSIVWLK-DSGTAP-K-STFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMIC 236 (549)
T ss_dssp STTSSHHHHHHHHHHHCSSTBTTTBSEEEEEE-CCCCST-T-HHHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHH
T ss_pred CCCCCHHHHHHHHHHhhhHHHhccCCcEEEEE-ECCCCC-C-CHHHHHHHHHHHHhcCcccccccccccccHHHHHHHHH
Confidence 799999999999995 7899999999996 776532 1 678999999999876422 111 23344688999
Q ss_pred HHhcCc-eEEEEEeCCCChhhhhHhhCCCCCCCCCCeEEEEecchhHHhhCC-CCCeeecCCCChhhhHHHHHHHhcCCC
Q 040234 71 VRLRRK-KVLVVIDDAAHPDHLRRLVGEPDWFGPGSRIIITTRNEHLLKLHP-VKKVYKLEALTYDEAFRLLCLKAFDTH 148 (377)
Q Consensus 71 ~~l~~k-~~LLVLDdv~~~~~~~~l~~~l~~~~~gs~IIvTTR~~~v~~~~~-~~~~~~l~~L~~~ea~~L~~~~~~~~~ 148 (377)
+.|+++ |+||||||||+.+++ .+. . .+||+||||||++.++..+. ....++|++|++++|++||.++++...
T Consensus 237 ~~L~~~kr~LlVLDdv~~~~~~-~~~-~----~~gs~ilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~a~~~~ 310 (549)
T 2a5y_B 237 NALIDRPNTLFVFDDVVQEETI-RWA-Q----ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMP 310 (549)
T ss_dssp HHHTTSTTEEEEEEEECCHHHH-HHH-H----HTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC
T ss_pred HHHcCCCcEEEEEECCCCchhh-ccc-c----cCCCEEEEEcCCHHHHHHcCCCCeEEECCCCCHHHHHHHHHHHhcCCC
Confidence 999996 999999999998865 222 1 37999999999999988775 446799999999999999999987653
Q ss_pred CCchhHHHHHHHHHHHhCCCCchhhHHHHHhhhhchhHHHHHHHHHhhccCchhHHHHHHHHHhhcccCCCCC
Q 040234 149 KPLEEYVELAESVVRICHCQKSTLNALMSVSYTVSHLLLTLCLKLMQYMLCPFILFVYLLFFSVGLQNMPPSD 221 (377)
Q Consensus 149 ~~~~~~~~~~~~I~~~c~G~~lplal~~~~~~l~~~~~~~~~~~L~~~~~~~~~~~~~~~~l~~Sy~~L~~~~ 221 (377)
. .+.+.+++++|+++||| +|||++++|+.+..+. .++...+...... .....+.+++.+||+.||+..
T Consensus 311 ~-~~~~~~~~~~I~~~c~G--lPLAl~~~g~~l~~~~-w~~~~~l~~~l~~-~~~~~i~~~l~~Sy~~L~~~l 378 (549)
T 2a5y_B 311 V-GEKEEDVLNKTIELSSG--NPATLMMFFKSCEPKT-FEKMAQLNNKLES-RGLVGVECITPYSYKSLAMAL 378 (549)
T ss_dssp ---CHHHHHHHHHHHHHTT--CHHHHHHHHTTCCSSS-HHHHHHHHHHHHH-HCSSTTCCCSSSSSSSHHHHH
T ss_pred C-chhHHHHHHHHHHHhCC--ChHHHHHHHHHhccch-HHHHHHhHHHhhc-ccHHHHHHHHhcccccccHHH
Confidence 2 46778899999999999 9999999999987763 2333333221100 001235567778888876654
|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* | Back alignment and structure |
|---|
| >2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A | Back alignment and structure |
|---|
| >3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* | Back alignment and structure |
|---|
| >3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* | Back alignment and structure |
|---|
| >3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 377 | ||||
| d2a5yb3 | 277 | c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor | 1e-20 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Score = 88.3 bits (218), Expect = 1e-20
Identities = 27/175 (15%), Positives = 54/175 (30%), Gaps = 18/175 (10%)
Query: 1 MGGLGKTTLARVVYD----LISHEFDGSSFLADVREKCDKEGSVISLQKQLLSDLLKLAD 56
G GK+ +A LI +D +L K + L+
Sbjct: 52 RAGSGKSVIASQALSKSDQLIGINYDSIVWL-KDSGTAPKSTFDLFTDILLMLKSEDDLL 110
Query: 57 N-----NIRNVYDGINMLRVRLRRKKVLVVIDDAAHPDHLRRLVGEPDWFGPGSRIIITT 111
N ++ +V + + R L V DD + +R R ++TT
Sbjct: 111 NFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRW------AQELRLRCLVTT 164
Query: 112 RNEHLLK-LHPVKKVYKLEALTYDEAFRLLCLKAFDTHKPLEEYVELAESVVRIC 165
R+ + + ++ +L DE + L E+ ++ + +
Sbjct: 165 RDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVG-EKEEDVLNKTIELS 218
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 377 | |||
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 99.97 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 98.42 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 98.02 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 97.94 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 97.89 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 97.89 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 97.82 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 97.79 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 97.78 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 97.65 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 97.65 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 97.48 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.42 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 97.28 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 97.25 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 97.12 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 97.08 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 97.05 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 96.8 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 96.73 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 96.73 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.72 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 96.56 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 95.14 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 94.8 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 94.58 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 94.28 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 94.23 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 94.16 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 94.15 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 93.95 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 93.93 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 93.73 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 93.6 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 93.24 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 93.15 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 92.98 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 92.68 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 92.63 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 92.57 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 92.49 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 92.19 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 91.79 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 91.74 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 91.74 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 91.59 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 91.58 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 91.41 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 91.33 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 90.93 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 90.71 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 90.46 | |
| d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 90.14 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 90.02 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 90.0 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 89.9 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 89.26 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 89.25 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 89.24 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 89.24 | |
| d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 88.92 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 88.91 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 88.74 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 88.38 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 88.27 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 88.12 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 88.07 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 87.95 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 87.62 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 87.59 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 87.56 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 87.54 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 87.41 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 87.33 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 87.14 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 86.95 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 86.92 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 86.83 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 86.5 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 85.86 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 85.47 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 85.23 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 84.83 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 84.81 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 84.59 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 84.58 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 84.28 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 84.23 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 84.18 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 84.12 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 84.03 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 83.89 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 83.75 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 83.39 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 81.84 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 81.39 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 81.28 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 81.26 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 81.03 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Probab=99.97 E-value=7.3e-32 Score=244.19 Aligned_cols=205 Identities=13% Similarity=0.087 Sum_probs=152.3
Q ss_pred CCCCcHHHHHHHHHch----hccccccceEEecchhhcccccCHHHHHHHH---HHHHhhcccc------CccchhhhHH
Q 040234 1 MGGLGKTTLARVVYDL----ISHEFDGSSFLADVREKCDKEGSVISLQKQL---LSDLLKLADN------NIRNVYDGIN 67 (377)
Q Consensus 1 mgGiGKTtLA~~v~~~----~~~~f~~~~w~~~~~~~~~~~~~~~~~~~~i---~~~l~~~~~~------~~~~~~~~~~ 67 (377)
|||+||||||++++++ ...+|+..+|+. +++.+ +...+...+ +..+...... ..........
T Consensus 52 mgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~-vs~~~----~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 126 (277)
T d2a5yb3 52 RAGSGKSVIASQALSKSDQLIGINYDSIVWLK-DSGTA----PKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRM 126 (277)
T ss_dssp STTSSHHHHHHHHHHHCSSTBTTTBSEEEEEE-CCCCS----TTHHHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHH
T ss_pred CCCCCHHHHHHHHHHhhhhhhhhcCceEEEEE-ecCCC----CHHHHHHHHHHHHHHhcchhhcCCccchhhhhHHHHHH
Confidence 8999999999999984 566688889988 66655 444444443 3332222111 1112223344
Q ss_pred HHHHHhcCceEEEEEeCCCChhhhhHhhCCCCCCCCCCeEEEEecchhHHhhCCC-CCeeecCCCChhhhHHHHHHHhcC
Q 040234 68 MLRVRLRRKKVLVVIDDAAHPDHLRRLVGEPDWFGPGSRIIITTRNEHLLKLHPV-KKVYKLEALTYDEAFRLLCLKAFD 146 (377)
Q Consensus 68 ~l~~~l~~k~~LLVLDdv~~~~~~~~l~~~l~~~~~gs~IIvTTR~~~v~~~~~~-~~~~~l~~L~~~ea~~L~~~~~~~ 146 (377)
.+.+.+.++++|+||||||+.++++.+.. .||+||||||++.++..+.. ...|+|++|+.+||++||.++++.
T Consensus 127 ~~~~~L~~kr~LlVLDDv~~~~~~~~~~~------~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~ 200 (277)
T d2a5yb3 127 ICNALIDRPNTLFVFDDVVQEETIRWAQE------LRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMP 200 (277)
T ss_dssp HHHHHTTSTTEEEEEEEECCHHHHHHHHH------TTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCC
T ss_pred HHHHHhccCCeeEecchhhHHhhhhhhcc------cCceEEEEeehHHHHHhcCCCCceEECCCCCHHHHHHHHHHHhCC
Confidence 57778899999999999999999987753 47899999999999887654 367999999999999999998876
Q ss_pred CCCCchhHHHHHHHHHHHhCCCCchhhHHHHHhhhhchhHHHHHHHHHhhccCchhHHHHHHHHHhhcccCCCCC
Q 040234 147 THKPLEEYVELAESVVRICHCQKSTLNALMSVSYTVSHLLLTLCLKLMQYMLCPFILFVYLLFFSVGLQNMPPSD 221 (377)
Q Consensus 147 ~~~~~~~~~~~~~~I~~~c~G~~lplal~~~~~~l~~~~~~~~~~~L~~~~~~~~~~~~~~~~l~~Sy~~L~~~~ 221 (377)
... .+..++++++|+++||| +|||++++|+.+..+...+|....+++.... ...+.+++.+||+.||+.-
T Consensus 201 ~~~-~~~~~~~~~~iv~~c~G--lPLAl~~ig~~l~~k~~~~~~~~~~~L~~~~--~~~v~~il~~sY~~L~~~l 270 (277)
T d2a5yb3 201 MPV-GEKEEDVLNKTIELSSG--NPATLMMFFKSCEPKTFEKMAQLNNKLESRG--LVGVECITPYSYKSLAMAL 270 (277)
T ss_dssp CC---CHHHHHHHHHHHHHTT--CHHHHHHHHTTCCSSSHHHHHHHHHHHHHHC--SSTTCCCSSSSSSSHHHHH
T ss_pred ccC-chhhHHHHHHHHHHhCC--CHHHHHHHHHHhccCCHHHHHHHHHHHhcCc--HHHHHHHHHHHHhcccHHH
Confidence 543 34457889999999999 9999999999999888777766544443211 1247788889999998753
|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|