Citrus Sinensis ID: 040254


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-----
MNIVPAAGGQIISCHTEKSILRNHGGFNILMQPAMNKLVQRYHLPSIGNLTHISHLNLSHNHVHGPLPINSFHFLTLLEIIDLSYNSLSGELTGLIPSLAWNHSFCSMRLLDFSYNDFSSQVPPRLGNCSRLKSFQAGYSNLLRSLPDDIYAAASLEEPSLHFNKLSGFISNDIINLTSLLVLELYSKELIGSIPRDIGKLTNLKYLLLYRNNLSGSLPSSMMNCTNLKTLNLMGNLFAGNLSAYNFSVLSQLETIDLYINMFTGSFLLTLTSCRLLTALRLACNQLEGQIPPEIIKLKSLILMGCKNLNVLFLTMNFMNEATPNYDQNKISDGFQNLRAVSLAGCQLTGQVPLWLSKLTKLEVLLLSGNQITGSIPGWFGNLPSLFYFALSQNNISGEFPKELSRLQPLVIEQNKFNRNKPDLPFFLFPNQNSTSHQYNRIFGLRPTIFLANNSLSGRIPAETGQLKFLNVLDLGNNNFAGSIPNQISQLTILERLDLSKNHLSENNLQGPIPSGGQLHTFPPSSFEGNPEFCSDIANRSSTTEPRTTTNIGLP
ccccccccccccccccccEEEccccccEEEEEccccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccccccccccEEEccccccEEcccccccccccccccccccccccccccHHHHcccccccEEcccccccccccHHHHccccccEEEccccccccccccccccccccccccccccccEEcccccccccccccEEEccccccEEEccHHcccccccccEEEcccccccccccHHccccccccEEEccccccEEcccccccccccccccccccccEEEccccccccccccccccccccccccccEEEccccccEEcccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccHHHcccccccEEEccccccccccHHHHHccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccEEEcccccccccccHHHcccccccEEEcccccccccccccccccccEEEEEccccccccccHHHHHccccccEEEEccccccccccHHHccHHHHcccccccEEEEccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEEccccccccccHHHHcccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEcccccEEEEcccccccccccHHHccccccccccEEEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEcccccccccccHHHHHHcccccccHccccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccc
mnivpaaggqiisCHTEKSILrnhggfnilmqPAMNKLVqryhlpsignlthishlnlshnhvhgplpinsfHFLTLLEIIDLSYnslsgeltglipslawnhsfcsmrlldfsyndfssqvpprlgncsrlKSFQAGYSNLLRSLPDDIYAAasleepslhfnklsgfisndIINLTSLLVLELYSKELIgsiprdigkltNLKYLLLYRNNlsgslpssmmnctnlktlNLMGNLFAGNLSAYNFSVLSQLETIDLYINMFTGSFLLTLTSCRLLTALRLACNqlegqippeiIKLKSLILMGCKNLNVLFLTMNfmneatpnydqnkisdgfQNLRAVSLAGcqltgqvplwlSKLTKLEVLLLSGnqitgsipgwfgnlpSLFYFALsqnnisgefpkelsrlqplvieqnkfnrnkpdlpfflfpnqnstshqynrifglrPTIFlannslsgripaetgqlKFLNVLdlgnnnfagsipnqisqLTILERLDLsknhlsennlqgpipsggqlhtfppssfegnpefcsdianrsstteprtttniglp
mnivpaaggqiisCHTEKSILRNHGGFNILMQPAMNKLVQRYHLPSIGNLTHISHLNLSHNHVHGPLPINSFHFLTLLEIIDLSYNSLSGELTGLIPSLAWNHSFCSMRLLDFSYNDFSSQVPPRLGNCSRLKSFQAGYSNLLRSLPDDIYAAASLEEPSLHFNKLSGFISNDIINLTSLLVLELYSKELIGSIPRDIGKLTNLKYLLLYRNNLSGSLPSSMMNCTNLKTLNLMGNLFAGNLSAYNFSVLSQLETIDLYINMFTGSFLLTLTSCRLLTALRLACNQLEGQIPPEIIKLKSLILMGCKNLNVLFLTMNFMNEATPNYDQNKISDGFQNLRAVSLAGCQLTGQVPLWLSKLTKLEVLLLSGNQITGSIPGWFGNLPSLFYFALSQNNISGEFPKELSRLQPLVIEQNKFNRNKPDLPFFLFPNQNSTSHQYNRIFGLRPTIFLANNSLSGRIPAETGQLKFLNVLDLGNNNFAGSIPNQISQLTILERLDLSKNHLSENNLQGPIPSGGQLHTFPPSSFEGNPEFCSDIanrsstteprtttniglp
MNIVPAAGGQIISCHTEKSILRNHGGFNILMQPAMNKLVQRYHLPSIGNLTHISHLNLSHNHVHGPLPINSFHFLTLLEIIDLSYNSLSGELTGLIPSLAWNHSFCSMRLLDFSYNDFSSQVPPRLGNCSRLKSFQAGYSNLLRSLPDDIYAAASLEEPSLHFNKLSGFISNDIINLTSLLVLELYSKELIGSIPRDIGkltnlkylllyrnnlSGSLPSSMMNCTNLKTLNLMGNLFAGNLSAYNFSVLSQLETIDLYINMFTGSFLLTLTSCRLLTALRLACNQLEGQIPPEIIKLKSLILMGCKNLNVLFLTMNFMNEATPNYDQNKISDGFQNLRAVSLAGCQLTGQVPlwlskltklevlllsGNQITGSIPGWFGNLPSLFYFALSQNNISGEFPKELSRLQPLVIEQNKFNRNKPDLPFFLFPNQNSTSHQYNRIFGLRPTIFLANNSLSGRIPAETGQLKFLNVLDLGNNNFAGSIPNQISQLTILERLDLSKNHLSENNLQGPIPSGGQLHTFPPSSFEGNPEFCSDIANRSSTTEPRTTTNIGLP
******AGGQIISCHTEKSILRNHGGFNILMQPAMNKLVQRYHLPSIGNLTHISHLNLSHNHVHGPLPINSFHFLTLLEIIDLSYNSLSGELTGLIPSLAWNHSFCSMRLLDFSYNDFSSQVPPRLGNCSRLKSFQAGYSNLLRSLPDDIYAAASLEEPSLHFNKLSGFISNDIINLTSLLVLELYSKELIGSIPRDIGKLTNLKYLLLYRNNLSGSLPSSMMNCTNLKTLNLMGNLFAGNLSAYNFSVLSQLETIDLYINMFTGSFLLTLTSCRLLTALRLACNQLEGQIPPEIIKLKSLILMGCKNLNVLFLTMNFMNEATPNYDQNKISDGFQNLRAVSLAGCQLTGQVPLWLSKLTKLEVLLLSGNQITGSIPGWFGNLPSLFYFALSQNNISGEFPKELSRLQPLVIEQNKFNRNKPDLPFFLFPNQNSTSHQYNRIFGLRPTIFLANNSLSGRIPAETGQLKFLNVLDLGNNNFAGSIPNQISQLTILERLD*********************************************************
*NIVPAAGGQIISCHTEKSILRNHGGFNI****************SIGNLTHISHLNLSHNHVHGPLPINSFHFLTLLEIIDLSYNSLSGELTGLIPSLAWNHSFCSMRLLDFSYNDFSSQVPPRLGNCSRLKSFQAGYSNLLRSLPDDIYAAASLEEPSLHFNKLSGFISNDIINLTSLLVLELYSKELIGSIPRDIGKLTNLKYLLLYRNNLSGSLPSSMMNCTNLKTLNLMGNLFAGNLSAYNFSVLSQLETIDLYINMFTGSFLLTLTSCRLLTALRLACNQLEGQIPPEIIKLKSLILMGCKNLNVLFLTMNFMNEATPNYDQNKISDGFQNLRAVSLAGCQLTGQVPLWLSKLTKLEVLLLSGNQITGSIPGWFGNLPSLFYFALSQNNISGEFPKELSRLQPLVI**************FLFPNQNSTSHQYNRIFGLRPTIFLANNSLSGRIPAETGQLKFLNVLDLGNNNFAGSIPNQISQLTILERLDLSKNHLSENNLQGPIPSGGQLHTFPPSSFEGNPEFCS********************
MNIVPAAGGQIISCHTEKSILRNHGGFNILMQPAMNKLVQRYHLPSIGNLTHISHLNLSHNHVHGPLPINSFHFLTLLEIIDLSYNSLSGELTGLIPSLAWNHSFCSMRLLDFSYNDFSSQVPPRLGNCSRLKSFQAGYSNLLRSLPDDIYAAASLEEPSLHFNKLSGFISNDIINLTSLLVLELYSKELIGSIPRDIGKLTNLKYLLLYRNNLSGSLPSSMMNCTNLKTLNLMGNLFAGNLSAYNFSVLSQLETIDLYINMFTGSFLLTLTSCRLLTALRLACNQLEGQIPPEIIKLKSLILMGCKNLNVLFLTMNFMNEATPNYDQNKISDGFQNLRAVSLAGCQLTGQVPLWLSKLTKLEVLLLSGNQITGSIPGWFGNLPSLFYFALSQNNISGEFPKELSRLQPLVIEQNKFNRNKPDLPFFLFPNQNSTSHQYNRIFGLRPTIFLANNSLSGRIPAETGQLKFLNVLDLGNNNFAGSIPNQISQLTILERLDLSKNHLSENNLQGPIPSGGQLHTFPPSSFEGNPEFCSDIAN****************
*NIVPAAGGQIISCHTEKSILRNHGGFNILMQPAMNKLVQRYHLPSIGNLTHISHLNLSHNHVHGPLPINSFHFLTLLEIIDLSYNSLSGELTGLIPSLAWNHSFCSMRLLDFSYNDFSSQVPPRLGNCSRLKSFQAGYSNLLRSLPDDIYAAASLEEPSLHFNKLSGFISNDIINLTSLLVLELYSKELIGSIPRDIGKLTNLKYLLLYRNNLSGSLPSSMMNCTNLKTLNLMGNLFAGNLSAYNFSVLSQLETIDLYINMFTGSFLLTLTSCRLLTALRLACNQLEGQIPPEIIKLKSLILMGCKNLNVLFLTMNFMNEATPNYDQNKISDGFQNLRAVSLAGCQLTGQVPLWLSKLTKLEVLLLSGNQITGSIPGWFGNLPSLFYFALSQNNISGEFPKELSRLQPLVIEQNKFNRNKPDLPFFLFPNQNSTSHQYNRIFGLRPTIFLANNSLSGRIPAETGQLKFLNVLDLGNNNFAGSIPNQISQLTILERLDLSKNHLSENNLQGPIPSGGQLHTFPPSSFEGNPEFCSDIAN****************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNIVPAAGGQIISCHTEKSILRNHGGFNILMQPAMNKLVQRYHLPSIGNLTHISHLNLSHNHVHGPLPINSFHFLTLLEIIDLSYNSLSGELTGLIPSLAWNHSFCSMRLLDFSYNDFSSQVPPRLGNCSRLKSFQAGYSNLLRSLPDDIYAAASLEEPSLHFNKLSGFISNDIINLTSLLVLELYSKELIGSIPRDIGKLTNLKYLLLYRNNLSGSLPSSMMNCTNLKTLNLMGNLFAGNLSAYNFSVLSQLETIDLYINMFTGSFLLTLTSCRLLTALRLACNQLEGQIPPEIIKLKSLILMGCKNLNVLFLTMNFMNEATPNYDQNKISDGFQNLRAVSLAGCQLTGQVPLWLSKLTKLEVLLLSGNQITGSIPGWFGNLPSLFYFALSQNNISGEFPKELSRLQPLVIEQNKFNRNKPDLPFFLFPNQNSTSHQYNRIFGLRPTIFLANNSLSGRIPAETGQLKFLNVLDLGNNNFAGSIPNQISQLTILERLDLSKNHLSENNLQGPIPSGGQLHTFPPSSFEGNPEFCSDIANRSSTTEPRTTTNIGLP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query555 2.2.26 [Sep-21-2011]
Q9C7S5 1095 Tyrosine-sulfated glycope yes no 0.913 0.463 0.408 1e-112
Q9SHI3729 Receptor-like protein 2 O no no 0.882 0.672 0.402 1e-105
Q9ZVR7 1008 Phytosulfokine receptor 1 no no 0.861 0.474 0.364 2e-73
Q8LPB4 1021 Phytosulfokine receptor 1 N/A no 0.949 0.516 0.347 8e-73
Q9FN37 1036 Phytosulfokine receptor 2 no no 0.873 0.468 0.335 3e-68
C0LGQ5 1249 LRR receptor-like serine/ no no 0.875 0.389 0.303 8e-47
Q8VZG8 1045 Probable LRR receptor-lik no no 0.812 0.431 0.313 6e-46
Q9ZWC8 1166 Serine/threonine-protein no no 0.899 0.427 0.296 4e-45
Q9M2Z1 1002 Leucine-rich repeat recep no no 0.837 0.464 0.304 2e-43
Q9LHP4 1141 Receptor-like protein kin no no 0.805 0.391 0.321 4e-43
>sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1 OS=Arabidopsis thaliana GN=PSYR1 PE=2 SV=1 Back     alignment and function desciption
 Score =  405 bits (1042), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 245/600 (40%), Positives = 328/600 (54%), Gaps = 93/600 (15%)

Query: 46  SIGNLTHISHLNLSHNHVHGPLPINSFHFLTLLEIIDLSYNSLSGEL------------- 92
           S+ +L  +S L+LSHN + GPLP      L  L ++DLSYNS  GEL             
Sbjct: 111 SVLDLQRLSRLDLSHNRLSGPLPPGFLSALDQLLVLDLSYNSFKGELPLQQSFGNGSNGI 170

Query: 93  ----------------------------------------TGLIPSLAWNHSFCSMRLLD 112
                                                   TG IPS     S   +  LD
Sbjct: 171 FPIQTVDLSSNLLEGEILSSSVFLQGAFNLTSFNVSNNSFTGSIPSFMCTAS-PQLTKLD 229

Query: 113 FSYNDFSSQVPPRLGNCSRLKSFQAGYSNLLRSLPDDIYAAASLEEPSLHFNKLSGFISN 172
           FSYNDFS  +   L  CSRL   +AG++NL   +P +IY    LE+  L  N+LSG I N
Sbjct: 230 FSYNDFSGDLSQELSRCSRLSVLRAGFNNLSGEIPKEIYNLPELEQLFLPVNRLSGKIDN 289

Query: 173 DIINLTSLLVLELYSKELIGSIPRDIGKLTNLKYLLLYRNNLSGSLPSSMMNCTNLKTLN 232
            I  LT L +LELYS  + G IP+DIGKL+ L  L L+ NNL GS+P S+ NCT L  LN
Sbjct: 290 GITRLTKLTLLELYSNHIEGEIPKDIGKLSKLSSLQLHVNNLMGSIPVSLANCTKLVKLN 349

Query: 233 LMGNLFAGNLSAYNFSVLSQLETIDLYINMFTGSFLLTLTSCRLLTALRLACNQLEGQIP 292
           L  N   G LSA +FS    L  +DL  N FTG F  T+ SC+++TA+R A N+L GQI 
Sbjct: 350 LRVNQLGGTLSAIDFSRFQSLSILDLGNNSFTGEFPSTVYSCKMMTAMRFAGNKLTGQIS 409

Query: 293 PEIIKLKSL------------------ILMGCKNLNVLFLTMNFMNEATPNYDQNKISDG 334
           P++++L+SL                  IL GCK L+ L +  NF +E  P+      SDG
Sbjct: 410 PQVLELESLSFFTFSDNKMTNLTGALSILQGCKKLSTLIMAKNFYDETVPSNKDFLRSDG 469

Query: 335 FQNLRAVSLAGCQLTGQVPLWLSKLTKLEVLLLSGNQITGSIPGWFGNLPSLFYFALSQN 394
           F +L+   +  C+LTG++P WL KL ++EV+ LS N+  G+IPGW G LP LFY  LS N
Sbjct: 470 FPSLQIFGIGACRLTGEIPAWLIKLQRVEVMDLSMNRFVGTIPGWLGTLPDLFYLDLSDN 529

Query: 395 NISGEFPKELSRLQPLVIEQ--NKFNRNKPDLPFFLFPNQNSTSHQYNRIFGLRPTIFLA 452
            ++GE PKEL +L+ L+ ++  +   RN  +LP F+ PN  +T+ QYN++  L PTI++ 
Sbjct: 530 FLTGELPKELFQLRALMSQKAYDATERNYLELPVFVNPNNVTTNQQYNQLSSLPPTIYIK 589

Query: 453 NNSLSGRIPAETGQLKFLNVLDLGNNNFAGSIPNQISQLTILERLDLSKNHLS------- 505
            N+L+G IP E GQLK L++L+L  NNF+GSIP+++S LT LERLDLS N+LS       
Sbjct: 590 RNNLTGTIPVEVGQLKVLHILELLGNNFSGSIPDELSNLTNLERLDLSNNNLSGRIPWSL 649

Query: 506 ------------ENNLQGPIPSGGQLHTFPPSSFEGNPEFCSDIANRSSTTEPRTTTNIG 553
                        N L GPIP+G Q  TFP ++FEGNP  C  +   S      +TT +G
Sbjct: 650 TGLHFLSYFNVANNTLSGPIPTGTQFDTFPKANFEGNPLLCGGVLLTSCDPTQHSTTKMG 709




Tyrosine-sulfated glycopeptide receptor with a serine/threonine-protein kinase activity. Regulates, in response to tyrosine-sulfated glycopeptide binding, a signaling cascade involved in cellular proliferation and plant growth. Not involved in PSK perception.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9SHI3|RLP2_ARATH Receptor-like protein 2 OS=Arabidopsis thaliana GN=RLP2 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=2 SV=4 Back     alignment and function description
>sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1 Back     alignment and function description
>sp|Q9FN37|PSKR2_ARATH Phytosulfokine receptor 2 OS=Arabidopsis thaliana GN=PSKR2 PE=2 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query555
359482434 1280 PREDICTED: tyrosine-sulfated glycopeptid 0.902 0.391 0.489 1e-133
255537393 1087 Leucine-rich repeat receptor protein kin 0.913 0.466 0.482 1e-131
224074123 1050 predicted protein [Populus trichocarpa] 0.906 0.479 0.464 1e-126
224138536 1092 predicted protein [Populus trichocarpa] 0.906 0.460 0.456 1e-124
219718185 1085 receptor kinase [Gossypium barbadense] 0.873 0.447 0.489 1e-123
449436222 1095 PREDICTED: tyrosine-sulfated glycopeptid 0.906 0.459 0.440 1e-117
255577318 717 Phytosulfokine receptor precursor, putat 0.879 0.680 0.475 1e-117
147832546 1188 hypothetical protein VITISV_009907 [Viti 0.859 0.401 0.451 1e-116
297841971 1096 hypothetical protein ARALYDRAFT_476358 [ 0.915 0.463 0.416 1e-111
356504209 1076 PREDICTED: tyrosine-sulfated glycopeptid 0.908 0.468 0.435 1e-110
>gi|359482434|ref|XP_002270860.2| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  481 bits (1237), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 290/593 (48%), Positives = 374/593 (63%), Gaps = 92/593 (15%)

Query: 45  PSIGNLTHISHLNLSHNHVHGPLPINSFHFLTLLEIIDLSYNSLSGEL------------ 92
           PS+ NLT +SHLNLS N   G +P+  F   + LEI+D+S+N LSGEL            
Sbjct: 311 PSLANLTLLSHLNLSRNSFSGSVPLELF---SSLEILDVSFNRLSGELPLSLSQSPNNSG 367

Query: 93  -------------TGLIPS----LAWN--------HSFCS------------MRLLDFSY 115
                         G+I S    LA N        +SF              +RL+DFSY
Sbjct: 368 VSLQTIDLSSNHFYGVIQSSFLQLARNLTNFNVSNNSFTDSIPSDICRNSPLVRLMDFSY 427

Query: 116 NDFSSQVPPRLGNCSRLKSFQAGYSNLLRSLPDDIYAAASLEEPSLHFNKLSGFISNDII 175
           N FS +VP  LG+CS+L+  +AG+++L   +P+DIY+AA+L E SL  N LSG IS+ I+
Sbjct: 428 NKFSGRVPLGLGDCSKLEVLRAGFNSLSGLIPEDIYSAAALREISLPVNSLSGPISDAIV 487

Query: 176 NLTSLLVLELYSKELIGSIPRDIGKLTNLKYLLLYRNNLSGSLPSSMMNCTNLKTLNLMG 235
           NL++L VLELYS +LIG++P+D+GKL  LK LLL+ N L+G LP+S+MNCT L TLNL  
Sbjct: 488 NLSNLTVLELYSNQLIGNLPKDMGKLFYLKRLLLHINKLTGPLPASLMNCTKLTTLNLRV 547

Query: 236 NLFAGNLSAYNFSVLSQLETIDLYINMFTGSFLLTLTSCRLLTALRLACNQLEGQIPPEI 295
           NLF G++S   FS L +L T+DL  N FTG+  ++L SC+ LTA+RLA N+LEGQI P+I
Sbjct: 548 NLFEGDISVIKFSTLQELSTLDLGDNNFTGNLPVSLYSCKSLTAVRLANNRLEGQILPDI 607

Query: 296 IKLKSL------------------ILMGCKNLNVLFLTMNFMNEATPNYDQNKISDGFQN 337
           + L+SL                  +LMGC+NL+ + LT NF NE  P+ D    S+GFQ 
Sbjct: 608 LALQSLSFLSISKNNLTNITGAIRMLMGCRNLSTVILTQNFFNERLPDDDSILDSNGFQR 667

Query: 338 LRAVSLAGCQLTGQVPLWLSKLTKLEVLLLSGNQITGSIPGWFGNLPSLFYFALSQNNIS 397
           L+ + L GC+ TGQVP WL+KL+KLEVL LS NQITGSIPGW G LPSLFY  LS N IS
Sbjct: 668 LQVLGLGGCRFTGQVPTWLAKLSKLEVLDLSLNQITGSIPGWLGTLPSLFYIDLSSNLIS 727

Query: 398 GEFPKELSRLQPLVIEQ--NKFNRNKPDLPFFLFPNQNSTSHQYNRIFGLRPTIFLANNS 455
           GEFPKE+ RL  L  E+   + +++  +LP F+ PN N+T+ QY ++  L P I+L NNS
Sbjct: 728 GEFPKEIIRLPRLTSEEAATEVDQSYLELPVFVMPN-NATNLQYKQLSNLPPAIYLRNNS 786

Query: 456 LSGRIPAETGQLKFLNVLDLGNNNFAGSIPNQISQLTILERLDLSKNHLS---------- 505
           LSG IP E GQLKF+++LDL  NNF+GSIP+QIS LT LE+LDLS NHLS          
Sbjct: 787 LSGNIPTEIGQLKFIHILDLSYNNFSGSIPDQISNLTNLEKLDLSGNHLSGEIPGSLRSL 846

Query: 506 ---------ENNLQGPIPSGGQLHTFPPSSFEGNPEFCSDIANRSSTTEPRTT 549
                     N+L+G IPSGGQ  TFP SSFEGNP  C     RS + +P TT
Sbjct: 847 HFLSSFNVANNSLEGAIPSGGQFDTFPNSSFEGNPGLCGPPLQRSCSNQPGTT 899




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255537393|ref|XP_002509763.1| Leucine-rich repeat receptor protein kinase EXS precursor, putative [Ricinus communis] gi|223549662|gb|EEF51150.1| Leucine-rich repeat receptor protein kinase EXS precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224074123|ref|XP_002304261.1| predicted protein [Populus trichocarpa] gi|222841693|gb|EEE79240.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224138536|ref|XP_002326627.1| predicted protein [Populus trichocarpa] gi|222833949|gb|EEE72426.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|219718185|gb|ACL35341.1| receptor kinase [Gossypium barbadense] Back     alignment and taxonomy information
>gi|449436222|ref|XP_004135892.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Cucumis sativus] gi|449491098|ref|XP_004158799.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255577318|ref|XP_002529540.1| Phytosulfokine receptor precursor, putative [Ricinus communis] gi|223530988|gb|EEF32843.1| Phytosulfokine receptor precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147832546|emb|CAN68301.1| hypothetical protein VITISV_009907 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297841971|ref|XP_002888867.1| hypothetical protein ARALYDRAFT_476358 [Arabidopsis lyrata subsp. lyrata] gi|297334708|gb|EFH65126.1| hypothetical protein ARALYDRAFT_476358 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356504209|ref|XP_003520891.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query555
TAIR|locus:2020402729 RLP2 "AT1G17240" [Arabidopsis 0.816 0.621 0.4 8.2e-83
TAIR|locus:2051628 1008 PSKR1 "phytosulfokin receptor 0.807 0.444 0.345 1.7e-61
TAIR|locus:2020382756 RLP3 "AT1G17250" [Arabidopsis 0.796 0.584 0.336 4.2e-56
TAIR|locus:2207056 1095 PSY1R "PSY1 receptor" [Arabido 0.787 0.399 0.325 8.2e-55
TAIR|locus:2154709 1036 PSKR2 "phytosylfokine-alpha re 0.821 0.440 0.319 2.4e-51
TAIR|locus:2181042 967 AT5G01890 [Arabidopsis thalian 0.841 0.482 0.299 4.7e-42
TAIR|locus:2138268 1045 AT4G08850 [Arabidopsis thalian 0.848 0.450 0.284 3.8e-40
TAIR|locus:2046525 1124 AT2G33170 [Arabidopsis thalian 0.787 0.388 0.292 7.4e-40
TAIR|locus:2169975 993 HSL2 "HAESA-like 2" [Arabidops 0.810 0.453 0.299 9.1e-40
TAIR|locus:2019255 1106 AT1G74360 [Arabidopsis thalian 0.630 0.316 0.271 1.1e-39
TAIR|locus:2020402 RLP2 "AT1G17240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 830 (297.2 bits), Expect = 8.2e-83, P = 8.2e-83
 Identities = 192/480 (40%), Positives = 264/480 (55%)

Query:    53 ISHLNLSHNHVHGPLPINSFHFLTLLEIIDLSYNSLSGELTGLIPSLAWNHSFCSMRLLD 112
             I  L+LS N + G +  +S +    + +I  S+N  +   TG IPS     S   +  LD
Sbjct:   171 IQTLDLSSNLLEGEILRSSVYLQGTINLI--SFNVSNNSFTGPIPSFMCRSS-PQLSKLD 227

Query:   113 FSYNDFSSQVPPRLGNCSRLKSFQAGYSNLLRSLPDDIYAAASLEEPSLHFNKLSGFISN 172
             FSYNDFS  +   LG C RL   QAG++NL   +P +IY  + LE+  L  N+L+G I N
Sbjct:   228 FSYNDFSGHISQELGRCLRLTVLQAGFNNLSGVIPSEIYNLSELEQLFLPANQLTGKIDN 287

Query:   173 DIINLTSLLVLELYSKELIGSIPRDIGXXXXXXXXXXXXXXXSGSLPSSMMNCTNLKTLN 232
             +I  L  L  L LYS  L G IP DIG               +G++P S+ NCT L  LN
Sbjct:   288 NITRLRKLTSLALYSNHLEGEIPMDIGNLSSLRSLQLHINNINGTVPLSLANCTKLVKLN 347

Query:   233 LMGNLFAGNLSAYNFSVLSQLETIDLYINMFTGSFLLTLTSCRLLTALRLACNQLEGQIP 292
             L  N   G L+   FS L  L+ +DL  N FTG+    + SC+ LTA+R A N+L G+I 
Sbjct:   348 LRVNQLGGGLTELEFSQLQSLKVLDLGNNSFTGALPDKIFSCKSLTAIRFAGNKLTGEIS 407

Query:   293 PEIIKLKSL------------------ILMGCKNLNVLFLTMNFMNEATPNYDQNKISDG 334
             P++++L+SL                  IL GC+ L+ L L  NF +E  P+ +     DG
Sbjct:   408 PQVLELESLSFMGLSDNKLTNITGALSILQGCRKLSTLILAKNFYDETVPSKEDFLSPDG 467

Query:   335 FQNLRAVSLAGCQLTGQVPXXXXXXXXXXXXXXXGNQITGSIPGWFGNLPSLFYFALSQN 394
             F  LR   +  C+L G++P                N+  GSIPGW G LP LFY  LS N
Sbjct:   468 FPKLRIFGVGACRLRGEIPAWLINLNKVEVMDLSMNRFVGSIPGWLGTLPDLFYLDLSDN 527

Query:   395 NISGEFPKELSRLQPLVIEQNKFNRNKPDLPFFLFPNQNSTSHQYNRIFGLRPTIFLANN 454
              ++GE PKEL +L+ L+ ++   N N  +LP FL PN  +T+ QYN+++   PTI++  N
Sbjct:   528 LLTGELPKELFQLRALMSQKITEN-NYLELPIFLNPNNVTTNQQYNKLYSFPPTIYIRRN 586

Query:   455 SLSGRIPAETGQLKFLNVLDLGNNNFAGSIPNQISQLTILERLDLSKNHLSENNLQGPIP 514
             +L+G IP E GQLK L++L+L  NN +GSIP+++S LT LERLDLS N     NL G IP
Sbjct:   587 NLTGSIPVEVGQLKVLHILELLGNNLSGSIPDELSNLTNLERLDLSNN-----NLSGSIP 641


GO:0004672 "protein kinase activity" evidence=ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2051628 PSKR1 "phytosulfokin receptor 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020382 RLP3 "AT1G17250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2207056 PSY1R "PSY1 receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154709 PSKR2 "phytosylfokine-alpha receptor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181042 AT5G01890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2138268 AT4G08850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046525 AT2G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169975 HSL2 "HAESA-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019255 AT1G74360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00033978001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (1078 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query555
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-57
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-45
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-35
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.001
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  207 bits (527), Expect = 1e-57
 Identities = 163/515 (31%), Positives = 236/515 (45%), Gaps = 57/515 (11%)

Query: 53  ISHLNLSHNHVHGPLPINSFHFLTLLEIIDLSYNSLSGELTGLIPSLAWNHSFCSMRLLD 112
           + +LNLS+N+  G +P      +  LE +DLS N LSGE+   I       SF S+++LD
Sbjct: 120 LRYLNLSNNNFTGSIPRG---SIPNLETLDLSNNMLSGEIPNDI------GSFSSLKVLD 170

Query: 113 FSYNDFSSQVPPRLGNCSRLKSFQAGYSNLLRSLPDDIYAAASLEEPSLHFNKLSGFISN 172
              N    ++P  L N + L+      + L+  +P ++    SL+   L +N LSG I  
Sbjct: 171 LGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPY 230

Query: 173 DIINLTSLLVLELYSKELIGSIPRDIGKLTNLKYLLLYRNNLSGSLPSSMMNCTNLKTLN 232
           +I  LTSL  L+L    L G IP  +G L NL+YL LY+N LSG +P S+ +   L +L+
Sbjct: 231 EIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLD 290

Query: 233 LMGNLFAGNLSAYNFSVLSQLETIDLYINMFTGSFLLTLTSCRLLTALRLACNQLEGQIP 292
           L  N  +G +       L  LE + L+ N FTG   + LTS   L  L+L  N+  G+IP
Sbjct: 291 LSDNSLSGEIPEL-VIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIP 349

Query: 293 PEIIKLKSLILMGCKNLNVLFLTMNFMNEATPNYDQNKISDGFQNLRAVSLAGCQLTGQV 352
             + K          NL VL L+ N +    P   +   S G  NL  + L    L G++
Sbjct: 350 KNLGKH--------NNLTVLDLSTNNLTGEIP---EGLCSSG--NLFKLILFSNSLEGEI 396

Query: 353 PLWLSKLTKLEVLLLSGNQITGSIPGWFGNLPSLFYFALSQNNISGEFPK---ELSRLQP 409
           P  L     L  + L  N  +G +P  F  LP +++  +S NN+ G       ++  LQ 
Sbjct: 397 PKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQM 456

Query: 410 LVIEQNKFNRNKPDLPFFLFPNQNSTSHQYNRIFGLRPTIF----------LANNSLSGR 459
           L + +NKF    PD   F      +     N+  G  P             L+ N LSG 
Sbjct: 457 LSLARNKFFGGLPD--SFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGE 514

Query: 460 IPAETGQLKFLNVLDLGNNNFAGSIPNQISQLTILERLDLSKNHL--------------- 504
           IP E    K L  LDL +N  +G IP   S++ +L +LDLS+N L               
Sbjct: 515 IPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLV 574

Query: 505 ----SENNLQGPIPSGGQLHTFPPSSFEGNPEFCS 535
               S N+L G +PS G       S+  GN + C 
Sbjct: 575 QVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCG 609


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 555
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.94
KOG4237498 consensus Extracellular matrix protein slit, conta 99.93
KOG4237498 consensus Extracellular matrix protein slit, conta 99.92
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.81
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.81
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.71
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.71
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.69
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
PLN03150623 hypothetical protein; Provisional 99.18
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.16
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.15
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.1
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.02
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.99
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.97
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.96
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.94
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.94
PLN03150623 hypothetical protein; Provisional 98.91
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.9
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.89
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.87
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.85
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.82
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.81
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.76
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.61
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.61
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.6
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.5
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.18
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.16
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.11
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.11
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.08
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.05
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.02
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.9
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.84
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.78
PRK15386426 type III secretion protein GogB; Provisional 97.65
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.62
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.61
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.6
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.6
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.54
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.47
PRK15386426 type III secretion protein GogB; Provisional 97.46
KOG4341483 consensus F-box protein containing LRR [General fu 97.42
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.69
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.64
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.57
KOG4341483 consensus F-box protein containing LRR [General fu 96.52
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.84
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.78
KOG4308 478 consensus LRR-containing protein [Function unknown 95.64
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.54
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.05
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.53
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.94
smart0037026 LRR Leucine-rich repeats, outliers. 93.94
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.26
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.81
smart0037026 LRR Leucine-rich repeats, outliers. 90.81
KOG4308478 consensus LRR-containing protein [Function unknown 90.2
KOG0473 326 consensus Leucine-rich repeat protein [Function un 89.71
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 88.93
KOG0473 326 consensus Leucine-rich repeat protein [Function un 88.65
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 87.61
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.65
KOG3864221 consensus Uncharacterized conserved protein [Funct 83.4
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 81.98
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.4e-52  Score=468.68  Aligned_cols=515  Identities=30%  Similarity=0.421  Sum_probs=356.9

Q ss_pred             CCCCceEecccCcceeeccCceeeeeccCCCCCccccCCccccCCCCCCEEEccCCcCcCcCchhHHhcCCCCCEEEccC
Q 040254            6 AAGGQIISCHTEKSILRNHGGFNILMQPAMNKLVQRYHLPSIGNLTHISHLNLSHNHVHGPLPINSFHFLTLLEIIDLSY   85 (555)
Q Consensus         6 ~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~l~~L~~L~L~~n~~~~~i~~~~~~~l~~L~~L~Ls~   85 (555)
                      -|+....+|.|.+..|...  ..++.++++.+.+++.++..|..+++|++|+|++|.+.+.+|...|..+++|++|+|++
T Consensus        50 ~w~~~~~~c~w~gv~c~~~--~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~  127 (968)
T PLN00113         50 NWNSSADVCLWQGITCNNS--SRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSN  127 (968)
T ss_pred             CCCCCCCCCcCcceecCCC--CcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcC
Confidence            3555557899998888753  36888999999999999999999999999999999999899999998899999999999


Q ss_pred             CcCccccCCCCccccccCCCCCccEEEccCCcCCccCCccccCCCCCcEEEccCCCCCCCCcHhhhcCCCCCeeEeeccc
Q 040254           86 NSLSGELTGLIPSLAWNHSFCSMRLLDFSYNDFSSQVPPRLGNCSRLKSFQAGYSNLLRSLPDDIYAAASLEEPSLHFNK  165 (555)
Q Consensus        86 n~i~~~~~~~~~~~~~~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~l~~n~  165 (555)
                      |++++..|..        .+++|++|++++|.+.+.+|..++++++|++|++++|.+.+.+|..+.++++|++|++++|.
T Consensus       128 n~l~~~~p~~--------~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~  199 (968)
T PLN00113        128 NNFTGSIPRG--------SIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQ  199 (968)
T ss_pred             CccccccCcc--------ccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCC
Confidence            9998765531        34588888888888887788888888888888888888888888888888888888888888


Q ss_pred             CcccccccccCCCCCcEEEcccCccccCCCcCccCCCCCCeeeCccCcCcccCCccccCCCCCCEEECcCccCccccCcc
Q 040254          166 LSGFISNDIINLTSLLVLELYSKELIGSIPRDIGKLTNLKYLLLYRNNLSGSLPSSMMNCTNLKTLNLMGNLFAGNLSAY  245 (555)
Q Consensus       166 i~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~~~~L~~L~l~~n~l~~~~~~~  245 (555)
                      +.+..|..+..+++|++|++++|.+.+.+|..+..+++|++|++++|.+.+..|..+..+++|++|++++|.+.+.++ .
T Consensus       200 l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p-~  278 (968)
T PLN00113        200 LVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIP-P  278 (968)
T ss_pred             CcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCc-h
Confidence            887778888888888888888888887888888888888888888888877777788888888888888887775555 4


Q ss_pred             cccCCCCCcEEEcccccccccccccccCCCCCcEEEcccceecccCChhhhhcccc----------------cccCCCCC
Q 040254          246 NFSVLSQLETIDLYINMFTGSFLLTLTSCRLLTALRLACNQLEGQIPPEIIKLKSL----------------ILMGCKNL  309 (555)
Q Consensus       246 ~~~~l~~L~~L~l~~n~~~~~~~~~l~~~~~L~~L~l~~n~~~~~~~~~l~~l~~l----------------~~~~~~~L  309 (555)
                      .+..+++|+.|++++|.+.+..+..+..+++|+.|++++|.+.+..|..+..+..+                .+..+++|
T Consensus       279 ~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L  358 (968)
T PLN00113        279 SIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNL  358 (968)
T ss_pred             hHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCC
Confidence            56677788888888887777777777777778888887777776666555433321                12223455


Q ss_pred             cEEEeccccCCCCCCccccccccCCCCCccEEEccCcccccccchhhhCCCCCcEEEccCCccccccCccccCCCCCcEE
Q 040254          310 NVLFLTMNFMNEATPNYDQNKISDGFQNLRAVSLAGCQLTGQVPLWLSKLTKLEVLLLSGNQITGSIPGWFGNLPSLFYF  389 (555)
Q Consensus       310 ~~L~l~~n~~~~~~~~~~~~~~~~~~~~L~~L~l~~n~i~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L  389 (555)
                      +.+++++|.+.+..+..+     ...++|+.|++++|.+.+..|.++..+++|+.|++++|++++..|..+..+++|+.|
T Consensus       359 ~~L~Ls~n~l~~~~p~~~-----~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L  433 (968)
T PLN00113        359 TVLDLSTNNLTGEIPEGL-----CSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFL  433 (968)
T ss_pred             cEEECCCCeeEeeCChhH-----hCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEE
Confidence            556665555554433322     233445555555555554555555555555555555555555555555555555555


Q ss_pred             EccCccCccccch---hhhccccchhhhccCCCCCCCCCccccCCCccccccccccc----------CCCCEEEccCccc
Q 040254          390 ALSQNNISGEFPK---ELSRLQPLVIEQNKFNRNKPDLPFFLFPNQNSTSHQYNRIF----------GLRPTIFLANNSL  456 (555)
Q Consensus       390 ~L~~n~l~~~~~~---~~~~l~~L~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~----------~~~~~l~L~~n~l  456 (555)
                      ++++|.+++.++.   .+.+|+.|++.+|.+....+..  .....++.+++..+.+.          .....|++++|.+
T Consensus       434 ~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~--~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l  511 (968)
T PLN00113        434 DISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDS--FGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKL  511 (968)
T ss_pred             ECcCCcccCccChhhccCCCCcEEECcCceeeeecCcc--cccccceEEECcCCccCCccChhhhhhhccCEEECcCCcc
Confidence            5555555544443   2334444445444432211100  00111222222211111          1123566666666


Q ss_pred             cccCChhccCCCCCCeeeCCCccceeecchhhhCCccCCeeeCCCCCCC-------------------CCcceecCCCCC
Q 040254          457 SGRIPAETGQLKFLNVLDLGNNNFAGSIPNQISQLTILERLDLSKNHLS-------------------ENNLQGPIPSGG  517 (555)
Q Consensus       457 ~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~l~~l~~L~~L~Ls~N~l~-------------------~~~l~~~ip~~~  517 (555)
                      ++.+|..+..+++|++|+|++|.+++.+|..+..+++|+.|||++|+++                   +|.+.|.+|...
T Consensus       512 ~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~  591 (968)
T PLN00113        512 SGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTG  591 (968)
T ss_pred             eeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcc
Confidence            6666666666666666666666666666666666666666666666665                   355679999988


Q ss_pred             CCCCCCCCccCCCcCCCCccc
Q 040254          518 QLHTFPPSSFEGNPEFCSDIA  538 (555)
Q Consensus       518 ~~~~l~~~~~~gNp~~c~~~~  538 (555)
                      .+.++....+.|||.+|+.+.
T Consensus       592 ~~~~~~~~~~~~n~~lc~~~~  612 (968)
T PLN00113        592 AFLAINASAVAGNIDLCGGDT  612 (968)
T ss_pred             hhcccChhhhcCCccccCCcc
Confidence            888999999999999998653



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query555
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-23
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 4e-23
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-13
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 106 bits (265), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 129/462 (27%), Positives = 203/462 (43%), Gaps = 35/462 (7%) Query: 44 LPSIGNLTHISHLNLSHNHVHGPLPINSFHFLTLLEIIDLSYNSLSGE-LTGLIPSLAWN 102 L S+G+ + + LN+S N + P ++ L LE++DLS NS+SG + G + S Sbjct: 116 LTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCG 175 Query: 103 HSFCSMRLLDFSYNDFSSQVPPRLGNCSRLKSFQAGYSNLLRSLPDDIYAAASLEEPSLH 162 ++ L S N S V + C L+ +N +P + ++L+ + Sbjct: 176 E----LKHLAISGNKISGDV--DVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDIS 228 Query: 163 FNKLSGFISNDIINLTSLLVLELYSKELIGSIPRDIGXXXXXXXXXXXXXXXSGSLPSSM 222 NKLSG S I T L +L + S + +G IP +G +P + Sbjct: 229 GNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFL 286 Query: 223 MN-CTNLKTLNLMGNLFAGNLSAYNFSVLSQLETIDLYINMFTGSF-LLTLTSCRLLTAL 280 C L L+L GN F G + + F S LE++ L N F+G + TL R L L Sbjct: 287 SGACDTLTGLDLSGNHFYGAVPPF-FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVL 345 Query: 281 RLACNQLEGQIPPEIIKLKSLILMGCKNLNVLFLTMNFMNEATPNYDQNKISDGFQNLRA 340 L+ N+ G++P + L + +L + + NF PN QN L+ Sbjct: 346 DLSFNEFSGELPESLTNLSASLLT------LDLSSNNFSGPILPNLCQNPK----NTLQE 395 Query: 341 VSLAGCQLTGQVPXXXXXXXXXXXXXXXGNQITGSIPGWFGNLPSLFYFALSQNNISGEF 400 + L TG++P N ++G+IP G+L L L N + GE Sbjct: 396 LYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEI 455 Query: 401 PKELSRLQPLVIEQNKFNRNKPDLPFFLFPNQNSTSHQYNRIFGLRPTIFLANNSLSGRI 460 P+EL ++ L FN ++P L N T+ + I L+NN L+G I Sbjct: 456 PQELMYVKTLETLILDFNDLTGEIPSGL---SNCTNLNW---------ISLSNNRLTGEI 503 Query: 461 PAETGQLKFLNVLDLGNNNFAGSIPNQISQLTILERLDLSKN 502 P G+L+ L +L L NN+F+G+IP ++ L LDL+ N Sbjct: 504 PKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTN 545
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query555
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-91
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-81
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-74
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-62
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-52
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-20
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-50
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-46
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-40
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-28
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-50
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-48
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-38
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-36
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-31
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-30
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-26
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-46
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-46
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-43
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-39
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-46
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-42
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-38
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-33
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-30
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-27
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-20
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-42
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-39
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-36
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-35
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-34
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-26
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-41
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-37
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-33
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-36
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-35
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-32
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-28
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-31
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-28
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-23
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-27
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-23
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-28
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-28
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-24
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-23
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-27
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-24
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-19
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-15
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-21
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-21
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-19
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-17
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-19
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-12
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-16
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-15
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 9e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-15
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-08
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  296 bits (759), Expect = 2e-91
 Identities = 138/583 (23%), Positives = 221/583 (37%), Gaps = 115/583 (19%)

Query: 44  LPSIGNLTHISHLNLSHNHVHGPLPINSFHFLTLLEIIDLSYNSLSGE------------ 91
           +P +G+ + + HL++S N + G     +    T L+++++S N   G             
Sbjct: 216 IPFLGDCSALQHLDISGNKLSGDFS-RAISTCTELKLLNISSNQFVGPIPPLPLKSLQYL 274

Query: 92  ------LTGLIPSLAWNHSFCSMRLLDFSYNDFSSQVPPRLGNCSRLKSFQAGYSNLLRS 145
                  TG IP    + +  ++  LD S N F   VPP  G+CS L+S     +N    
Sbjct: 275 SLAENKFTGEIPD-FLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGE 333

Query: 146 LPDD-IYAAASLEEPSLHFNKLSGFISNDIINLT-SLLVLELYSKELIGSIPRDIGK--L 201
           LP D +     L+   L FN+ SG +   + NL+ SLL L+L S    G I  ++ +   
Sbjct: 334 LPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPK 393

Query: 202 TNLKYLLLYRNNLSGSLPSSMMNCTNLKTLNLMGNLFAGNLSAYNFSVLSQLETIDLYIN 261
             L+ L L  N  +G +P ++ NC+ L +L+L  N  +G + + +   LS+L  + L++N
Sbjct: 394 NTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPS-SLGSLSKLRDLKLWLN 452

Query: 262 MFTGSFLLTLTSCRLLTALRLACNQLEGQIPPEIIKLKSLILMGCKNLNVLFLTMNFMNE 321
           M  G     L   + L  L L  N L G+IP  +          C NLN + L+ N    
Sbjct: 453 MLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSN--------CTNLNWISLSNN---- 500

Query: 322 ATPNYDQNKISDGFQNLRAVSLAGCQLTGQVPLWLSKLTKLEVLLLSGNQITGSIPGWFG 381
                                    +LTG++P W+ +L  L +L LS N  +G+IP   G
Sbjct: 501 -------------------------RLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELG 535

Query: 382 NLPSLFYFALSQNNISGEFPKELSRLQPLVIEQNKFNRNKPDLPFFLFPNQNSTSHQYNR 441
           +  SL +  L+ N  +G  P  + +    +       +    +       +   +     
Sbjct: 536 DCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLE 595

Query: 442 IFGLRP----------TIFLANNSLSGRIPAETGQLKFLNVLDLGNNNFAGSIPNQISQL 491
             G+R              + +    G           +  LD+  N  +G IP +I  +
Sbjct: 596 FQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSM 655

Query: 492 TILERLDLSKNH-------------------LSENNL----------------------- 509
             L  L+L  N                    LS N L                       
Sbjct: 656 PYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNN 715

Query: 510 -QGPIPSGGQLHTFPPSSFEGNPEFCSDIANRSSTTEPRTTTN 551
             GPIP  GQ  TFPP+ F  NP  C     R   +      +
Sbjct: 716 LSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAH 758


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query555
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.98
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.89
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.83
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.83
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.79
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.73
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.73
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.73
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.68
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.66
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.64
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.63
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.62
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.62
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.61
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.6
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.59
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.56
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.56
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.55
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.55
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.53
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.47
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.42
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.38
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.37
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.36
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.35
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.35
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.3
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.3
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.27
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.23
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.19
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.1
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.1
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.74
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.58
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.54
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.43
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.08
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.07
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.96
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.91
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.43
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.28
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.19
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.02
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.1e-57  Score=498.09  Aligned_cols=531  Identities=30%  Similarity=0.424  Sum_probs=349.3

Q ss_pred             cCCCCceEecccCcceeeccCceeeeeccCCCCCcccc--------------------------CCccccCCCCCCEEEc
Q 040254            5 PAAGGQIISCHTEKSILRNHGGFNILMQPAMNKLVQRY--------------------------HLPSIGNLTHISHLNL   58 (555)
Q Consensus         5 ~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~i~~~--------------------------~~~~~~~l~~L~~L~L   58 (555)
                      .-|.....+|.|.++.|. .  ...+.++++.+.+.|.                          ++..|..+++|++|+|
T Consensus        31 ~~W~~~~~~C~w~gv~C~-~--~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~L  107 (768)
T 3rgz_A           31 PDWSSNKNPCTFDGVTCR-D--DKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVSGFKCSASLTSLDL  107 (768)
T ss_dssp             TTCCTTSCGGGSTTEEEE-T--TEEEEEECTTSCCCEEHHHHHHHTTTCTTCCEEECTTSCEEECCCCCCCCTTCCEEEC
T ss_pred             cCCCCCCCCcCCcceEEC-C--CcEEEEECCCCCcCCccCccChhHhccCcccccCCcCCCcCCCchhhccCCCCCEEEC
Confidence            345545578999999887 2  3566666666666554                          2246777777788888


Q ss_pred             cCCcCcCcCch-hHHhcCCCCCEEEccCCcCccccCCCC-ccc-------------------------------------
Q 040254           59 SHNHVHGPLPI-NSFHFLTLLEIIDLSYNSLSGELTGLI-PSL-------------------------------------   99 (555)
Q Consensus        59 ~~n~~~~~i~~-~~~~~l~~L~~L~Ls~n~i~~~~~~~~-~~~-------------------------------------   99 (555)
                      ++|.+.+.+|. ..+.++++|++|++++|.+.+..+..+ ..+                                     
T Consensus       108 s~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~  187 (768)
T 3rgz_A          108 SRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISG  187 (768)
T ss_dssp             CSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCS
T ss_pred             CCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCC
Confidence            87777765654 145667777777777776664444322 000                                     


Q ss_pred             ------cccCCCCCccEEEccCCcCCccCCccccCCCCCcEEEccCCCCCCCCcHhhhcCCCCCeeEeecccCccccccc
Q 040254          100 ------AWNHSFCSMRLLDFSYNDFSSQVPPRLGNCSRLKSFQAGYSNLLRSLPDDIYAAASLEEPSLHFNKLSGFISND  173 (555)
Q Consensus       100 ------~~~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~l~~n~i~~~~~~~  173 (555)
                            .....+++|++|++++|.+.+.+|. ++++++|++|++++|.+.+.+|..+.++++|++|++++|.+++..+..
T Consensus       188 n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~  266 (768)
T 3rgz_A          188 NKISGDVDVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL  266 (768)
T ss_dssp             SEEESCCBCTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC
T ss_pred             CcccccCCcccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc
Confidence                  0001345566666666666654444 666777777777777766666777777777777777777766544433


Q ss_pred             ccCCCCCcEEEcccCccccCCCcCccCC-CCCCeeeCccCcCcccCCccccCCCCCCEEECcCccCccccCcccccCCCC
Q 040254          174 IINLTSLLVLELYSKELIGSIPRDIGKL-TNLKYLLLYRNNLSGSLPSSMMNCTNLKTLNLMGNLFAGNLSAYNFSVLSQ  252 (555)
Q Consensus       174 ~~~l~~L~~L~L~~n~~~~~~~~~l~~l-~~L~~L~L~~n~l~~~~~~~l~~~~~L~~L~l~~n~l~~~~~~~~~~~l~~  252 (555)
                        .+++|++|++++|.+.+.+|..+... ++|++|++++|.+.+..|..+..+++|++|++++|.+.+.++...+..+++
T Consensus       267 --~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~  344 (768)
T 3rgz_A          267 --PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRG  344 (768)
T ss_dssp             --CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTT
T ss_pred             --ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCC
Confidence              66677777777777766667666554 788888888888777777778888888888888887776676555777777


Q ss_pred             CcEEEcccccccccccccccCCC-CCcEEEcccceeccc--------------------------CChhhhhcccc----
Q 040254          253 LETIDLYINMFTGSFLLTLTSCR-LLTALRLACNQLEGQ--------------------------IPPEIIKLKSL----  301 (555)
Q Consensus       253 L~~L~l~~n~~~~~~~~~l~~~~-~L~~L~l~~n~~~~~--------------------------~~~~l~~l~~l----  301 (555)
                      |+.|++++|.+++..+..+..++ +|++|++++|.+.+.                          +|..+..+..+    
T Consensus       345 L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~  424 (768)
T 3rgz_A          345 LKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH  424 (768)
T ss_dssp             CCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEE
T ss_pred             CCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEE
Confidence            77777777777655555554443 455555555544443                          33333322211    


Q ss_pred             ------------cccCCCCCcEEEeccccCCCCCCccccccccCCCCCccEEEccCcccccccchhhhCCCCCcEEEccC
Q 040254          302 ------------ILMGCKNLNVLFLTMNFMNEATPNYDQNKISDGFQNLRAVSLAGCQLTGQVPLWLSKLTKLEVLLLSG  369 (555)
Q Consensus       302 ------------~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~~~~~L~~L~l~~n~i~~~~~~~l~~l~~L~~L~L~~  369 (555)
                                  .+..+++|+.|++++|.+.+..+..+     ..+++|++|++++|++++.+|.++..+++|++|++++
T Consensus       425 Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~-----~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~  499 (768)
T 3rgz_A          425 LSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL-----MYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSN  499 (768)
T ss_dssp             CCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGG-----GGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCS
T ss_pred             CcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHH-----cCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccC
Confidence                        12233444444554444444433333     4567778888888877777777788888888888888


Q ss_pred             CccccccCccccCCCCCcEEEccCccCccccchhhhc---cccchhhhccCCCCCCCCCccccCC--C------------
Q 040254          370 NQITGSIPGWFGNLPSLFYFALSQNNISGEFPKELSR---LQPLVIEQNKFNRNKPDLPFFLFPN--Q------------  432 (555)
Q Consensus       370 n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~---l~~L~~~~~~~~~~~~~l~~~~~~~--~------------  432 (555)
                      |++.+.+|..+..+++|++|++++|++++.+|..+..   |+.|++.+|.+....+   ......  .            
T Consensus       500 N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip---~~~~~~~~~~~~~~~~~~~~~  576 (768)
T 3rgz_A          500 NRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIP---AAMFKQSGKIAANFIAGKRYV  576 (768)
T ss_dssp             SCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCC---GGGGTTTTCBCCSTTCSCEEE
T ss_pred             CccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCC---hHHhcccchhhhhcccccccc
Confidence            8888778888888888888888888888777766544   5556666666542211   000000  0            


Q ss_pred             ----------------------------------cccccccc----------cccCCCCEEEccCccccccCChhccCCC
Q 040254          433 ----------------------------------NSTSHQYN----------RIFGLRPTIFLANNSLSGRIPAETGQLK  468 (555)
Q Consensus       433 ----------------------------------~~~~~~~~----------~~~~~~~~l~L~~n~l~~~~~~~~~~l~  468 (555)
                                                        .......+          ........||+++|++++.+|..++.++
T Consensus       577 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~  656 (768)
T 3rgz_A          577 YIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMP  656 (768)
T ss_dssp             EEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCT
T ss_pred             ccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccc
Confidence                                              00000000          0012345788888888888888888888


Q ss_pred             CCCeeeCCCccceeecchhhhCCccCCeeeCCCCCCC-------------------CCcceecCCCCCCCCCCCCCccCC
Q 040254          469 FLNVLDLGNNNFAGSIPNQISQLTILERLDLSKNHLS-------------------ENNLQGPIPSGGQLHTFPPSSFEG  529 (555)
Q Consensus       469 ~L~~L~Ls~N~l~~~~~~~l~~l~~L~~L~Ls~N~l~-------------------~~~l~~~ip~~~~~~~l~~~~~~g  529 (555)
                      .|++|+|++|++++.+|..++.+++|+.|||++|+++                   +|+++|.||...++.++...+|.|
T Consensus       657 ~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~g  736 (768)
T 3rgz_A          657 YLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLN  736 (768)
T ss_dssp             TCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCS
T ss_pred             cCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcC
Confidence            8888888888888888888888888888888888877                   578889999999999999999999


Q ss_pred             CcCCCCcccCCCCCCCCCCCc
Q 040254          530 NPEFCSDIANRSSTTEPRTTT  550 (555)
Q Consensus       530 Np~~c~~~~~~~~~~~~~~~~  550 (555)
                      ||.+||.|+. .|....+++-
T Consensus       737 N~~Lcg~~l~-~C~~~~~~~~  756 (768)
T 3rgz_A          737 NPGLCGYPLP-RCDPSNADGY  756 (768)
T ss_dssp             CTEEESTTSC-CCCSCC----
T ss_pred             CchhcCCCCc-CCCCCccCCC
Confidence            9999999886 8988777653



>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 555
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.003
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-08
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 80.8 bits (198), Expect = 5e-17
 Identities = 74/361 (20%), Positives = 120/361 (33%), Gaps = 24/361 (6%)

Query: 44  LPSIGNLTHISHLNLSHNHVHGPLPINSFHFLTLLEIIDLSYNSLSG-----ELTGLIPS 98
             S  +L  ++ L      +     I+   +L  L  I+ S N L+       LT L+  
Sbjct: 37  TVSQTDLDQVTTLQADRLGIKS---IDGVEYLNNLTQINFSNNQLTDITPLKNLTKLVDI 93

Query: 99  LAWNHSFCSMRLLDFSYNDFSSQVPPRLGNCSRLKSFQAGYSNLLRSLPDDIYAAASLEE 158
           L  N+    +  L    N     +                 + L  S       +A    
Sbjct: 94  LMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGL 153

Query: 159 PSLHFNKLSGFISNDIINLTSLLVLELYSKELIGSIPRDIGKLTNLKYLLLYRNNLSGSL 218
            SL        +++         +  L       S    + KLTNL+ L+   N +S   
Sbjct: 154 TSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDIT 213

Query: 219 PSSMMNCTNLKTLNLMGNLFAGNLSAYNFSVLSQLETIDLYINMFTGSFLLTLTSCRLLT 278
           P  +   TNL  L+L GN           + L+ L  +DL  N  +   L  L+    LT
Sbjct: 214 P--LGILTNLDELSLNGNQLKD---IGTLASLTNLTDLDLANNQISN--LAPLSGLTKLT 266

Query: 279 ALRLACNQLEGQIPPEIIKLKSLILMGCKNLNVLFLTMNFMNEATPNYDQNKISD----- 333
            L+L  NQ+    P   +   + + +    L  +    N  N        N ISD     
Sbjct: 267 ELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVS 326

Query: 334 GFQNLRAVSLAGCQLTGQVPLWLSKLTKLEVLLLSGNQITGSIPGWFGNLPSLFYFALSQ 393
               L+ +  A  +++      L+ LT +  L    NQI+   P    NL  +    L+ 
Sbjct: 327 SLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHNQISDLTP--LANLTRITQLGLND 382

Query: 394 N 394
            
Sbjct: 383 Q 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query555
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.81
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.76
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.69
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.68
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.46
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.45
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.42
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.4
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.37
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.21
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.19
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.16
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.12
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.21
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.14
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.88
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.52
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.35
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.24
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.95  E-value=6.2e-28  Score=232.61  Aligned_cols=259  Identities=30%  Similarity=0.469  Sum_probs=155.9

Q ss_pred             CCcEEEcccCcccc--CCCcCccCCCCCCeeeCcc-CcCcccCCccccCCCCCCEEECcCccCccccCcccccCCCCCcE
Q 040254          179 SLLVLELYSKELIG--SIPRDIGKLTNLKYLLLYR-NNLSGSLPSSMMNCTNLKTLNLMGNLFAGNLSAYNFSVLSQLET  255 (555)
Q Consensus       179 ~L~~L~L~~n~~~~--~~~~~l~~l~~L~~L~L~~-n~l~~~~~~~l~~~~~L~~L~l~~n~l~~~~~~~~~~~l~~L~~  255 (555)
                      .++.|+++++.+.+  .+|..++.+++|++|+|++ |.+.+.+|..+.++++|++|++++|.+.+..+ ..+..+..|+.
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~-~~~~~~~~L~~  129 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIP-DFLSQIKTLVT  129 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECC-GGGGGCTTCCE
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhcccccccccc-ccccchhhhcc
Confidence            45566666665554  2455555666666666654 45555555555555555555555555543222 33444444444


Q ss_pred             EEcccccccccccccccCCCCCcEEEcccceecccCChhhhhcccccccCCCCCcEEEeccccCCCCCCccccccccCCC
Q 040254          256 IDLYINMFTGSFLLTLTSCRLLTALRLACNQLEGQIPPEIIKLKSLILMGCKNLNVLFLTMNFMNEATPNYDQNKISDGF  335 (555)
Q Consensus       256 L~l~~n~~~~~~~~~l~~~~~L~~L~l~~n~~~~~~~~~l~~l~~l~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~~~~  335 (555)
                      ++++.|.+.+..+..+..++.+                                                          
T Consensus       130 l~l~~N~~~~~~p~~l~~l~~L----------------------------------------------------------  151 (313)
T d1ogqa_         130 LDFSYNALSGTLPPSISSLPNL----------------------------------------------------------  151 (313)
T ss_dssp             EECCSSEEESCCCGGGGGCTTC----------------------------------------------------------
T ss_pred             cccccccccccCchhhccCccc----------------------------------------------------------
Confidence            4444444443333334444444                                                          


Q ss_pred             CCccEEEccCcccccccchhhhCCCCC-cEEEccCCccccccCccccCCCCCcEEEccCccCccccchhhhccccchhhh
Q 040254          336 QNLRAVSLAGCQLTGQVPLWLSKLTKL-EVLLLSGNQITGSIPGWFGNLPSLFYFALSQNNISGEFPKELSRLQPLVIEQ  414 (555)
Q Consensus       336 ~~L~~L~l~~n~i~~~~~~~l~~l~~L-~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~~~  414 (555)
                         +.+++++|.+.+.+|..+..+..+ +.+++++|++++..+..+..+.. ..++++++...+.+|..+..++.+.   
T Consensus       152 ---~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~-~~l~l~~~~~~~~~~~~~~~~~~l~---  224 (313)
T d1ogqa_         152 ---VGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNL-AFVDLSRNMLEGDASVLFGSDKNTQ---  224 (313)
T ss_dssp             ---CEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCC-SEEECCSSEEEECCGGGCCTTSCCS---
T ss_pred             ---ceeecccccccccccccccccccccccccccccccccccccccccccc-ccccccccccccccccccccccccc---
Confidence               444444444444444444444433 44555555555444444444332 2455555555555554444444443   


Q ss_pred             ccCCCCCCCCCccccCCCcccccccccccCCCCEEEccCccccccCChhccCCCCCCeeeCCCccceeecchhhhCCccC
Q 040254          415 NKFNRNKPDLPFFLFPNQNSTSHQYNRIFGLRPTIFLANNSLSGRIPAETGQLKFLNVLDLGNNNFAGSIPNQISQLTIL  494 (555)
Q Consensus       415 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~l~L~~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~l~~l~~L  494 (555)
                                                       .+++++|.+++.++ .+..+++|+.|+|++|++++.+|+.+.++++|
T Consensus       225 ---------------------------------~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L  270 (313)
T d1ogqa_         225 ---------------------------------KIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFL  270 (313)
T ss_dssp             ---------------------------------EEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTC
T ss_pred             ---------------------------------cccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCC
Confidence                                             35555565554433 46677889999999999999999999999999


Q ss_pred             CeeeCCCCCCCCCcceecCCCCCCCCCCCCCccCCCcCCCCcccCCCCC
Q 040254          495 ERLDLSKNHLSENNLQGPIPSGGQLHTFPPSSFEGNPEFCSDIANRSST  543 (555)
Q Consensus       495 ~~L~Ls~N~l~~~~l~~~ip~~~~~~~l~~~~~~gNp~~c~~~~~~~~~  543 (555)
                      ++|||++|+|+     |.+|+...++.+..+++.||+.+|+.|+. .|.
T Consensus       271 ~~L~Ls~N~l~-----g~iP~~~~L~~L~~l~l~~N~~l~g~plp-~c~  313 (313)
T d1ogqa_         271 HSLNVSFNNLC-----GEIPQGGNLQRFDVSAYANNKCLCGSPLP-ACT  313 (313)
T ss_dssp             CEEECCSSEEE-----EECCCSTTGGGSCGGGTCSSSEEESTTSS-CCC
T ss_pred             CEEECcCCccc-----ccCCCcccCCCCCHHHhCCCccccCCCCC-CCC
Confidence            99999999875     88998878889999999999999998763 563



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure