Citrus Sinensis ID: 040304

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000

MAGAPGSRIIVTTRSRDVASKMGPVKYYGLKLLSDDDCWSVFVAHAFDSRDAGTHGNFESTRQRVVEKCKGLPLAARALGGLLGSKQRVDEWRAILDSKIWDLEDETEVPSVLKLSYHHLPSHLKRCFAYCAILPKDYEFQEEELVLLWIAEGLIQQSKDRKQADDLGSEYFHDLLSRSLFQKSSNSGSKFVMHDLVHDLAQWASGETCFRLDDQFSADRQSNVFEKVRHSSYVRSGDCDGMGVRCDGMNKFKVLDKVENLRTFLPIFVEECFFSPAGYISPMVISDLLPKCKKLRVLSLGRYRISEVPTSIGCLKHLRYLNFSESWIKCLPEAITSLFNLEILILSDCRLLLKLPSSIGNLVNLYHLDIDGANRLCELPLGMKELKCLRTLTNFIVGKDSGCALKDLKNWKFLRGRLCISGLENVIDSQEANEALLRVKKDLEVLKLEWRARRDGDSVDEVREKNILDMLKPHGNIKRLVINSYGGTRFPSWIGDPSFSNVAVLILKNCRRSTSLPSLGQLCSLKDLTIVRMSALKGIGSEINGECCSKPFPSLQTLYFEDLQVWEKWEPNTENDEHVQAFPRLQKLFIHKCPKLSGRLPNHLPSLEKIVITECRQLVISLPSVPALCKLKIDGCKRLVCDGLSESKSLNKMTLWNISEFENWSSQKFQNVEHLEIVGCEGSSTCLDLESLSVFRCPLLTCLWTGGWLPVTLKRLEIWCCYNFKVLTSECQLPVAIEALTISNCSNLESIAERFYDDACLRSILISSCDNLKSLPIGLNNLSHLHRISIEGCHNLVSLPEDALPSSVVDVSIEECDKLKGPLPTGKISSLQELSLKKCPGIVFFPEEGLSTNLTYLEISGANIYKPLVNWGFHKLTSLRKLCINGCSDAASFPEVEKGVILPTSLTWIRISDFPKLERLSSKGFHYLVSLESLEVFSCPNFTSFPEAGFPSSLLSLKIIGCPLLGNKCRKDKGQEWPKIAHIPYVVIDPKFIRHQQEVA

cccccccEEEEEcccHHHHHHHccccEEccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHccccccccccccHHHHccccccccccHHHHcccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccEEEccccccEEEcHHHHHHHHHHHHccEEEEEcccccccccccccccEEEEEEEccccccccccccccccccccccccccEEEcccccccccccccccccHHHHHHHccccccccEEEccccccccccccccccccccEEEccccccccccHHHHccccccEEccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEcccccccHHHHccccccccEEEEccccccccHHHHHHHccccccccccEEEEEEcccccccccHHHHHHHcccccccccccEEEEEEcccccccccccccccccEEEEEEEcccccccccccccccccccEEEccccccEEEcccccccccccccccccEEEcccccccccccccccccccccccccccEEEcccccccccccccccccccEEEEEEcccccccccccccccEEEEccccccccccccccccccEEEEccccccccccccccccccEEEEEccccccccccccEEEEEcccccccccccccccccccEEEEEEEcccccccccccccccccEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEEEcccccccccccccccccEEEEEccccccccccccccccccEEEEEccccccccccccccccccccEEEEEccccccccccccccccccccccEEEEEccccccccccccccccccccEEEEEccccccccccccccccccEEEEcccHHHHHHHcccccccccccccccEEEEccEEEccccccc

cccccccEEEEEEccHHHHHHHccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHcHHHcccccccccHHEEEcHcccccHHHHHHHEHHcccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccccccccEEHHHHHHHHHHHHHccHEEEHHHccccccccccccccEEEEEEccccccEEccccccccccccHHHHHHHcEEcccccccccccccccccHHHHHHHHHHcccEEEEEEcccccccccccccccHHEEEEEcccccccccccHHcHHHHHHHHHHcccccHHHccHHHHccccccEEEcccccccccccccccccccccEccEEEEcccccccHHHHHHHHHcccEEEEccccccccHHHHHHHHHcccccccEEEEEEcccccccccccccHHHHHHHccccccccEEEEEccccccccccccccccccEEEEEEcccccccccccccccccHcEEEEcccccEEEccHHHcccccccccccHcEEEEcccHHHHHccccccccccccccccHcEEEEccccHHccccccccccccEEEEccccccccccccccHHcEEEEcccccEEcccccccccccccccccccccccccHHccccccEEEEcccccccccccccEEEEccccccccccccccccccccEEEEcccccHccccHcccccccccEEEEccccccccccccccccccccEEEEcccccHccccccccccccccEEEEcccccccccccccccccccEEEEcccHHHcccccccccccccEEEEcccccccccccccccccccEEEEcccHHHccccHHHccccccccEEEEcccccccccccccccccccccccEEEEcccccHccccHHcccccccccEEEEcccccccccccccccccccEEEEcccHHHHHHHHcccccccccEEEccEEEEcccEEEEcEEcc

magapgsriIVTTRsrdvaskmgpvkyyglkllsdddcwSVFVAHafdsrdagthgnfeSTRQRVVEKCKGLPLAARALGGLLGSKQRVDEWRAILDSkiwdledetevpSVLKLSyhhlpshlkRCFAYCAilpkdyefQEEELVLLWIAEGLIQQSKDRKQADDLGSEYFHDLLSRSlfqkssnsgskfvMHDLVHDLaqwasgetcfrlddqfsadrqsnvfekvrhssyvrsgdcdgmgvrcdgmnkfKVLDKVENLRTFLPIFVeecffspagyispmvisdllpkckkLRVLSLgryrisevptsigclkhlrylnfsESWIKCLPEAITSLFNLEILILSDCRLLLklpssignlvnlyhldidganrlcelplgmKELKCLRTLTnfivgkdsgcalkdlknwkfLRGRLCISGLENVIDSQEANEALLRVKKDLEVLKLEWrarrdgdsvdeVREKNILDmlkphgnikRLVInsyggtrfpswigdpsfsNVAVLILKncrrstslpslgqlcslkdlTIVRMSALKgigseingeccskpfpslqtlyfEDLQVWekwepntendehvqafpRLQKLfihkcpklsgrlpnhlpslEKIVITECRQLVislpsvpalcklkidgckrlvcdglseskslnKMTLWNISEFenwssqkfqnvehleivgcegsstcldleslsvfrcplltclwtggwlpvtLKRLEIWCcynfkvltsecqlpVAIEALTISNCSNLESIAERFYDDACLRSILISScdnlkslpiglnnlshlhrisiegchnlvslpedalpssvvdvsieecdklkgplptgkisslqelslkkcpgivffpeeglstnltyleisganiykplvnwgfhklTSLRKLCIngcsdaasfpevekgvilptsltwirisdfpklerlsskgfhyLVSLEslevfscpnftsfpeagfpssllslkiigcpllgnkcrkdkgqewpkiahipyvvidpkfirHQQEVA

magapgsriivttrsrdvaskmgPVKYYGLKLLSDDDCWSVFVAHAFDSRDAGTHGNFESTRQRVVEKCKGLPLAARAlggllgskqrvdEWRAILDskiwdledETEVPSVLKLSYHHLPSHLKRCFAYCAILPKDYEFQEEELVLLWIAEGLIQQSKDRKQADDLGSEYFHDLLSRSLFQKSSNSGSKFVMHDLVHDLAQWASGETCFRLDDQFSADrqsnvfekvrhssyvrsgdcdgmgvrCDGMNKFKVLDKVENLRTFLPIFVEECFFSPAGYISPMVISDLLPKCKKLRVLSLGryrisevptsigclkhlRYLNFSESWIKCLPEAITSLFNLEILILSDCRLLLKLPSSIGNLVNLYHLDIDGANRLCELPLGMKELKCLRTLTNfivgkdsgcalKDLKNWKFLRGRLCISGlenvidsqeaNEALLrvkkdlevlklewrarrdgdsvdevreknildmlkphgniKRLVINSYGGTRFPSWIGDPSFSNVAVLILKNCRrstslpslgqlcslkdLTIVRMSALKGIGSEINGECCSKPFPSLQTLYFEDLQVWEKWEPNTENDEHVQAFPRLQKLFIHKCPKLSGRLPNHLPSLEKIVITECRQLVISLPSVPALCKLKIDGCKRLVCDGlseskslnkMTLWNISEFENWSSQKFQNVEHLEIVGCEGSSTCLDLESLSVFRCPLLTCLWTGGWLPVTLKRLEIWCCYNFKVLTSECQLPVAIEALTISNCSNLESIAERFYDDACLRSILISSCDNLKSLPIGLNNLSHLHRISIEGCHNLVSLPEDALPSSVVDVSIEECDKLKGPLPTGKISSLQELSLKKCPGIVFFPEEGLSTNLTYLEISGANIYKPLVNWGFHKLTSLRKLCINGCSDAASFPEVEKGVILPTSLTWIRISDFPKLERLSSKGFHYLVSLESLEVFSCPNFTSFPEAGFPSSLLSLKIIGCPLLGNKCRKDKGQEWPKIAHIPYVVIDPKFIRHQQEVA

MAGAPGSRIIVTTRSRDVASKMGPVKYYGLKLLSDDDCWSVFVAHAFDSRDAGTHGNFESTRQRVVEKCKglplaaralggllgSKQRVDEWRAILDSKIWDLEDETEVPSVLKLSYHHLPSHLKRCFAYCAILPKDYEFQEEELVLLWIAEGLIQQSKDRKQADDLGSEYFHDLLSRSLFQKSSNSGSKFVMHDLVHDLAQWASGETCFRLDDQFSADRQSNVFEKVRHSSYVRSGDCDGMGVRCDGMNKFKVLDKVENLRTFLPIFVEECFFSPAGYISPMVISDLLPKCKKLRVLSLGRYRISEVPTSIGCLKHLRYLNFSESWIKCLPEAITSLFNLEILILSDCRLLLKLPSSIGNLVNLYHLDIDGANRLCELPLGMKELKCLRTLTNFIVGKDSGCALKDLKNWKFLRGRLCISGLENVIDSQEANEALLRVKKDLEVLKLEWRARRDGDSVDEVREKNILDMLKPHGNIKRLVINSYGGTRFPSWIGDPSFSNVAVLILKNCRRSTSLPSLGQLCSLKDLTIVRMSALKGIGSEINGECCSKPFPSLQTLYFEDLQVWEKWEPNTENDEHVQAFPRLQKLFIHKCPKLSGRLPNHLPSLEKIVITECRQLVISLPSVPALCKLKIDGCKRLVCDGLSESKSLNKMTLWNISEFENWSSQKFQNVEHLEIVGCEGSSTCLDLESLSVFRCPLLTCLWTGGWLPVTLKRLEIWCCYNFKVLTSECQLPVAIEALTISNCSNLESIAERFYDDACLRSILISSCDNLKSLPIGLNNLSHLHRISIEGCHNLVSLPEDALPSSVVDVSIEECDKLKGPLPTGKISSLQELSLKKCPGIVFFPEEGLSTNLTYLEISGANIYKPLVNWGFHKLTSLRKLCINGCSDAASFPEVEKGVILPTSLTWIRISDFPKLERLSSKGFHYLVSLESLEVFSCPNFTSFPEAGFPSSLLSLKIIGCPLLGNKCRKDKGQEWPKIAHIPYVVIDPKFIRHQQEVA

*********IV******VASKMGPVKYYGLKLLSDDDCWSVFVAHAFDSRDAGTHGNFESTRQRVVEKCKGLPLAARALGGLLGSKQRVDEWRAILDSKIWDLEDETEVPSVLKLSYHHLPSHLKRCFAYCAILPKDYEFQEEELVLLWIAEGLIQ*************EYFHDLLSR***********KFVMHDLVHDLAQWASGETCFRLDDQFSADRQSNVFEKVRHSSYVRSGDCDGMGVRCDGMNKFKVLDKVENLRTFLPIFVEECFFSPAGYISPMVISDLLPKCKKLRVLSLGRYRISEVPTSIGCLKHLRYLNFSESWIKCLPEAITSLFNLEILILSDCRLLLKLPSSIGNLVNLYHLDIDGANRLCELPLGMKELKCLRTLTNFIVGKDSGCALKDLKNWKFLRGRLCISGLENVIDSQEANEALLRVKKDLEVLKLEWRARRDGDSVDEVREKNILDMLKPHGNIKRLVINSYGGTRFPSWIGDPSFSNVAVLILKNCRRSTSLPSLGQLCSLKDLTIVRMSALKGIGSEINGECCSKPFPSLQTLYFEDLQVWEKWEPNTENDEHVQAFPRLQKLFIHKCPKLSGRLPNHLPSLEKIVITECRQLVISLPSVPALCKLKIDGCKRLVCDGLSESKSLNKMTLWNISEFENWSSQKFQNVEHLEIVGCEGSSTCLDLESLSVFRCPLLTCLWTGGWLPVTLKRLEIWCCYNFKVLTSECQLPVAIEALTISNCSNLESIAERFYDDACLRSILISSCDNLKSLPIGLNNLSHLHRISIEGCHNLVSLPEDALPSSVVDVSIEECDKLKGPLPTGKISSLQELSLKKCPGIVFFPEEGLSTNLTYLEISGANIYKPLVNWGFHKLTSLRKLCINGCSDAASFPEVEKGVILPTSLTWIRISDFPKLERLSSKGFHYLVSLESLEVFSCPNFTSFPEAGFPSSLLSLKIIGCPLLGNKCRKDKGQEWPKIAHIPYVVIDPKFIR******

***APGSRIIVTTRSRDVASKMGPVKYYGLKLLSDDDCWSVFVAHA*************STRQRVVEKCKGLPLAARALGGLLGSKQRVDEWRAILDSKIWDLEDETEVPSVLKLSYHHLPSHLKRCFAYCAILPKDYEFQEEELVLLWIAEGLIQQSKDRKQADDLGSEYFHDLLSRSLFQKSSNSGSKFVMHDLVHDLAQWASGETCFRLDDQFS*****NVFEKVRHSSYVRSGDCDGMGVRCDGMNKFKVLDKVENLRTFLPIFVEECFFSPAGYISPMVISDLLPKCKKLRVLSLGRYRISEVPTSIGCLKHLRYLNFSESWIKCLPEAITSLFNLEILILSDCRLLLKLPSSIGNLVNLYHLDIDGANRLCELPLGMKELKCLRTLTNFIVGKDSGCALKDLKNWKFLRGRLCISGLENVIDSQEANEALLRVKKDLEVLKLEWRARRD******VREKNILDMLKPHGNIKRLVINSYGGTRFPSWIGDPSFSNVAVLILKNCRRSTSLPSLGQLCSLKDLTIVRMSALKGIGSEINGECCSKPFPSLQTLYFEDLQVWEKWEPNTENDEHVQAFPRLQKLFIHKCPKLSGRLPNHLPSLEKIVITECRQLVISLPSVPALCKLKIDGCKRLVCDGLSESKSLNKMTLWNISEFENWSSQKFQNVEHLEIVGCEGSSTCLDLESLSVFRCPLLTCLWT**WLPVTLKRLEIWCCYNFKVLTSECQLPVAIEALTISNCSNLESIAERFYDDACLRSILISSCDNLKSLPIGLNNLSHLHRISIEGCHNLVSLPEDALPSSVVDVSIEECDKLKGPLP*GKISSLQELSLKKCPGIVFFPEEGLSTNLTYLEISGANIYKPLVNWGFHKLTSLRKLCINGCSDAASFPEVEKGVILPTSLTWIRISDFPKLERLSSKGFHYLVSLESLEVFSCPNFTSFPEAGFPSSLLSLKIIGCPLLGNKCRKDKGQEWPKIAHIPYVVIDPKFIRHQ****

*****GSRIIVTTRSRDVASKMGPVKYYGLKLLSDDDCWSVFVAHAFDSRDAGTHGNFESTRQRVVEKCKGLPLAARALGGLLGSKQRVDEWRAILDSKIWDLEDETEVPSVLKLSYHHLPSHLKRCFAYCAILPKDYEFQEEELVLLWIAEGLIQQSKDRKQADDLGSEYFHDLLSRSLFQKSSNSGSKFVMHDLVHDLAQWASGETCFRLDDQFSADRQSNVFEKVRHSSYVRSGDCDGMGVRCDGMNKFKVLDKVENLRTFLPIFVEECFFSPAGYISPMVISDLLPKCKKLRVLSLGRYRISEVPTSIGCLKHLRYLNFSESWIKCLPEAITSLFNLEILILSDCRLLLKLPSSIGNLVNLYHLDIDGANRLCELPLGMKELKCLRTLTNFIVGKDSGCALKDLKNWKFLRGRLCISGLENVIDSQEANEALLRVKKDLEVLKLEWRARRDGDSVDEVREKNILDMLKPHGNIKRLVINSYGGTRFPSWIGDPSFSNVAVLILKNCRRSTSLPSLGQLCSLKDLTIVRMSALKGIGSEINGECCSKPFPSLQTLYFEDLQVWEKWEPNTENDEHVQAFPRLQKLFIHKCPKLSGRLPNHLPSLEKIVITECRQLVISLPSVPALCKLKIDGCKRLVCDGLSESKSLNKMTLWNISEFENWSSQKFQNVEHLEIVGCEGSSTCLDLESLSVFRCPLLTCLWTGGWLPVTLKRLEIWCCYNFKVLTSECQLPVAIEALTISNCSNLESIAERFYDDACLRSILISSCDNLKSLPIGLNNLSHLHRISIEGCHNLVSLPEDALPSSVVDVSIEECDKLKGPLPTGKISSLQELSLKKCPGIVFFPEEGLSTNLTYLEISGANIYKPLVNWGFHKLTSLRKLCINGCSDAASFPEVEKGVILPTSLTWIRISDFPKLERLSSKGFHYLVSLESLEVFSCPNFTSFPEAGFPSSLLSLKIIGCPLLGNKCRKDKGQEWPKIAHIPYVVIDPKFIRHQQE**

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAGAPGSRIIVTTRSRDVASKMGPVKYYGLKLLSDDDCWSVFVAHAFDSRDAGTHGNFESTRQRVVEKCKGLPLAARALGGLLGSKQRVDEWRAILDSKIWDLEDETEVPSVLKLSYHHLPSHLKRCFAYCAILPKDYEFQEEELVLLWIAEGLIQQSKDRKQADDLGSEYFHDLLSRSLFQKSSNSGSKFVMHDLVHDLAQWASGETCFRLDDQFSADRQSNVFEKVRHSSYVRSGDCDGMGVRCDGMNKFKVLDKVENLRTFLPIFVEECFFSPAGYISPMVISDLLPKCKKLRVLSLGRYRISEVPTSIGCLKHLRYLNFSESWIKCLPEAITSLFNLEILILSDCRLLLKLPSSIGNLVNLYHLDIDGANRLCELPLGMKELKCLRTLTNFIVGKDSGCALKDLKNWKFLRGRLCISGLENVIDxxxxxxxxxxxxxxxxxxxxxWRARRDGDSVDEVREKNILDMLKPHGNIKRLVINSYGGTRFPSWIGDPSFSNVAVLILKNCRRSTSLPSLGQLCSLKDLTIVRMSALKGIGSEINGECCSKPFPSLQTLYFEDLQVWEKWEPNTENDEHVQAFPRLQKLFIHKCPKLSGRLPNHLPSLEKIVITECRQLVISLPSVPALCKLKIDGCKRLVCDGLSESKSLNKMTLWNISEFENWSSQKFQNVEHLEIVGCEGSSTCLDLESLSVFRCPLLTCLWTGGWLPVTLKRLEIWCCYNFKVLTSECQLPVAIEALTISNCSNLESIAERFYDDACLRSILISSCDNLKSLPIGLNNLSHLHRISIEGCHNLVSLPEDALPSSVVDVSIEECDKLKGPLPTGKISSLQELSLKKCPGIVFFPEEGLSTNLTYLEISGANIYKPLVNWGFHKLTSLRKLCINGCSDAASFPEVEKGVILPTSLTWIRISDFPKLERLSSKGFHYLVSLESLEVFSCPNFTSFPEAGFPSSLLSLKIIGCPLLGNKCRKDKGQEWPKIAHIPYVVIDPKFIRHQQEVA

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		1000	2.2.26 [Sep-21-2011]
Q9LRR4		1054	Putative disease resistan	yes	no	0.693	0.657	0.364	1e-121
Q9LRR5		1424	Putative disease resistan	no	no	0.596	0.418	0.395	1e-114
Q7XA39		988	Putative disease resistan	N/A	no	0.668	0.676	0.310	7e-81
Q7XBQ9		970	Disease resistance protei	N/A	no	0.627	0.646	0.317	2e-80
Q7XA40		992	Putative disease resistan	N/A	no	0.68	0.685	0.312	7e-79
Q7XA42		979	Putative disease resistan	N/A	no	0.637	0.650	0.32	4e-77
P0DI18		1049	Probable disease resistan	no	no	0.663	0.632	0.257	2e-34
P0DI17		1049	Probable disease resistan	no	no	0.663	0.632	0.257	2e-34
Q39214		926	Disease resistance protei	no	no	0.367	0.396	0.285	2e-34
Q9STE7		847	Putative disease resistan	no	no	0.311	0.367	0.321	2e-32

>sp\|Q9LRR4\|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1	Back alignment and function desciption

 Score =  435 bits (1119), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 283/776 (36%), Positives = 425/776 (54%), Gaps = 83/776 (10%)

Query: 1    MAGAPGSRIIVTTRSRDVASKMGPVKYYGLKLLSDDDCWSVFVAHAFDSRDAGTHGNFES 60
            +  A GS+I+VTTRS+ VAS M  V  + L+ LSD DCWS+F+   F +++   +     
Sbjct: 302  IHAAQGSQILVTTRSQRVASIMCAVHVHNLQPLSDGDCWSLFMKTVFGNQEPCLNREIGD 361

Query: 61   TRQRVVEKCKGLPLAARALGGLLGSKQRVDEWRAILDSKIWDL-EDETEVPSVLKLSYHH 119
              +R+V KC+GLPLA + LGG+L  + +V EW  +L S+IWDL  D++ +  VL++SY++
Sbjct: 362  LAERIVHKCRGLPLAVKTLGGVLRFEGKVIEWERVLSSRIWDLPADKSNLLPVLRVSYYY 421

Query: 120  LPSHLKRCFAYCAILPKDYEFQEEELVLLWIAEGLIQQSKDRKQADDLGSEYFHDLLSRS 179
            LP+HLKRCFAYC+I PK + F+++++VLLW+AEG +QQ++  K  ++LG+EYF +L SRS
Sbjct: 422  LPAHLKRCFAYCSIFPKGHAFEKDKVVLLWMAEGFLQQTRSSKNLEELGNEYFSELESRS 481

Query: 180  LFQKSSNSGSKFVMHDLVHDLAQWASGETCFRLDDQFSADRQSNVFEKVRHSSYVRSGDC 239
            L QK+    ++++MHD +++LAQ+ASGE   + +D         V E+ R+ SY+R    
Sbjct: 482  LLQKTK---TRYIMHDFINELAQFASGEFSSKFEDGCKL----QVSERTRYLSYLRDNYA 534

Query: 240  DGMGVRCDGMNKFKVLDKVENLRTFLPIFVEECFFSPAGYISPMVISDLLPKCKKLRVLS 299
            + M        +F+ L +V+ LRTFLP+ +     S +  +  MV   LLP   +LRVLS
Sbjct: 535  EPM--------EFEALREVKFLRTFLPLSLTNS--SRSCCLDQMVSEKLLPTLTRLRVLS 584

Query: 300  LGRYRISEVPTS-IGCLKHLRYLNFSESWIKCLPEAITSLFNLEILILSDCRLLLKLPSS 358
            L  Y+I+ +P      + H R+L+ S + ++ LP+++  ++NL+ L+LS C  L +LP+ 
Sbjct: 585  LSHYKIARLPPDFFKNISHARFLDLSRTELEKLPKSLCYMYNLQTLLLSYCSSLKELPTD 644

Query: 359  IGNLVNLYHLDIDGANRLCELPLGMKELKCLRTLTNFIVGKDSGCALKDLKNWKFLRGRL 418
            I NL+NL +LD+ G  +L ++P     LK L+TLT F V    G  + +L     L G+L
Sbjct: 645  ISNLINLRYLDLIGT-KLRQMPRRFGRLKSLQTLTTFFVSASDGSRISELGGLHDLHGKL 703

Query: 419  CISGLENVIDSQEANEALLRVKKDLEVLKLEWRARRDGDSVDE--------VREKNILDM 470
             I  L+ V+D  +A EA L  KK L  +   WR    G S  E          E  + + 
Sbjct: 704  KIVELQRVVDVADAAEANLNSKKHLREIDFVWRT---GSSSSENNTNPHRTQNEAEVFEK 760

Query: 471  LKPHGNIKRLVINSYGGTRFPSWIGDPSFSNVAVLILKNCRRSTSLPSLGQLCSLKDLTI 530
            L+PH +I++L I  Y G RFP W+ DPSFS +  + L+ C+  TSLPSLGQL  LK+L I
Sbjct: 761  LRPHRHIEKLAIERYKGRRFPDWLSDPSFSRIVCIRLRECQYCTSLPSLGQLPCLKELHI 820

Query: 531  VRMSALKGIGSEI------NGECCSKPFPSLQTLYFEDLQVWEKW--EPNTENDEHVQAF 582
              M  L+ IG +         +   +PF SL+TL F++L  W++W     T  D     F
Sbjct: 821  SGMVGLQSIGRKFYFSDQQLRDQDQQPFRSLETLRFDNLPDWQEWLDVRVTRGD----LF 876

Query: 583  PRLQKLFIHKCPKLSGRLPNHLPSLEKIVITECRQLVISLP----SVPALCKLKIDGCKR 638
            P L+KLFI +CP+L+G LP  LPSL  + I +C  L         S   L  L I     
Sbjct: 877  PSLKKLFILRCPELTGTLPTFLPSLISLHIYKCGLLDFQPDHHEYSYRNLQTLSIKSS-- 934

Query: 639  LVCDGLSESKSLNKMTLWNISEFENWSSQKFQNVEHLEIVGCEGSSTCLDLESLSVFRCP 698
              CD L +                 +    F N++ LE+  C            S++   
Sbjct: 935  --CDTLVK-----------------FPLNHFANLDKLEVDQCT-----------SLYSLE 964

Query: 699  LLTCLWTGGWLPVTLKRLEIWCCYNFKVLTSECQLPVAIEALTISNCSNLESIAER 754
            L      G   P  L+ L I  C N ++L     LP  ++ +TI+NC  L    E+
Sbjct: 965  LSNEHLRG---PNALRNLRINDCQNLQLLPKLNALPQNLQ-VTITNCRYLRQPMEQ 1016

Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q9LRR5\|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1	Back alignment and function description

>sp\|Q7XA39\|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1	Back alignment and function description

>sp\|Q7XBQ9\|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1	Back alignment and function description

>sp\|Q7XA40\|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2	Back alignment and function description

>sp\|Q7XA42\|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2	Back alignment and function description

>sp\|P0DI18\|DRL45_ARATH Probable disease resistance protein RDL6 OS=Arabidopsis thaliana GN=RDL6 PE=2 SV=1	Back alignment and function description

>sp\|P0DI17\|DRL11_ARATH Probable disease resistance protein RF9 OS=Arabidopsis thaliana GN=RF9 PE=2 SV=1	Back alignment and function description

>sp\|Q39214\|RPM1_ARATH Disease resistance protein RPM1 OS=Arabidopsis thaliana GN=RPM1 PE=1 SV=1	Back alignment and function description

>sp\|Q9STE7\|R13L3_ARATH Putative disease resistance RPP13-like protein 3 OS=Arabidopsis thaliana GN=RPP13L3 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1000
284026888		1424	CC-NBS-LRR protein [Quercus suber]	0.973	0.683	0.403	0.0
356554923		1399	PREDICTED: putative disease resistance R	0.963	0.688	0.398	0.0
225464007		1327	PREDICTED: putative disease resistance p	0.967	0.728	0.418	0.0
224059590		1381	cc-nbs-lrr resistance protein [Populus t	0.97	0.702	0.390	0.0
359485895		1257	PREDICTED: putative disease resistance R	0.935	0.743	0.423	0.0
359495085		1345	PREDICTED: putative disease resistance p	0.966	0.718	0.398	0.0
359495083		1280	PREDICTED: putative disease resistance p	0.94	0.734	0.417	0.0
359487065		1424	PREDICTED: putative disease resistance p	0.971	0.681	0.383	0.0
359487257		1330	PREDICTED: putative disease resistance p	0.966	0.726	0.403	0.0
359494768		1377	PREDICTED: putative disease resistance p	0.957	0.694	0.406	0.0

>gi\|284026888\|gb\|ADB66335.1\| CC-NBS-LRR protein [Quercus suber]	Back alignment and taxonomy information

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/1131 (40%), Positives = 631/1131 (55%), Gaps = 158/1131 (13%)

Query: 2    AGAPGSRIIVTTRSRDVASKMGPVKYYGLKLLSDDDCWSVFVAHAFDSRDAGTHGNFEST 61
            AGA GSRIIVTTR+  V   MG V+ Y L  +S++DCW++FV H+  + + G  GN    
Sbjct: 300  AGAAGSRIIVTTRNASVGKVMGAVQSYNLDFISNNDCWAIFVQHSLMNENFGRPGNSGLI 359

Query: 62   RQRVVEKCKGLPLAARALGGLLGSKQRVDEWRAILDSKIWDLEDE-TEVPSVLKLSYHHL 120
            R+R++E+C+GLPLAAR LGGL   K+ +DEW  I++SK+W   +  +++  +L+LSYHHL
Sbjct: 360  RERILERCRGLPLAARTLGGLFRGKE-LDEWEDIMNSKLWSSSNMGSDIFPILRLSYHHL 418

Query: 121  PSHLKRCFAYCAILPKDYEFQEEELVLLWIAEGLIQQSKDRKQADDLGSEYFHDLLSRSL 180
            P HLKRCFAYC++ P+DYEF+E++L+LLW+AEGLI Q++  K  +DLG EYF DLLSRS 
Sbjct: 419  PHHLKRCFAYCSLFPRDYEFEEKQLILLWMAEGLIYQAEGDKPMEDLGGEYFRDLLSRSF 478

Query: 181  FQKSSNSGSKFVMHDLVHDLAQWASGETCFRLDDQFSADRQSNVFEKVRHSSYVRSGDCD 240
            FQ+SS++ S+FVMHDL+ DLAQW +G + FRL+ +   + QS V  K RH S+V      
Sbjct: 479  FQQSSSNKSRFVMHDLITDLAQWVAGISYFRLETKLKGNEQSKVSSKARHLSFV------ 532

Query: 241  GMGVRCDGMNKFKVLDKVENLRTFLPIFVEECFFSPAGYISPMVISDLLPKCKKLRVLSL 300
              G R DG  KF+ + + ++LRTFLP+      +S   Y+S  +I+ LLPK + LRVLSL
Sbjct: 533  --GSRYDGAKKFEAISEFKHLRTFLPLMAPYVGYS---YLSYHIINQLLPKLQNLRVLSL 587

Query: 301  GRYRISEVPTSIGCLKHLRYLNFSESWIKCLPEAITSLFNLEILILSDCRLLLKLPSSIG 360
              YRI  +P +IG LKHLRYL+ S + ++ LP +I++L+NL+ L+L +C  L  LP   G
Sbjct: 588  SGYRIVYLPQTIGDLKHLRYLDLSCTQLRSLPTSISTLYNLQTLLLENCTSLKFLPPDFG 647

Query: 361  NLVNLYHLDIDGANRLCELPLGMKELKCLRTLTNFIVGK-DSGCALKDLKNWKFLRGRLC 419
             L NL HL+I G+N L  +PL +  L  L+TL+NF+VGK DS C +++L     LRG LC
Sbjct: 648  KLFNLRHLNIFGSNLLEGMPLSIGNLSSLQTLSNFVVGKADSFCVIRELGPLVHLRGTLC 707

Query: 420  ISGLENVIDSQEANEALLRVKKDLEVLKLEWRARRDGDSVDEVREKNILDMLKPHGNIKR 479
            IS LENV  +QEA ++ L  K+DL  + +EW +  + +S DE  +  +L+ML+P+  +K 
Sbjct: 708  ISKLENVTKAQEARDSYLYGKQDLNEVVMEWSSNLN-ESQDEETQLEVLNMLQPNVKLKE 766

Query: 480  LVINSYGGTRFPSWIGDPSFSNVAVLILKNCRRSTSLPSLGQLCSLKDLTIVRMSALKGI 539
            L +  YGGT+FP+WIGDPSFSN+ +L  +NC    SLP +GQL  LKDL I  M+ +K +
Sbjct: 767  LTVKCYGGTKFPTWIGDPSFSNLVLLRFENCDNCNSLPPVGQLPFLKDLLIKGMAGVKSV 826

Query: 540  GSEINGECCSKPFPSLQTLYFEDLQVWEKWEPNTENDEHVQAFPRLQKLFIHKCPKLSGR 599
            G E  GE CS+PF SL+TL+FED+  W  W P   N    +AF  L KL I +C  L  +
Sbjct: 827  GREFYGESCSRPFQSLETLHFEDMPRWVNWIPLGVN----EAFACLHKLSIIRCHNLVRK 882

Query: 600  LPNHLPSLEKIVITECRQLVISLPSVPALCKLKIDGCKRLVCDGLSESKSLNKMTLWNIS 659
            LP+HLPSL+K+VI  C  +V+S+ ++P LC L I+GCKR+ C+      S   M    IS
Sbjct: 883  LPDHLPSLKKLVIHGCWNMVVSVSNLPMLCVLVIEGCKRVECESSVGFGSPYSMAFSKIS 942

Query: 660  EFENWSS---QKFQNVEHLEIVGCEGSSTCLD-----------LESLSVFRCPLLTCLWT 705
            EF N ++        VE+L+IV  E  +T  +           L  LS+  CP L     
Sbjct: 943  EFGNATAGLMHGVSKVEYLKIVDSEKLTTLWEKIPEGLHRLKFLRELSIEDCPTLVSFPA 1002

Query: 706  GGWLPVTLKRLEIWCCYNFKVLTSECQL----PVAIEALTISNCSNLESIAERFYDDACL 761
             G+ P  LK ++I  C   K L  E  L       +E L +  C +++SIA R      L
Sbjct: 1003 SGF-PSMLKVIQIKSCSGLKSLLPEGTLHSRENACLERLCVVRCDSMKSIA-RGQLPTTL 1060

Query: 762  RSILISSCDNLKSL----------------PIGLNNLSHLHRISIEGCHNLVSLPEDA-L 804
            + + IS C NL+ +                 I   + +HL  + I+ C +L +L     L
Sbjct: 1061 KKLEISHCMNLQCVLDEGEGSSSSSGMHDEDINNRSKTHLQYLDIKSCPSLTTLTSSGKL 1120

Query: 805  PSSVVDVSIEECDKL-----KGPLPTG-------KISSLQELS----------------- 835
            P+++  + + EC KL      G LP          IS LQ+++                 
Sbjct: 1121 PATLTHLLLRECPKLMCLSSTGKLPAALQYLEIQSISKLQKIAERLHQNTSLECIKIWNC 1180

Query: 836  --LKKCPG-----------IVF-------FPEEGLSTNLTYLEISGANIYKPLVNWGFHK 875
              LK  P            ++F       FP  GL +NL  L I      K L N G   
Sbjct: 1181 HGLKSLPEDLHNLSKLRQFLIFWCQSFSSFPAAGLPSNLRVLGIKNCKNLKALPN-GMRN 1239

Query: 876  LTSLRKLCING------------------------------------------------- 886
            LTSL+KL I+                                                  
Sbjct: 1240 LTSLQKLDISHRLDSLPSPQEGLPTNLIELNMHDLKFYKPMFEWGLQQPTSLIKLSIHGE 1299

Query: 887  CSDAASFP-EVEKGV--ILPTSLTWIRISDFPKLERLSSKGFHYLVSLESLEVFSCPNFT 943
            C D  S+P E E GV  +LP SL+ + IS F  LE LS KGF  L SL  L++++C   T
Sbjct: 1300 CLDVDSYPGERENGVMMLLPNSLSILCISYFQNLECLSPKGFQNLTSLNQLKIYNCLKLT 1359

Query: 944  SFPEAGFPSSLLSLKIIGCPLLGNKCRKDKGQEWPKIAHIPYVVIDPKFIR 994
            S P+ G P SL  L+I  CPLL   C  +KGQEW KIAHIP V+ID KFI 
Sbjct: 1360 SLPKEGLPPSLTQLEIRNCPLLSQHCNNEKGQEWSKIAHIPCVLIDNKFIH 1410

Source: Quercus suber

Species: Quercus suber

Genus: Quercus

Family: Fagaceae

Order: Fagales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356554923\|ref\|XP_003545790.1\| PREDICTED: putative disease resistance RPP13-like protein 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|225464007\|ref\|XP_002264663.1\| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224059590\|ref\|XP_002299922.1\| cc-nbs-lrr resistance protein [Populus trichocarpa] gi\|222847180\|gb\|EEE84727.1\| cc-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|359485895\|ref\|XP_002265277.2\| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359495085\|ref\|XP_003634909.1\| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359495083\|ref\|XP_003634908.1\| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359487065\|ref\|XP_002270668.2\| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359487257\|ref\|XP_002269571.2\| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359494768\|ref\|XP_002263518.2\| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		1000
TAIR\|locus:2091662		1424	AT3G14460 [Arabidopsis thalian	0.594	0.417	0.386	2.3e-134
TAIR\|locus:2091672		1054	AT3G14470 [Arabidopsis thalian	0.644	0.611	0.338	5.9e-89
UNIPROTKB\|O48647		1802	O48647 "XA1" [Oryza sativa (ta	0.445	0.246	0.291	1.7e-52
TAIR\|locus:2034770		894	SUMM2 "AT1G12280" [Arabidopsis	0.385	0.430	0.272	1.7e-25
TAIR\|locus:2171579		843	AT5G47250 [Arabidopsis thalian	0.2	0.237	0.319	5.3e-25
TAIR\|locus:504956186		1138	AT1G58602 [Arabidopsis thalian	0.204	0.179	0.254	6.8e-25
TAIR\|locus:2077572		926	RPM1 "RESISTANCE TO P. SYRINGA	0.337	0.363	0.259	1e-24
TAIR\|locus:2201996		889	RPS5 "AT1G12220" [Arabidopsis	0.361	0.406	0.283	5.7e-23
TAIR\|locus:504956483		847	AT3G46730 [Arabidopsis thalian	0.338	0.399	0.279	2.5e-22
TAIR\|locus:504956184		1017	AT1G58807 "AT1G58807" [Arabido	0.379	0.372	0.256	4.9e-21

TAIR\|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1016 (362.7 bits), Expect = 2.3e-134, Sum P(2) = 2.3e-134
 Identities = 242/626 (38%), Positives = 357/626 (57%)

Query:     6 GSRIIVTTRSRDVASKMGPVKYYGLKLLSDDDCWSVFVAHAFDSRDAGT-HGNFESTRQR 64
             GS+I++TTRS  V++     K Y +KL+++++CW +    AF +   G+ +   E   +R
Sbjct:   302 GSKIVLTTRSEIVSTVAKAEKIYQMKLMTNEECWELISRFAFGNISVGSINQELEGIGKR 361

Query:    65 VVEKCKXXXXXXXXXXXXXXSKQRVDEWRAILDSKIWDLEDETEVPSVLKLSYHHLPSHL 124
             + E+CK              SK   D+W A+  SK +     + +P VLKLSY  LP  L
Sbjct:   362 IAEQCKGLPLAARAIASHLRSKPNPDDWYAV--SKNFSSYTNSILP-VLKLSYDSLPPQL 418

Query:   125 KRCFAYCAILPKDYEFQEEELVLLWIAEGLIQQSKDRKQADDLGSEYFHDLLSRSLFQKS 184
             KRCFA C+I PK + F  EELVLLW+A  L+ Q +  ++ +D+G++Y  DL+++S FQ+ 
Sbjct:   419 KRCFALCSIFPKGHVFDREELVLLWMAIDLLYQPRSSRRLEDIGNDYLGDLVAQSFFQRL 478

Query:   185 SNSGSKFVMHDLVHDLAQWASGETCFRLDDQFSADRQSNVFEKVRHSSYVRSGDCDGMGV 244
               + + FVMHDL++DLA+  SG+ CFRL+D    D    +    RH S+ RS        
Sbjct:   479 DITMTSFVMHDLMNDLAKAVSGDFCFRLED----DNIPEIPSTTRHFSFSRS-------- 526

Query:   245 RCDGMNKFKVLDKVENLRTFLPIFVEECFFSPAGYISPMVISDLLPKCKKLRVLSLGRYR 304
             +CD    F+ +   E LRT LP        S    ++  V++ LL     LR+LSL  Y+
Sbjct:   527 QCDASVAFRSICGAEFLRTILPFNSPTSLESLQ--LTEKVLNPLLNALSGLRILSLSHYQ 584

Query:   305 ISEVPTSIGCLKHLRYLNFSESWIKCLPEAITSLFNLEILILSDCRLLLKLPSSIGNLVN 364
             I+ +P S+  LK LRYL+ S + IK LPE + +L NL+ L+LS+CR L  LP SI  L+N
Sbjct:   585 ITNLPKSLKGLKLLRYLDLSSTKIKELPEFVCTLCNLQTLLLSNCRDLTSLPKSIAELIN 644

Query:   365 LYHLDIDGANRLCELPLGMKELKCLRTLTNFIVGKDSGCALKDLKNWKFLRGRLCISGLE 424
             L  LD+ G   L E+P G+K+L+ L+ L+NF++G+ SG  L +LK    LRG L IS L+
Sbjct:   645 LRLLDLVGTP-LVEMPPGIKKLRSLQKLSNFVIGRLSGAGLHELKELSHLRGTLRISELQ 703

Query:   425 NVIDSQEANEALLRVKKDLEVLKLEWRARRDG---DSVDEVR--EKNILDMLKPHGNIKR 479
             NV  + EA +A L+ K  L+ L L+W  +  G    S + +   +K +L ML+PH ++K 
Sbjct:   704 NVAFASEAKDAGLKRKPFLDGLILKWTVKGSGFVPGSFNALACDQKEVLRMLEPHPHLKT 763

Query:   480 LVINSYGGTRFPSWIGDPSFSNVAVLILKNCRRSTSLPSLGQLCSLKDLTIVRMSALKGI 539
               I SY G  FP W+GD SF  +  + L +C    SLP +GQL SLK L+I + + L+ +
Sbjct:   764 FCIESYQGGAFPKWLGDSSFFGITSVTLSSCNLCISLPPVGQLPSLKYLSIEKFNILQKV 823

Query:   540 GSEIN-GECCSK--PFPSLQTLYFEDLQVWEKWE-PNTENDEHVQAFPRLQKLFIHKCPK 595
             G +   GE  S+  PF SLQ L F  +  W++W  P  E+      FP LQKL I +CP 
Sbjct:   824 GLDFFFGENNSRGVPFQSLQILKFYGMPRWDEWICPELEDG----IFPCLQKLIIQRCPS 879

Query:   596 LSGRLPNHLPSLEKIVITECRQLVIS 621
             L  + P  LPS  ++ I++C    +S
Sbjct:   880 LRKKFPEGLPSSTEVTISDCPLRAVS 905

GO:0005634 "nucleus" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0043531 "ADP binding" evidence=IEA

TAIR\|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|O48647 O48647 "XA1" [Oryza sativa (taxid:4530)]	Back alignment and assigned GO terms

TAIR\|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2171579 AT5G47250 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:504956186 AT1G58602 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2077572 RPM1 "RESISTANCE TO P. SYRINGAE PV MACULICOLA 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:504956483 AT3G46730 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:504956184 AT1G58807 "AT1G58807" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		1000
pfam00931		285	pfam00931, NB-ARC, NB-ARC domain	7e-43
PLN03210		1153	PLN03210, PLN03210, Resistant to P	4e-10
PLN03210		1153	PLN03210, PLN03210, Resistant to P	3e-07
PLN03210		1153	PLN03210, PLN03210, Resistant to P	2e-06
PLN03210		1153	PLN03210, PLN03210, Resistant to P	1e-05
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	3e-05
PRK15386		426	PRK15386, PRK15386, type III secretion protein Gog	1e-04
PRK15386		426	PRK15386, PRK15386, type III secretion protein Gog	0.001
PLN03210		1153	PLN03210, PLN03210, Resistant to P	0.002
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	0.002
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	0.002

>gnl\|CDD\|216202 pfam00931, NB-ARC, NB-ARC domain	Back alignment and domain information

 Score =  157 bits (400), Expect = 7e-43
 Identities = 69/161 (42%), Positives = 93/161 (57%), Gaps = 5/161 (3%)

Query: 2   AGAPGSRIIVTTRSRDVASKMGPVKY-YGLKLLSDDDCWSVFVAHAFDSRDAGTHGNFES 60
            G  GSR+IVTTRS  VA +MG     + ++ L  ++ W +F    F+          E 
Sbjct: 124 DGENGSRVIVTTRSESVAGRMGGTSKPHEVESLEPEESWELFSNKVFEKEL-PPCPELEE 182

Query: 61  TRQRVVEKCKGLPLAARALGGLLGSKQRVDEWRAILDSKIWDLEDET---EVPSVLKLSY 117
             + +VEKCKGLPLA + LGGLL  K  V EW  +L+    +L       EV S+L LSY
Sbjct: 183 VAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNELAGRDGLNEVLSILSLSY 242

Query: 118 HHLPSHLKRCFAYCAILPKDYEFQEEELVLLWIAEGLIQQS 158
            +LP HLKRCF Y A+ P+DY  ++E+L+ LWIAEG +  S
Sbjct: 243 DNLPMHLKRCFLYLALFPEDYNIRKEQLIKLWIAEGFVIPS 283

Length = 285

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional	Back alignment and domain information

>gnl\|CDD\|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		1000
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	100.0
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.94
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.93
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.93
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.92
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.91
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.88
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.87
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.87
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	99.87
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.86
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.66
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.55
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.53
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.52
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.46
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.44
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.43
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.39
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.19
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.02
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.01
KOG4341		483	consensus F-box protein containing LRR [General fu	98.76
KOG4341		483	consensus F-box protein containing LRR [General fu	98.73
PRK15386		426	type III secretion protein GogB; Provisional	98.72
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.68
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.63
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.61
PLN03150		623	hypothetical protein; Provisional	98.6
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.58
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.57
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.56
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.53
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.51
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.49
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.48
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.43
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.41
PRK15386		426	type III secretion protein GogB; Provisional	98.39
PLN03150		623	hypothetical protein; Provisional	98.3
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.15
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	98.09
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.99
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.98
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.93
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.9
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.84
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.68
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.61
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.55
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.47
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.39
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.32
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.2
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.1
PRK04841		903	transcriptional regulator MalT; Provisional	97.06
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.9
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	96.85
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.68
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	96.56
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	96.48
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	96.46
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.23
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	96.21
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.89
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.8
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.52
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.5
KOG0473		326	consensus Leucine-rich repeat protein [Function un	94.8
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	94.13
KOG3864		221	consensus Uncharacterized conserved protein [Funct	94.03
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	93.88
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	93.32
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	92.46
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	92.43
KOG0473		326	consensus Leucine-rich repeat protein [Function un	92.18
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	91.6
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	89.52
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	89.43
smart00370		26	LRR Leucine-rich repeats, outliers.	89.43
KOG3864		221	consensus Uncharacterized conserved protein [Funct	89.41
PRK06893		229	DNA replication initiation factor; Validated	84.04
COG3903		414	Predicted ATPase [General function prediction only	83.55
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	82.89
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	82.67
smart00370		26	LRR Leucine-rich repeats, outliers.	82.67

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=3.4e-55  Score=515.75  Aligned_cols=350  Identities=33%  Similarity=0.538  Sum_probs=287.3

Q ss_pred             CCCcEEEEEcCChHHHhh-cCCCceEeCCCCChHhhHHHHHHhhcCCCCCCCCcchHHHHHHHHHHccCChhhHHHHHhh
Q 040304            4 APGSRIIVTTRSRDVASK-MGPVKYYGLKLLSDDDCWSVFVAHAFDSRDAGTHGNFESTRQRVVEKCKGLPLAARALGGL   82 (1000)
Q Consensus         4 ~~gs~ilvTtR~~~v~~~-~~~~~~~~l~~L~~~~a~~Lf~~~~~~~~~~~~~~~~~~~~~~i~~~c~glPlAl~~~g~~   82 (1000)
                      .+||||++|||++.||.. |++...+++++|..+|||+||++.||..... .++.++++|++|+++|+|||||++++|+.
T Consensus       287 ~~g~KvvlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~-~~~~i~~lak~v~~kC~GLPLAl~viG~~  365 (889)
T KOG4658|consen  287 ENGSKVVLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLG-SHPDIEELAKEVAEKCGGLPLALNVLGGL  365 (889)
T ss_pred             cCCeEEEEEeccHhhhhccccCCccccccccCccccHHHHHHhhcccccc-ccccHHHHHHHHHHHhCChHHHHHHHHHH
Confidence            478999999999999999 8888899999999999999999999876432 33459999999999999999999999999


Q ss_pred             hccCCcHHHHHHHhhhccccCCC-----CCCchHHHHHhhccCchhHHHHhhhhcccCCCCCCChHHHHHHHHHcCCCcc
Q 040304           83 LGSKQRVDEWRAILDSKIWDLED-----ETEVPSVLKLSYHHLPSHLKRCFAYCAILPKDYEFQEEELVLLWIAEGLIQQ  157 (1000)
Q Consensus        83 L~~~~~~~~w~~~l~~~~~~~~~-----~~~~~~~l~~sy~~L~~~~k~~fl~~~~f~~~~~i~~~~l~~~w~~~g~~~~  157 (1000)
                      |+.|++.++|+++.+...+....     .+.++.+|++|||.||++.|.||+|||+||+||.|+++.++.+|+||||+.+
T Consensus       366 ma~K~t~~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~  445 (889)
T KOG4658|consen  366 LACKKTVQEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLPEELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDP  445 (889)
T ss_pred             hcCCCcHHHHHHHHccccccccCCCCchhhhhHHhhhccHhhhhHHHHHHHHhhccCCcccccchHHHHHHHHhccCcCc
Confidence            99999999999999876555221     2379999999999999889999999999999999999999999999999999


Q ss_pred             CcccchHHHHHHHHHHHHHhcccccccC--CCCCeEEEchHHHHHHHHhhc-----cceeeecC--cccccccccccccc
Q 040304          158 SKDRKQADDLGSEYFHDLLSRSLFQKSS--NSGSKFVMHDLVHDLAQWASG-----ETCFRLDD--QFSADRQSNVFEKV  228 (1000)
Q Consensus       158 ~~~~~~~~~~~~~~l~~L~~~~ll~~~~--~~~~~~~mhdlv~~~~~~~~~-----~~~~~~~~--~~~~~~~~~~~~~~  228 (1000)
                      .+.+..+++.|+.|+.+||+++|+...+  .....|+|||+||+||.++++     ++......  .....+....+..+
T Consensus       446 ~~~~~~~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~~iv~~~~~~~~~~~~~~~~~~  525 (889)
T KOG4658|consen  446 LDGGETAEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEENQIVSDGVGLSEIPQVKSWNSV  525 (889)
T ss_pred             cccccchhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccceEEECCcCccccccccchhhe
Confidence            7778899999999999999999999865  234689999999999999999     44332222  11112333445678


Q ss_pred             eEEEEEecCCCCCCCccccccccccccccccCccccccccccccccCCCCCCCchhhhhhhcCCCcceEEEcCCcc-ccc
Q 040304          229 RHSSYVRSGDCDGMGVRCDGMNKFKVLDKVENLRTFLPIFVEECFFSPAGYISPMVISDLLPKCKKLRVLSLGRYR-ISE  307 (1000)
Q Consensus       229 ~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~Lr~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~L~~n~-l~~  307 (1000)
                      |++++..+..+.           .......++|++|.+.....        ....+...+|..++.||+|||++|. +.+
T Consensus       526 rr~s~~~~~~~~-----------~~~~~~~~~L~tLll~~n~~--------~l~~is~~ff~~m~~LrVLDLs~~~~l~~  586 (889)
T KOG4658|consen  526 RRMSLMNNKIEH-----------IAGSSENPKLRTLLLQRNSD--------WLLEISGEFFRSLPLLRVLDLSGNSSLSK  586 (889)
T ss_pred             eEEEEeccchhh-----------ccCCCCCCccceEEEeecch--------hhhhcCHHHHhhCcceEEEECCCCCccCc
Confidence            888888765321           11222334678876654321        1234456678889999999999775 678


Q ss_pred             ccccccCCCCccEeecCCCcccccchhhhccCCCcEEeccCCcCcccCChhhhccccccceeecCc
Q 040304          308 VPTSIGCLKHLRYLNFSESWIKCLPEAITSLFNLEILILSDCRLLLKLPSSIGNLVNLYHLDIDGA  373 (1000)
Q Consensus       308 lp~~~~~l~~L~~L~Ls~n~i~~lp~~i~~L~~L~~L~L~~~~~~~~lp~~i~~L~~L~~L~L~~~  373 (1000)
                      +|++++.|-+||||+|+++.+..+|..+++|..|.+||+..+.....+|..+..|++||+|.+...
T Consensus       587 LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s  652 (889)
T KOG4658|consen  587 LPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLPRS  652 (889)
T ss_pred             CChHHhhhhhhhcccccCCCccccchHHHHHHhhheeccccccccccccchhhhcccccEEEeecc
Confidence            999999999999999999999999999999999999999998867777776777999999998765

>PLN03210 Resistant to P	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>COG3903 Predicted ATPase [General function prediction only]	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		1000
4fcg_A		328	Structure Of The Leucine-Rich Repeat Domain Of The		2e-04

>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328

Back alignment and structure

Iteration: 1

Score = 45.1 bits (105), Expect = 2e-04, Method: Composition-based stats. Identities = 20/64 (31%), Positives = 36/64 (56%) Query: 737 IEALTISNCSNLESIAERFYDDACLRSILISSCDNLKSLPIGLNNLSHLHRISIEGCHNL 796 +E L + C+ L + F A L+ +++ C NL +LP+ ++ L+ L ++ + GC NL Sbjct: 231 LEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNL 290 Query: 797 VSLP 800 LP Sbjct: 291 SRLP 294

PyMOL of 4fcg

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		1000
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	5e-72
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	9e-56
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-22
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-19
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	8e-18
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-14
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	8e-12
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-10
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-08
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	9e-08
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	6e-07
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-21
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-15
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-06
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	3e-20
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-19
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-18
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	4e-14
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	8e-13
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-15
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-10
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-10
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-09
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	7e-07
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-05
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	7e-12
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	9e-12
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-10
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-07
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-06
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-11
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-11
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-09
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	5e-09
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	7e-09
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-11
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-07
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-07
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-07
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-11
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	7e-11
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-09
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-05
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	5e-04
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	7e-11
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-10
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	4e-09
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	4e-08
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	5e-08
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-07
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-07
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	7e-07
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-06
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	6e-06
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	9e-11
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-10
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	5e-10
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	5e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	5e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-08
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-08
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-08
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-08
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-06
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-05
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-10
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	6e-09
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-08
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	3e-08
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	9e-07
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-10
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	3e-07
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-07
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	9e-07
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-06
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-06
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	5e-06
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-04
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	5e-04
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-10
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	6e-10
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	6e-08
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-07
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	7e-07
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	3e-04
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-10
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	6e-08
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	7e-08
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	7e-04
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	2e-10
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-10
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-08
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-07
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	5e-07
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-06
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-06
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	6e-06
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	8e-06
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	6e-04
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	6e-10
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	4e-04
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	8e-10
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-09
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-08
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-08
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	7e-08
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-07
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-06
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-05
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-05
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-05
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-05
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-09
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	2e-09
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	2e-09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	4e-09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-04
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	2e-09
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	1e-05
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	5e-05
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-09
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-09
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-08
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-08
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-06
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	3e-09
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-08
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	9e-08
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	6e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	4e-09
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	8e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-04
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	7e-09
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	4e-05
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	5e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	8e-09
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-06
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-06
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	4e-06
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-05
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-05
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-05
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	1e-08
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	1e-08
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	2e-08
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	4e-08
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	3e-04
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	1e-08
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	5e-08
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	1e-06
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	3e-08
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-05
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	4e-08
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	7e-07
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	5e-06
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	6e-06
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	7e-05
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	4e-08
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	2e-05
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	5e-08
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-05
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-04
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	1e-07
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	4e-07
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	5e-07
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-06
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-05
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-04
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	8e-04
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	1e-07
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-05
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	2e-07
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	2e-04
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	7e-04
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	3e-07
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	5e-07
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	5e-04
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	4e-07
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	5e-07
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	5e-07
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	8e-07
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	1e-06
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	1e-06
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	6e-05
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-06
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	5e-06
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	3e-06
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	2e-05
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	3e-05
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	4e-05
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	7e-04
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	8e-05
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	2e-04
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	2e-04
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	5e-04
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	9e-04
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	6e-04

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591	Back alignment and structure

 Score =  249 bits (637), Expect = 5e-72
 Identities = 48/342 (14%), Positives = 104/342 (30%), Gaps = 44/342 (12%)

Query: 2   AGAPGSRIIVTTRSRDVASKMG--PVKYYGLKLLSDDDCWSVFVAHAFDSRDAGTHGNFE 59
           A     +I++TTR + V   +            L  +    +               +  
Sbjct: 253 AFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVNMK-----KADLP 307

Query: 60  STRQRVVEKCKGLPLAARALGGLLGSK-QRVDEWRAILDSKIWDL------EDETEVPSV 112
                ++++CKG PL    +G LL     R + +   L +K +         D   +   
Sbjct: 308 EQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYDYEALDEA 367

Query: 113 LKLSYHHLPSHLKRCFAYCAILPKDYEFQEEELVLLWIAEGLIQQSKDRKQADDLGSEYF 172
           + +S   L   +K  +   +IL KD +   + L +LW  E             +   +  
Sbjct: 368 MSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMET------------EEVEDIL 415

Query: 173 HDLLSRSLFQKSSNSGSK-FVMHDLVHDLAQWASGETCFRLDDQFSADRQSNVFEKVRHS 231
            + +++SL     N  S  + +HDL  D       + C +L D      +  + +  R+ 
Sbjct: 416 QEFVNKSLLFCDRNGKSFRYYLHDLQVDFLT---EKNCSQLQD----LHKKIITQFQRYH 468

Query: 232 SYVRSGDCDGMGVRCDGMNKFKVLDKVENLRTFLPIFVEECFFSPAGYISPMVISDLLPK 291
               +   D              +   +  +    +     +         +  + L+ +
Sbjct: 469 QP-HTLSPDQEDCMYWYNFLAYHMASAKMHKELCALMFSLDWIK--AKTELVGPAHLIHE 525

Query: 292 CKKLRVLSLGRYRISEVPTSIGCLKHLRYLNFSESWIKCLPE 333
             + R        I +            +L+ +   +   P 
Sbjct: 526 FVEYR-------HILDEKDCAVSENFQEFLSLNGHLLGRQPF 560

PyMOL of 1z6t

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		1000
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	100.0
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	100.0
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	100.0
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	100.0
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	100.0
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	100.0
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	100.0
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	100.0
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	100.0
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.98
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.97
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.97
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.97
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.97
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.97
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.96
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.95
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.95
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.95
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	99.94
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.94
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.93
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.93
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.93
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.92
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.91
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.9
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.89
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.88
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.88
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.88
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.88
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.87
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.87
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.87
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.87
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.85
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.84
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	99.83
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	99.83
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.81
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.81
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.81
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.8
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.77
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.77
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.77
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.77
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.77
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.76
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.76
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.75
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	99.75
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.74
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.74
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.73
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.73
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.72
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.72
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.72
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.71
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.71
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.69
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.69
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.69
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.69
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.68
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.67
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.67
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.67
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.65
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.64
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.63
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.63
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.63
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.63
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.62
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.62
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.59
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.58
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.58
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.56
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.56
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.56
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.55
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.54
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.51
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.49
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.47
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.46
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.46
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.45
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.45
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.44
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.41
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.41
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.4
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.4
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.38
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.37
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.37
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.37
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.36
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.35
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.35
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.34
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.33
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.32
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.31
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.29
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.28
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.27
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.27
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.26
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.2
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.19
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.17
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.16
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.16
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.15
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.15
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.15
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.15
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.15
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.14
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.11
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.11
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.05
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.03
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.02
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.01
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.0
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.98
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.98
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.97
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.95
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.91
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.72
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.67
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.64
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.63
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.58
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.23
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.17
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.13
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	98.08
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.94
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.89
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	97.83
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.82
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.79
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.77
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.77
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	97.67
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	97.61
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.34
2qen_A		350	Walker-type ATPase; unknown function; HET: ADP; 2.	97.01
2fna_A		357	Conserved hypothetical protein; structural genomic	96.77
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	96.52
1w5s_A		412	Origin recognition complex subunit 2 ORC2; replica	95.96
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	94.1
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	93.73
2qby_B		384	CDC6 homolog 3, cell division control protein 6 ho	91.45
1hqc_A		324	RUVB; extended AAA-ATPase domain, complex with nuc	91.01
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	90.99
2v1u_A		387	Cell division control protein 6 homolog; DNA repli	88.71
1njg_A		250	DNA polymerase III subunit gamma; rossman-like fol	86.33
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	85.45
1fnn_A		389	CDC6P, cell division control protein 6; ORC1, AAA	81.09

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

Probab=100.00  E-value=4.7e-52  Score=508.28  Aligned_cols=639  Identities=15%  Similarity=0.105  Sum_probs=434.6

Q ss_pred             hhhhhcCCCcceEEEcCCcccccccccccCCCCccEeecCCCccc-ccch--hhhccCCCcEEeccCCcCcccCChhh-h
Q 040304          285 ISDLLPKCKKLRVLSLGRYRISEVPTSIGCLKHLRYLNFSESWIK-CLPE--AITSLFNLEILILSDCRLLLKLPSSI-G  360 (1000)
Q Consensus       285 ~~~~~~~l~~L~~L~L~~n~l~~lp~~~~~l~~L~~L~Ls~n~i~-~lp~--~i~~L~~L~~L~L~~~~~~~~lp~~i-~  360 (1000)
                      ++..+..++.|++++++.+.+..+|..|+.+++|++|+|++|.+. .+|.  .++++++|++|+|++|.+.+.+|..+ .
T Consensus        69 l~~~l~~L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~  148 (768)
T 3rgz_A           69 VSSSLLSLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGL  148 (768)
T ss_dssp             HHHHTTTCTTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCC
T ss_pred             cChhHhccCcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhc
Confidence            566788999999999999999888899999999999999999887 4777  89999999999999999878888765 8


Q ss_pred             ccccccceeecCcccccccccc---ccCCcccCccCceEecCCCCCChhhccchhhhhhhhhhcCCCCCCChhhhhHHhh
Q 040304          361 NLVNLYHLDIDGANRLCELPLG---MKELKCLRTLTNFIVGKDSGCALKDLKNWKFLRGRLCISGLENVIDSQEANEALL  437 (1000)
Q Consensus       361 ~L~~L~~L~L~~~~~l~~ip~~---i~~L~~L~~L~~~~~~~~~~~~~~~l~~L~~L~~~l~~~~l~~~~~~~~~~~~~l  437 (1000)
                      ++++|++|++++|...+..|..   +.++++|++|+...........                                .
T Consensus       149 ~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~--------------------------------~  196 (768)
T 3rgz_A          149 KLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD--------------------------------V  196 (768)
T ss_dssp             CCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCB--------------------------------C
T ss_pred             cCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCC--------------------------------c
Confidence            8999999999999655555655   7888888888532211110000                                1


Q ss_pred             ccccCCceeEEEeecCCCCCCcchHHHHHHHhhcCCCCCcceEEEeeeCCC-CCCcccCCCCCCceeEEEEcCCCCCCCC
Q 040304          438 RVKKDLEVLKLEWRARRDGDSVDEVREKNILDMLKPHGNIKRLVINSYGGT-RFPSWIGDPSFSNVAVLILKNCRRSTSL  516 (1000)
Q Consensus       438 ~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~-~~p~~~~~~~~~~L~~L~L~~~~~~~~l  516 (1000)
                      ..+++|+.|+++++....           ....+..+++|++|+++++... .+|.++..  +++|++|++++|.+.+.+
T Consensus       197 ~~l~~L~~L~Ls~n~l~~-----------~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~--l~~L~~L~Ls~n~l~~~~  263 (768)
T 3rgz_A          197 SRCVNLEFLDVSSNNFST-----------GIPFLGDCSALQHLDISGNKLSGDFSRAIST--CTELKLLNISSNQFVGPI  263 (768)
T ss_dssp             TTCTTCCEEECCSSCCCS-----------CCCBCTTCCSCCEEECCSSCCCSCHHHHTTT--CSSCCEEECCSSCCEESC
T ss_pred             ccCCcCCEEECcCCcCCC-----------CCcccccCCCCCEEECcCCcCCCcccHHHhc--CCCCCEEECCCCcccCcc
Confidence            234556666665433210           0112455666677777666654 23444443  667777777777666555


Q ss_pred             CCCCCcCCCCeEEEeecccceeecccccCCCCCCCCCCcceeeccCcccccccCCCCCCccccccCCccceEEecCCccc
Q 040304          517 PSLGQLCSLKDLTIVRMSALKGIGSEINGECCSKPFPSLQTLYFEDLQVWEKWEPNTENDEHVQAFPRLQKLFIHKCPKL  596 (1000)
Q Consensus       517 ~~~~~l~~L~~L~L~~~~~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l  596 (1000)
                      |.. .+++|++|++++|...+.++..+..     .+++|+.|++++|..      .+..+..++.+++|++|++++ +.+
T Consensus       264 ~~~-~l~~L~~L~L~~n~l~~~ip~~~~~-----~~~~L~~L~Ls~n~l------~~~~p~~~~~l~~L~~L~L~~-n~l  330 (768)
T 3rgz_A          264 PPL-PLKSLQYLSLAENKFTGEIPDFLSG-----ACDTLTGLDLSGNHF------YGAVPPFFGSCSLLESLALSS-NNF  330 (768)
T ss_dssp             CCC-CCTTCCEEECCSSEEEESCCCCSCT-----TCTTCSEEECCSSEE------EECCCGGGGGCTTCCEEECCS-SEE
T ss_pred             Ccc-ccCCCCEEECcCCccCCccCHHHHh-----hcCcCCEEECcCCcC------CCccchHHhcCCCccEEECCC-Ccc
Confidence            544 6667777777766554444443322     136677777777665      223344556667777777776 355


Q ss_pred             ccCCC----CCCCCccEEEEecccccc---ccCCCCC-cceEEEEcCCCCcc--cccccC--CCCcceEEecCCcccccc
Q 040304          597 SGRLP----NHLPSLEKIVITECRQLV---ISLPSVP-ALCKLKIDGCKRLV--CDGLSE--SKSLNKMTLWNISEFENW  664 (1000)
Q Consensus       597 ~~~~p----~~l~~L~~L~l~~~~~l~---~~~~~l~-~L~~L~l~~~~~~~--~~~~~~--~~~L~~L~l~~~~~l~~~  664 (1000)
                      ++.+|    ..+++|++|++.+|....   ..+..++ +|+.|++++|....  ...+..  +++|+.|+++++......
T Consensus       331 ~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~  410 (768)
T 3rgz_A          331 SGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKI  410 (768)
T ss_dssp             EEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEEC
T ss_pred             cCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCcccccc
Confidence            55555    235666677666664221   1111233 67777777765322  122222  566777777776544343


Q ss_pred             c--cccccccceeEEecCCC-------CCccCCcceeEeccCCCccccccCCCCCccccEEEEecccCceeccccccCcc
Q 040304          665 S--SQKFQNVEHLEIVGCEG-------SSTCLDLESLSVFRCPLLTCLWTGGWLPVTLKRLEIWCCYNFKVLTSECQLPV  735 (1000)
Q Consensus       665 ~--~~~~~~L~~L~l~~~~~-------~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~l~~~~~~~~  735 (1000)
                      +  +..+++|+.|++++|..       +..+++|+.|++++|...+.+|.....+++|+.|++++|.....+|..+..++
T Consensus       411 p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~  490 (768)
T 3rgz_A          411 PPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCT  490 (768)
T ss_dssp             CGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCT
T ss_pred             CHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCC
Confidence            3  45667777777777653       34677888888888887777777767778888888888877777888888888


Q ss_pred             ccceEeecCCCchhhhhhhcCCcccccceeeccccccccccccccCCCCcceEeecCCCCccccCCCCCC-CCCceE---
Q 040304          736 AIEALTISNCSNLESIAERFYDDACLRSILISSCDNLKSLPIGLNNLSHLHRISIEGCHNLVSLPEDALP-SSVVDV---  811 (1000)
Q Consensus       736 ~L~~L~L~~~~~l~~l~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~l~~L~~L~l~~c~~l~~l~~~~~~-~~L~~L---  811 (1000)
                      +|++|++++|.....+|.++..+++|++|++++|...+.+|..+..+++|+.|++++|+....+|...+. ..+..+   
T Consensus       491 ~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~  570 (768)
T 3rgz_A          491 NLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFI  570 (768)
T ss_dssp             TCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTT
T ss_pred             CCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcc
Confidence            8888888888777778888888888888888888777788888888888888888887655566654322 111111   


Q ss_pred             ------eeccccC------------ccCCCCC--CCccccceeccccCCCccccCCC-CCCCCccEEEeccccCcccccc
Q 040304          812 ------SIEECDK------------LKGPLPT--GKISSLQELSLKKCPGIVFFPEE-GLSTNLTYLEISGANIYKPLVN  870 (1000)
Q Consensus       812 ------~l~~~~~------------l~~~~~~--~~l~~L~~L~l~~~~~~~~~~~~-~~l~~L~~L~L~~n~~~~~~~~  870 (1000)
                            .+.+...            +.+..+.  ..++.++.++++.+...+.+|.. +.+++|++|+|++|.+.+.+|.
T Consensus       571 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~  650 (768)
T 3rgz_A          571 AGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPK  650 (768)
T ss_dssp             CSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCG
T ss_pred             ccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCH
Confidence                  1111100            1111111  14555666677766656666665 7789999999999999998887


Q ss_pred             cccccCCccceEEECCCCCccccccccccccCCCCcCeEEeccCCCcc-ccCccccCCCCccccccccCCCCCcCCCCCC
Q 040304          871 WGFHKLTSLRKLCINGCSDAASFPEVEKGVILPTSLTWIRISDFPKLE-RLSSKGFHYLVSLESLEVFSCPNFTSFPEAG  949 (1000)
Q Consensus       871 ~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~L~~L~l~~~~~l~-~l~~~~~~~l~~L~~L~l~~c~~l~~l~~~~  949 (1000)
                       .++.+++|+.|++++|...+.+|..   +..+++|+.|++++| +++ .+| ..+..+++|+.|++++|+..+.+|..+
T Consensus       651 -~l~~l~~L~~L~Ls~N~l~g~ip~~---l~~L~~L~~LdLs~N-~l~g~ip-~~l~~l~~L~~L~ls~N~l~g~iP~~~  724 (768)
T 3rgz_A          651 -EIGSMPYLFILNLGHNDISGSIPDE---VGDLRGLNILDLSSN-KLDGRIP-QAMSALTMLTEIDLSNNNLSGPIPEMG  724 (768)
T ss_dssp             -GGGGCTTCCEEECCSSCCCSCCCGG---GGGCTTCCEEECCSS-CCEECCC-GGGGGCCCCSEEECCSSEEEEECCSSS
T ss_pred             -HHhccccCCEEeCcCCccCCCCChH---HhCCCCCCEEECCCC-cccCcCC-hHHhCCCCCCEEECcCCcccccCCCch
Confidence             6999999999999998777788873   346799999999999 555 566 789999999999999998888999877


Q ss_pred             CCCCcceEeecCCchhh----HhhhccCCCCCccccCCceEE
Q 040304          950 FPSSLLSLKIIGCPLLG----NKCRKDKGQEWPKIAHIPYVV  987 (1000)
Q Consensus       950 ~~~sL~~L~l~~c~~l~----~~~~~~~~~~~~~~~~~~~~~  987 (1000)
                      .+.++....+.+||.+=    ..|....+++|+||+|++.++
T Consensus       725 ~~~~~~~~~~~gN~~Lcg~~l~~C~~~~~~~~~~~~~~~~~~  766 (768)
T 3rgz_A          725 QFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQRSHHHH  766 (768)
T ss_dssp             SGGGSCGGGGCSCTEEESTTSCCCCSCC--------------
T ss_pred             hhccCCHHHhcCCchhcCCCCcCCCCCccCCCCCCCCccccC
Confidence            78888888888886442    279999999999999999865

PyMOL of 3rgz

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi}	Back alignment and structure

>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A*	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}	Back alignment and structure

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		1000
d2a5yb3		277	c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor	2e-23
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	2e-06
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	7e-06
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	1e-05
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	0.003
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	0.003
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	1e-05
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	1e-05
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	3e-05
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	0.002

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 99.5 bits (247), Expect = 2e-23
 Identities = 20/128 (15%), Positives = 41/128 (32%), Gaps = 7/128 (5%)

Query: 4   APGSRIIVTTRSRDVASKM-GPVKYYGLKLLSDDDCWSVFVAHAFDSRDAGTHGNFESTR 62
               R +VTTR  ++++      ++  +  L  D+C+    A+           +     
Sbjct: 155 ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDV---L 211

Query: 63  QRVVEKCKGLPLAARALGGLLGSKQRVDEWRAILDSKIWDLEDETEVPSVLKLSYHHLPS 122
            + +E   G P            K   ++   + +    +      V  +   SY  L  
Sbjct: 212 NKTIELSSGNPATLMMFFKSCEPKTF-EKMAQLNNK--LESRGLVGVECITPYSYKSLAM 268

Query: 123 HLKRCFAY 130
            L+RC   
Sbjct: 269 ALQRCVEV 276

PyMOL of d2a5yb3

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		1000
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.82
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.77
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	99.75
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.74
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.72
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.68
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.63
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.62
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.6
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.59
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.57
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.55
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.55
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.4
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.4
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.38
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.37
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.36
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.34
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.32
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.32
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.31
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.27
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.24
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.2
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.17
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.17
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.12
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.06
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.9
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.82
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.79
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.75
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.73
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.72
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.41
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.09
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.93
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.73
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	95.95
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	95.7
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.51
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	93.44

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.82  E-value=1.1e-20  Score=202.49  Aligned_cols=86  Identities=14%  Similarity=0.171  Sum_probs=50.7

Q ss_pred             eeEEEEcCCCCCCCCC-CCCCcCCCCeEEEeecccceeecccccCCCCCCCCCCcceeeccCcccccccCCCCCCccccc
Q 040304          502 VAVLILKNCRRSTSLP-SLGQLCSLKDLTIVRMSALKGIGSEINGECCSKPFPSLQTLYFEDLQVWEKWEPNTENDEHVQ  580 (1000)
Q Consensus       502 L~~L~L~~~~~~~~l~-~~~~l~~L~~L~L~~~~~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~  580 (1000)
                      ...+++.++...+.+| .++.+++|+.+++.++.....++ .+      ..+++|+.|++++|..      .+..|+.++
T Consensus       199 ~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~------~~~~~L~~L~Ls~N~l------~g~iP~~l~  265 (313)
T d1ogqa_         199 LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KV------GLSKNLNGLDLRNNRI------YGTLPQGLT  265 (313)
T ss_dssp             CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GC------CCCTTCCEEECCSSCC------EECCCGGGG
T ss_pred             cccccccccccccccccccccccccccccccccccccccc-cc------ccccccccccCccCee------cccCChHHh
Confidence            3456666666655555 45567777777777665433222 22      2256677777776665      223445556


Q ss_pred             cCCccceEEecCCcccccCCC
Q 040304          581 AFPRLQKLFIHKCPKLSGRLP  601 (1000)
Q Consensus       581 ~~~~L~~L~l~~c~~l~~~~p  601 (1000)
                      .+++|++|+|++ |+++|.+|
T Consensus       266 ~L~~L~~L~Ls~-N~l~g~iP  285 (313)
T d1ogqa_         266 QLKFLHSLNVSF-NNLCGEIP  285 (313)
T ss_dssp             GCTTCCEEECCS-SEEEEECC
T ss_pred             CCCCCCEEECcC-CcccccCC
Confidence            667777777776 56666555

PyMOL of d1ogqa_

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure