Citrus Sinensis ID: 040308

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------
MSGNLGCVIVAVDGGEESMDALRWAIDNLKLRSPAPGSFIVLHVQPPPTIAAGLNPGAIPFGGPSHVEVPAFTAAIEAHQGRITQAIIDHALKICSEKNVNVKSEVVIGDAKEKVCELVEKLHADLLVMGSHTFGPIKRMFLGSVSNYCANHAQCPVVVVKGKGTSS
ccccccEEEEEEcccHHHHHHHHHHHHHHHHccccccEEEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHccccEEEEcccccccccccEEccHHHHHHccccccEEEEccccccc
ccccccEEEEEEcccHHHHHHHHHHHHHHHcccccccEEEEEEEccccccccccccHHcccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHcccEEEEEEEEccHHHHHHHHHHHccccEEEEEcccccHHHHHHHccccHHHHccccccEEEEEcccccc
MSGNLGCVIVAVDGGEESMDALRWAIDnlklrspapgsfivlhvqppptiaaglnpgaipfggpshvevpAFTAAIEAHQGRITQAIIDHALKICseknvnvkseVVIGDAKEKVCELVEKLHADLLVmgshtfgpikrMFLGSVSnycanhaqcpvvvvkgkgtss
MSGNLGCVIVAVDGGEESMDALRWAIDNLKLRSPAPGSFIVLHVQPPPTIAAGLNPGAIPFGGPSHVEVPAFTAAIEAHQGRITQAIIDHALKICSEKNVNVKSEVVIGDAKEKVCELVEKLHADLLVMGSHTFGPIKRMFLGSVSNYCANHAQCPVVVVKGKGTSS
MSGNLGCVIVAVDGGEESMDALRWAIDNLKLRSPAPGSFIVLHVQPPPTIAAGLNPGAIPFGGPSHVEVPAFTAAIEAHQGRITQAIIDHALKICSEKNVNVKSEVVIGDAKEKVCELVEKLHADLLVMGSHTFGPIKRMFLGSVSNYCANHAQCPVVVVKGKGTSS
****LGCVIVAVDGGEESMDALRWAIDNLKLRSPAPGSFIVLHVQPPPTIAAGLNPGAIPFGGPSHVEVPAFTAAIEAHQGRITQAIIDHALKICSEKNVNVKSEVVIGDAKEKVCELVEKLHADLLVMGSHTFGPIKRMFLGSVSNYCANHAQCPVVVVK******
**GNLGCVIVAVDGGEESMDALRWAIDNLKLRSPAPGSFIVLHVQPPPTIAAGLNPGAIPFGGPSHVEVPAFTAAIEAHQGRITQAIIDHALKICSEKNVNVKSEVVIGDAKEKVCELVEKLHADLLVMGSHTFGPIKRMFLGSVSNYCANHAQCPV***KG*****
MSGNLGCVIVAVDGGEESMDALRWAIDNLKLRSPAPGSFIVLHVQPPPTIAAGLNPGAIPFGGPSHVEVPAFTAAIEAHQGRITQAIIDHALKICSEKNVNVKSEVVIGDAKEKVCELVEKLHADLLVMGSHTFGPIKRMFLGSVSNYCANHAQCPVVV********
****LGCVIVAVDGGEESMDALRWAIDNLKLRSPAPGSFIVLHVQPPPTIAAGLNPGAIPFGGPSHVEVPAFTAAIEAHQGRITQAIIDHALKICSEKNVNVKSEVVIGDAKEKVCELVEKLHADLLVMGSHTFGPIKRMFLGSVSNYCANHAQCPVVVVKGK****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGNLGCVIVAVDGGEESMDALRWAIDNLKLRSPAPGSFIVLHVQPPPTIAAGLNPGAIPFGGPSHVEVPAFTAAIEAHQGRITQAIIDHALKICSEKNVNVKSEVVIGDAKEKVCELVEKLHADLLVMGSHTFGPIKRMFLGSVSNYCANHAQCPVVVVKGKGTSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query167 2.2.26 [Sep-21-2011]
Q8LGG8175 Universal stress protein no no 0.796 0.76 0.241 6e-10
O07552166 Stress response protein N yes no 0.880 0.885 0.281 9e-07
P74148154 Universal stress protein N/A no 0.880 0.954 0.245 3e-06
Q57951170 Universal stress protein yes no 0.461 0.452 0.350 6e-06
P87132601 Uncharacterized protein C yes no 0.526 0.146 0.329 8e-05
A0QZA1294 Universal stress protein no no 0.790 0.448 0.292 9e-05
P42297148 Universal stress protein no no 0.862 0.972 0.246 0.0002
P64922 295 Universal stress protein yes no 0.754 0.427 0.272 0.0005
P64921 295 Universal stress protein yes no 0.754 0.427 0.272 0.0005
O06189 297 Universal stress protein no no 0.826 0.464 0.283 0.0007
>sp|Q8LGG8|USPAL_ARATH Universal stress protein A-like protein OS=Arabidopsis thaliana GN=At3g01520 PE=1 SV=2 Back     alignment and function desciption
 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 71/141 (50%), Gaps = 8/141 (5%)

Query: 21  ALRWAIDNLKLRSPAPGSFIVLHVQPPPTIAAGLNPGAIPFGGPSHVEVPAFTAAIEAHQ 80
           A  W ++ +   + +    ++LHVQ       G +     +  P       F    ++++
Sbjct: 30  AFEWTLEKIVRSNTSDFKILLLHVQV--VDEDGFDDVDSIYASPED-----FRDMRQSNK 82

Query: 81  GRITQAIIDHALKICSEKNVNVKSEVVIGDAKEKVCELVEKLHADLLVMGSHTFGPIKRM 140
            +    +++  +  C E  V  ++ +  GD K+ +C+ V+++  D LV+GS   G  +++
Sbjct: 83  AKGLH-LLEFFVNKCHEIGVGCEAWIKTGDPKDVICQEVKRVRPDFLVVGSRGLGRFQKV 141

Query: 141 FLGSVSNYCANHAQCPVVVVK 161
           F+G+VS +C  HA+CPV+ +K
Sbjct: 142 FVGTVSAFCVKHAECPVMTIK 162

Arabidopsis thaliana (taxid: 3702)
>sp|O07552|NHAX_BACSU Stress response protein NhaX OS=Bacillus subtilis (strain 168) GN=nhaX PE=2 SV=2 Back     alignment and function description
>sp|P74148|Y1388_SYNY3 Universal stress protein Sll1388 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1388 PE=3 SV=1 Back     alignment and function description
>sp|Q57951|Y531_METJA Universal stress protein MJ0531 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0531 PE=3 SV=1 Back     alignment and function description
>sp|P87132|YFK5_SCHPO Uncharacterized protein C167.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC167.05 PE=1 SV=2 Back     alignment and function description
>sp|A0QZA1|Y3950_MYCS2 Universal stress protein MSMEG_3950/MSMEI_3859 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_3950 PE=1 SV=1 Back     alignment and function description
>sp|P42297|YXIE_BACSU Universal stress protein YxiE OS=Bacillus subtilis (strain 168) GN=yxiE PE=3 SV=1 Back     alignment and function description
>sp|P64922|Y2028_MYCBO Universal stress protein Mb2028c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2028c PE=3 SV=1 Back     alignment and function description
>sp|P64921|Y2005_MYCTU Universal stress protein Rv2005c/MT2061 OS=Mycobacterium tuberculosis GN=Rv2005c PE=1 SV=1 Back     alignment and function description
>sp|O06189|Y2623_MYCTU Universal stress protein Rv2623/MT2698 OS=Mycobacterium tuberculosis GN=Rv2623 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
224067048173 predicted protein [Populus trichocarpa] 1.0 0.965 0.768 6e-72
255545934176 conserved hypothetical protein [Ricinus 1.0 0.948 0.75 3e-71
225459113168 PREDICTED: universal stress protein A-li 0.964 0.958 0.769 2e-69
357489967177 Universal stress protein A-like protein 0.976 0.920 0.726 4e-67
357489965179 Universal stress protein A-like protein 0.976 0.910 0.723 3e-66
115448821162 Os02g0760500 [Oryza sativa Japonica Grou 0.952 0.981 0.745 3e-65
449461379175 PREDICTED: universal stress protein A-li 1.0 0.954 0.699 3e-64
5669654168 ER6 protein [Solanum lycopersicum] 0.946 0.940 0.737 3e-64
356552957179 PREDICTED: stress response protein nhaX- 0.964 0.899 0.702 2e-63
242066596162 hypothetical protein SORBIDRAFT_04g03392 0.952 0.981 0.726 4e-62
>gi|224067048|ref|XP_002302337.1| predicted protein [Populus trichocarpa] gi|222844063|gb|EEE81610.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  275 bits (702), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 133/173 (76%), Positives = 150/173 (86%), Gaps = 6/173 (3%)

Query: 1   MSGNLGCVIVAVDGGEESMDALRWAIDNLKLRSPAP------GSFIVLHVQPPPTIAAGL 54
           MS NLGCVIVAVDG EESM+ALR A+DNLKLRSPAP      GSF++LHVQPPP+IAAGL
Sbjct: 1   MSANLGCVIVAVDGSEESMNALRHALDNLKLRSPAPDSTETPGSFVILHVQPPPSIAAGL 60

Query: 55  NPGAIPFGGPSHVEVPAFTAAIEAHQGRITQAIIDHALKICSEKNVNVKSEVVIGDAKEK 114
           NPGAIPFGGPS +EVPAFTAAIEAHQ RIT+AI++HAL+IC EK VNVK++VVIGD KEK
Sbjct: 61  NPGAIPFGGPSGLEVPAFTAAIEAHQRRITEAILEHALEICREKKVNVKTQVVIGDPKEK 120

Query: 115 VCELVEKLHADLLVMGSHTFGPIKRMFLGSVSNYCANHAQCPVVVVKGKGTSS 167
           +CE+ E L ADLLVMG  +FGPIKRMFLGSVSNYC N AQCPV++VKGK  SS
Sbjct: 121 ICEVAENLPADLLVMGCRSFGPIKRMFLGSVSNYCTNQAQCPVIIVKGKDPSS 173

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255545934|ref|XP_002514027.1| conserved hypothetical protein [Ricinus communis] gi|223547113|gb|EEF48610.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|225459113|ref|XP_002285692.1| PREDICTED: universal stress protein A-like protein [Vitis vinifera] gi|302142048|emb|CBI19251.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357489967|ref|XP_003615271.1| Universal stress protein A-like protein [Medicago truncatula] gi|355516606|gb|AES98229.1| Universal stress protein A-like protein [Medicago truncatula] gi|388494584|gb|AFK35358.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357489965|ref|XP_003615270.1| Universal stress protein A-like protein [Medicago truncatula] gi|217071340|gb|ACJ84030.1| unknown [Medicago truncatula] gi|355516605|gb|AES98228.1| Universal stress protein A-like protein [Medicago truncatula] gi|388496022|gb|AFK36077.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|115448821|ref|NP_001048190.1| Os02g0760500 [Oryza sativa Japonica Group] gi|47497367|dbj|BAD19406.1| putative ethylene-responsive protein [Oryza sativa Japonica Group] gi|113537721|dbj|BAF10104.1| Os02g0760500 [Oryza sativa Japonica Group] gi|215693118|dbj|BAG88500.1| unnamed protein product [Oryza sativa Japonica Group] gi|218191615|gb|EEC74042.1| hypothetical protein OsI_09021 [Oryza sativa Indica Group] gi|222623713|gb|EEE57845.1| hypothetical protein OsJ_08468 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|449461379|ref|XP_004148419.1| PREDICTED: universal stress protein A-like protein-like [Cucumis sativus] gi|449518061|ref|XP_004166062.1| PREDICTED: universal stress protein A-like protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|5669654|gb|AAD46412.1|AF096262_1 ER6 protein [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|356552957|ref|XP_003544826.1| PREDICTED: stress response protein nhaX-like [Glycine max] Back     alignment and taxonomy information
>gi|242066596|ref|XP_002454587.1| hypothetical protein SORBIDRAFT_04g033920 [Sorghum bicolor] gi|241934418|gb|EES07563.1| hypothetical protein SORBIDRAFT_04g033920 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
TAIR|locus:2024291171 AT1G09740 "AT1G09740" [Arabido 1.0 0.976 0.696 1.2e-60
TAIR|locus:2081531226 AT3G11930 "AT3G11930" [Arabido 0.820 0.606 0.344 2.1e-25
TAIR|locus:2096089162 AT3G62550 "AT3G62550" [Arabido 0.868 0.895 0.388 1.2e-24
TAIR|locus:2076381204 AT3G58450 "AT3G58450" [Arabido 0.892 0.730 0.388 1e-22
TAIR|locus:2043273162 AT2G47710 "AT2G47710" [Arabido 0.862 0.888 0.369 3e-21
TAIR|locus:2199282160 AT1G68300 "AT1G68300" [Arabido 0.886 0.925 0.384 1.7e-20
TAIR|locus:2131719260 PHOS34 "AT4G27320" [Arabidopsi 0.808 0.519 0.364 1.1e-14
TAIR|locus:2222687175 AT5G14680 "AT5G14680" [Arabido 0.449 0.428 0.346 1.9e-14
TAIR|locus:2147319242 PHOS32 "AT5G54430" [Arabidopsi 0.868 0.599 0.352 3e-14
TAIR|locus:2084525160 AT3G53990 "AT3G53990" [Arabido 0.892 0.931 0.304 7.9e-14
TAIR|locus:2024291 AT1G09740 "AT1G09740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 621 (223.7 bits), Expect = 1.2e-60, P = 1.2e-60
 Identities = 117/168 (69%), Positives = 140/168 (83%)

Query:     1 MSGNLGCVIVAVDGGEESMDALRWAIDNLKLRSPAP-GSFIVLHVQPPPTIAAGLNPGAI 59
             +SG+L CV+VAVDG E SM+ALRWA+DNLKL S +   SF+VLHVQP P++AAG++PG I
Sbjct:     3 VSGSLNCVVVAVDGSEVSMEALRWALDNLKLSSSSSDSSFVVLHVQPSPSVAAGVSPGTI 62

Query:    60 PFGGPSHVEVPAFTAAIEAHQGRITQAIIDHALKICSEKNVNVKSEVVIGDAKEKVCELV 119
             PFGGPS +EVPAFTAAIE HQ RIT  I++HA +IC+EK+VNVK++VVIGD K K+CE V
Sbjct:    63 PFGGPSGLEVPAFTAAIEQHQKRITDTILEHASQICAEKSVNVKTQVVIGDPKYKICEAV 122

Query:   120 EKLHADLLVMGSHTFGPIKRMFLGSVSNYCANHAQCPVVVVKGKGTSS 167
             E LHADLLVMGS  +G IKRMFLGSVSNYC NHA CPVV++K K  SS
Sbjct:   123 ENLHADLLVMGSRAYGRIKRMFLGSVSNYCTNHAHCPVVIIKPKEDSS 170
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0002238 "response to molecule of fungal origin" evidence=RCA
GO:0006826 "iron ion transport" evidence=RCA
GO:0010106 "cellular response to iron ion starvation" evidence=RCA
GO:0010167 "response to nitrate" evidence=RCA
GO:0015706 "nitrate transport" evidence=RCA
TAIR|locus:2081531 AT3G11930 "AT3G11930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096089 AT3G62550 "AT3G62550" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076381 AT3G58450 "AT3G58450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043273 AT2G47710 "AT2G47710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199282 AT1G68300 "AT1G68300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131719 PHOS34 "AT4G27320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2222687 AT5G14680 "AT5G14680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147319 PHOS32 "AT5G54430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084525 AT3G53990 "AT3G53990" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
cd00293130 cd00293, USP_Like, Usp: Universal stress protein f 6e-31
pfam00582139 pfam00582, Usp, Universal stress protein family 3e-28
COG0589154 COG0589, UspA, Universal stress protein UspA and r 2e-18
cd01989146 cd01989, STK_N, The N-terminal domain of Eukaryoti 1e-10
PRK15005144 PRK15005, PRK15005, universal stress protein F; Pr 9e-07
PRK15456142 PRK15456, PRK15456, universal stress protein UspG; 8e-05
cd01988132 cd01988, Na_H_Antiporter_C, The C-terminal domain 0.001
>gnl|CDD|238182 cd00293, USP_Like, Usp: Universal stress protein family Back     alignment and domain information 
 Score =  108 bits (271), Expect = 6e-31
 Identities = 50/153 (32%), Positives = 74/153 (48%), Gaps = 24/153 (15%)

Query: 8   VIVAVDGGEESMDALRWAIDNLKLRSPAPGSFIVLHVQPPPTIAAGLNPGAIPFGGPSHV 67
           ++VAVDG EES  ALRWA    +         ++LHV  PP                   
Sbjct: 2   ILVAVDGSEESERALRWAARLARRLG---AELVLLHVVDPP------------------- 39

Query: 68  EVPAFTAAIEAHQGRITQAIIDHALKICSEKNVNVKSEVVIGDAKEKVCELVEKLHADLL 127
             P+  A +        +A+++   +  +E  V V++ V+ GD  E + E  E+L ADL+
Sbjct: 40  --PSSAAELAELLEEEARALLEALREALAEAGVKVETVVLEGDPAEAILEAAEELGADLI 97

Query: 128 VMGSHTFGPIKRMFLGSVSNYCANHAQCPVVVV 160
           VMGS     ++R+ LGSV+     HA CPV+VV
Sbjct: 98  VMGSRGRSGLRRLLLGSVAERVLRHAPCPVLVV 130

The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity. Length = 130
>gnl|CDD|216006 pfam00582, Usp, Universal stress protein family Back     alignment and domain information
>gnl|CDD|223662 COG0589, UspA, Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|238947 cd01989, STK_N, The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
>gnl|CDD|184967 PRK15005, PRK15005, universal stress protein F; Provisional Back     alignment and domain information
>gnl|CDD|185353 PRK15456, PRK15456, universal stress protein UspG; Provisional Back     alignment and domain information
>gnl|CDD|238946 cd01988, Na_H_Antiporter_C, The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 167
PRK15456142 universal stress protein UspG; Provisional 99.97
PRK15005144 universal stress protein F; Provisional 99.96
PRK09982142 universal stress protein UspD; Provisional 99.96
cd01989146 STK_N The N-terminal domain of Eukaryotic Serine T 99.96
PRK15118144 universal stress global response regulator UspA; P 99.95
PF00582140 Usp: Universal stress protein family; InterPro: IP 99.95
PRK10116142 universal stress protein UspC; Provisional 99.95
PRK11175 305 universal stress protein UspE; Provisional 99.94
cd01988132 Na_H_Antiporter_C The C-terminal domain of a subfa 99.93
cd01987124 USP_OKCHK USP domain is located between the N-term 99.92
PRK11175305 universal stress protein UspE; Provisional 99.89
cd00293130 USP_Like Usp: Universal stress protein family. The 99.88
COG0589154 UspA Universal stress protein UspA and related nuc 99.88
PRK12652 357 putative monovalent cation/H+ antiporter subunit E 99.79
PRK10490 895 sensor protein KdpD; Provisional 99.52
COG2205 890 KdpD Osmosensitive K+ channel histidine kinase [Si 99.44
cd0198486 AANH_like Adenine nucleotide alpha hydrolases supe 98.68
PLN03159 832 cation/H(+) antiporter 15; Provisional 98.09
TIGR02432189 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t 97.34
PLN03159832 cation/H(+) antiporter 15; Provisional 97.32
PF01171182 ATP_bind_3: PP-loop family; InterPro: IPR011063 Th 97.08
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of 96.91
PRK12342 254 hypothetical protein; Provisional 96.21
PF01012164 ETF: Electron transfer flavoprotein domain; InterP 95.89
PRK03359256 putative electron transfer flavoprotein FixA; Revi 95.84
TIGR00591 454 phr2 photolyase PhrII. All proteins in this family 95.78
COG0041162 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) m 95.69
COG2086 260 FixA Electron transfer flavoprotein, beta subunit 95.59
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine n 95.52
COG0037 298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle 94.95
TIGR01162156 purE phosphoribosylaminoimidazole carboxylase, Pur 94.73
PRK10696258 tRNA 2-thiocytidine biosynthesis protein TtcA; Pro 94.09
PRK05253 301 sulfate adenylyltransferase subunit 2; Provisional 93.66
PF00731150 AIRC: AIR carboxylase; InterPro: IPR000031 Phospho 93.59
PF00875165 DNA_photolyase: DNA photolyase from Prosite.; Inte 93.46
PRK10660 436 tilS tRNA(Ile)-lysidine synthetase; Provisional 92.83
PRK07313182 phosphopantothenoylcysteine decarboxylase; Validat 92.71
PRK13820 394 argininosuccinate synthase; Provisional 92.55
PRK05579 399 bifunctional phosphopantothenoylcysteine decarboxy 92.35
PRK14665 360 mnmA tRNA-specific 2-thiouridylase MnmA; Provision 92.23
PF02601 319 Exonuc_VII_L: Exonuclease VII, large subunit; Inte 92.06
TIGR02765 429 crypto_DASH cryptochrome, DASH family. Photolyases 91.33
KOG1650769 consensus Predicted K+/H+-antiporter [Inorganic io 90.81
TIGR03556 471 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 90.27
PRK08305196 spoVFB dipicolinate synthase subunit B; Reviewed 90.1
PRK13982 475 bifunctional SbtC-like/phosphopantothenoylcysteine 89.97
cd0556599 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of en 89.88
TIGR02039 294 CysD sulfate adenylyltransferase, small subunit. I 89.84
TIGR02113177 coaC_strep phosphopantothenoylcysteine decarboxyla 89.63
TIGR0085395 pts-lac PTS system, lactose/cellobiose family IIB 89.49
PRK10867 433 signal recognition particle protein; Provisional 89.47
COG0299200 PurN Folate-dependent phosphoribosylglycinamide fo 88.81
cd01985181 ETF The electron transfer flavoprotein (ETF) serve 88.67
PRK00286 438 xseA exodeoxyribonuclease VII large subunit; Revie 88.23
cd0556496 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lic 87.97
PF03746242 LamB_YcsF: LamB/YcsF family; InterPro: IPR005501 T 87.92
TIGR02852187 spore_dpaB dipicolinic acid synthetase, B subunit. 87.79
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 87.77
KOG1467556 consensus Translation initiation factor 2B, delta 86.74
PF02441129 Flavoprotein: Flavoprotein; InterPro: IPR003382 Th 86.66
PRK14664 362 tRNA-specific 2-thiouridylase MnmA; Provisional 86.56
PLN02948577 phosphoribosylaminoimidazole carboxylase 86.54
TIGR00237 432 xseA exodeoxyribonuclease VII, large subunit. This 86.4
COG1597 301 LCB5 Sphingosine kinase and enzymes related to euk 86.35
PF1008797 DUF2325: Uncharacterized protein conserved in bact 85.26
PRK09590104 celB cellobiose phosphotransferase system IIB comp 85.2
TIGR00521 390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 84.29
), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF02844">PF02844100 GARS_N: Phosphoribosylglycinamide synthetase, N do 84.22
PF03652135 UPF0081: Uncharacterised protein family (UPF0081); 84.22
PRK00109138 Holliday junction resolvase-like protein; Reviewed 84.21
TIGR00959 428 ffh signal recognition particle protein. This mode 84.19
TIGR00268252 conserved hypothetical protein TIGR00268. The N-te 83.79
PF12683 275 DUF3798: Protein of unknown function (DUF3798); In 82.99
COG1927 277 Mtd Coenzyme F420-dependent N(5),N(10)-methenyltet 82.47
COG1184301 GCD2 Translation initiation factor 2B subunit, eIF 82.35
PF01261213 AP_endonuc_2: Xylose isomerase-like TIM barrel; In 82.34
PF04459204 DUF512: Protein of unknown function (DUF512); Inte 82.18
cd08550 349 GlyDH-like Glycerol_dehydrogenase-like. Families o 82.11
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 81.7
TIGR00655280 PurU formyltetrahydrofolate deformylase. This mode 81.66
PRK11914 306 diacylglycerol kinase; Reviewed 81.03
COG0452 392 Dfp Phosphopantothenoylcysteine synthetase/decarbo 80.86
TIGR02855283 spore_yabG sporulation peptidase YabG. Members of 80.76
PLN00200 404 argininosuccinate synthase; Provisional 80.68
PRK06027286 purU formyltetrahydrofolate deformylase; Reviewed 80.62
cd00532112 MGS-like MGS-like domain. This domain composes the 80.57
PRK12563 312 sulfate adenylyltransferase subunit 2; Provisional 80.51
TIGR02699174 archaeo_AfpA archaeoflavoprotein AfpA. The prototy 80.48
PF05582287 Peptidase_U57: YabG peptidase U57; InterPro: IPR00 80.36
>PRK15456 universal stress protein UspG; Provisional Back     alignment and domain information 
Probab=99.97  E-value=2.7e-29  Score=167.97  Aligned_cols=140  Identities=28%  Similarity=0.312  Sum_probs=110.7

Q ss_pred             CCcEEEEeecCCh--hHHHHHHHHHHhccccCCCCCeEEEEEEeCCCCcccCCCCCCCCCCCCCCCCCchHHHHHHHHHH
Q 040308            4 NLGCVIVAVDGGE--ESMDALRWAIDNLKLRSPAPGSFIVLHVQPPPTIAAGLNPGAIPFGGPSHVEVPAFTAAIEAHQG   81 (167)
Q Consensus         4 ~~~~ILv~id~s~--~s~~al~~a~~la~~~~~~~~~l~~l~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (167)
                      ||++||||+|+|+  .+.+++++|..+|+..    ++++++||+++...... .       .     .....+.+.+...
T Consensus         1 m~~~ILv~vD~S~~~~s~~al~~A~~la~~~----~~l~llhv~~~~~~~~~-~-------~-----~~~~~~~~~~~~~   63 (142)
T PRK15456          1 MYKTIIMPVDVFEMELSDKAVRHAEFLAQDD----GVIHLLHVLPGSASLSL-H-------R-----FAADVRRFEEHLQ   63 (142)
T ss_pred             CCccEEEeccCCchhHHHHHHHHHHHHHhcC----CeEEEEEEecCcccccc-c-------c-----cccchhhHHHHHH
Confidence            5899999999994  8999999999999865    48999999986532110 0       0     0011122334455


Q ss_pred             HHHHHHHHHHHHHhhhcCCcEEEEEEecChHhHHHHHHHHhCCCEEEEeecCCCccceecccchhHHHHhcCCCCEEEEc
Q 040308           82 RITQAIIDHALKICSEKNVNVKSEVVIGDAKEKVCELVEKLHADLLVMGSHTFGPIKRMFLGSVSNYCANHAQCPVVVVK  161 (167)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~v~~g~~~~~I~~~a~~~~~dliV~g~~~~~~~~~~~~gs~~~~i~~~~~~pVliv~  161 (167)
                      +..++.++.+.+.+...+.++++++..|++.+.|.+++++.++||||||+++++ +.++++||++++++++++||||+||
T Consensus        64 ~~~~~~l~~~~~~~~~~~~~v~~~v~~G~~~~~I~~~a~~~~~DLIVmG~~g~~-~~~~llGS~a~~v~~~a~~pVLvV~  142 (142)
T PRK15456         64 HEAEERLQTMVSHFTIDPSRIKQHVRFGSVRDEVNELAEELGADVVVIGSRNPS-ISTHLLGSNASSVIRHANLPVLVVR  142 (142)
T ss_pred             HHHHHHHHHHHHHhCCCCcceEEEEcCCChHHHHHHHHhhcCCCEEEEcCCCCC-ccceecCccHHHHHHcCCCCEEEeC
Confidence            556666666666655557888999999999999999999999999999999976 7788999999999999999999996

>PRK15005 universal stress protein F; Provisional Back     alignment and domain information
>PRK09982 universal stress protein UspD; Provisional Back     alignment and domain information
>cd01989 STK_N The N-terminal domain of Eukaryotic Serine Threonine kinases Back     alignment and domain information
>PRK15118 universal stress global response regulator UspA; Provisional Back     alignment and domain information
>PF00582 Usp: Universal stress protein family; InterPro: IPR006016 The universal stress protein UspA P28242 from SWISSPROT [] is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents Back     alignment and domain information
>PRK10116 universal stress protein UspC; Provisional Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea Back     alignment and domain information
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family Back     alignment and domain information
>PRK11175 universal stress protein UspE; Provisional Back     alignment and domain information
>cd00293 USP_Like Usp: Universal stress protein family Back     alignment and domain information
>COG0589 UspA Universal stress protein UspA and related nucleotide-binding proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK12652 putative monovalent cation/H+ antiporter subunit E; Reviewed Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain Back     alignment and domain information
>PLN03159 cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,] Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK12342 hypothetical protein; Provisional Back     alignment and domain information
>PF01012 ETF: Electron transfer flavoprotein domain; InterPro: IPR014730 Electron transfer flavoproteins (ETFs) serve as specific electron acceptors for primary dehydrogenases, transferring the electrons to terminal respiratory systems Back     alignment and domain information
>PRK03359 putative electron transfer flavoprotein FixA; Reviewed Back     alignment and domain information
>TIGR00591 phr2 photolyase PhrII Back     alignment and domain information
>COG0041 PurE Phosphoribosylcarboxyaminoimidazole (NCAIR) mutase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG2086 FixA Electron transfer flavoprotein, beta subunit [Energy production and conversion] Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01162 purE phosphoribosylaminoimidazole carboxylase, PurE protein Back     alignment and domain information
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PF00731 AIRC: AIR carboxylase; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>PF00875 DNA_photolyase: DNA photolyase from Prosite Back     alignment and domain information
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>PRK07313 phosphopantothenoylcysteine decarboxylase; Validated Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PRK14665 mnmA tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>PF02601 Exonuc_VII_L: Exonuclease VII, large subunit; InterPro: IPR020579 Exonuclease VII 3 Back     alignment and domain information
>TIGR02765 crypto_DASH cryptochrome, DASH family Back     alignment and domain information
>KOG1650 consensus Predicted K+/H+-antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03556 photolyase_8HDF deoxyribodipyrimidine photo-lyase, 8-HDF type Back     alignment and domain information
>PRK08305 spoVFB dipicolinate synthase subunit B; Reviewed Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>cd05565 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of enzyme II (EII) of the lactose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) found in Firmicutes as well as Actinobacteria Back     alignment and domain information
>TIGR02039 CysD sulfate adenylyltransferase, small subunit Back     alignment and domain information
>TIGR02113 coaC_strep phosphopantothenoylcysteine decarboxylase, streptococcal Back     alignment and domain information
>TIGR00853 pts-lac PTS system, lactose/cellobiose family IIB component Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>COG0299 PurN Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01985 ETF The electron transfer flavoprotein (ETF) serves as a specific electron acceptor for various mitochondrial dehydrogenases Back     alignment and domain information
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>cd05564 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) Back     alignment and domain information
>PF03746 LamB_YcsF: LamB/YcsF family; InterPro: IPR005501 This entry represents the uncharacterised protein family UPF0271, including LamB Back     alignment and domain information
>TIGR02852 spore_dpaB dipicolinic acid synthetase, B subunit Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG1467 consensus Translation initiation factor 2B, delta subunit (eIF-2Bdelta/GCD2) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02441 Flavoprotein: Flavoprotein; InterPro: IPR003382 This entry contains a diverse range of flavoprotein enzymes, including epidermin biosynthesis protein, EpiD, which has been shown to be a flavoprotein that binds FMN [] Back     alignment and domain information
>PRK14664 tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>TIGR00237 xseA exodeoxyribonuclease VII, large subunit Back     alignment and domain information
>COG1597 LCB5 Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only] Back     alignment and domain information
>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK09590 celB cellobiose phosphotransferase system IIB component; Reviewed Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>PF02844 GARS_N: Phosphoribosylglycinamide synthetase, N domain; InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PF03652 UPF0081: Uncharacterised protein family (UPF0081); InterPro: IPR005227 Holliday junction resolvases (HJRs) are key enzymes of DNA recombination Back     alignment and domain information
>PRK00109 Holliday junction resolvase-like protein; Reviewed Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>TIGR00268 conserved hypothetical protein TIGR00268 Back     alignment and domain information
>PF12683 DUF3798: Protein of unknown function (DUF3798); InterPro: IPR024258 This entry represents functionally uncharacterised proteins that are found in bacteria Back     alignment and domain information
>COG1927 Mtd Coenzyme F420-dependent N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG1184 GCD2 Translation initiation factor 2B subunit, eIF-2B alpha/beta/delta family [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01261 AP_endonuc_2: Xylose isomerase-like TIM barrel; InterPro: IPR012307 This TIM alpha/beta barrel structure is found in xylose isomerase (P19148 from SWISSPROT) and in endonuclease IV (P12638 from SWISSPROT, 3 Back     alignment and domain information
>PF04459 DUF512: Protein of unknown function (DUF512); InterPro: IPR007549 This is a domain of uncharacterised prokaryotic proteins Back     alignment and domain information
>cd08550 GlyDH-like Glycerol_dehydrogenase-like Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>PRK11914 diacylglycerol kinase; Reviewed Back     alignment and domain information
>COG0452 Dfp Phosphopantothenoylcysteine synthetase/decarboxylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02855 spore_yabG sporulation peptidase YabG Back     alignment and domain information
>PLN00200 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd00532 MGS-like MGS-like domain Back     alignment and domain information
>PRK12563 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>TIGR02699 archaeo_AfpA archaeoflavoprotein AfpA Back     alignment and domain information
>PF05582 Peptidase_U57: YabG peptidase U57; InterPro: IPR008764 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
2gm3_A175 Crystal Structure Of An Universal Stress Protein Fa 8e-11
3cis_A 309 The Crystal Structure Of Rv2623 From Mycobacterium 1e-04
1mjh_A162 Structure-Based Assignment Of The Biochemical Funct 2e-04
2jax_A 305 Universal Stress Protein Rv2623 From Mycobaterium T 5e-04
>pdb|2GM3|A Chain A, Crystal Structure Of An Universal Stress Protein Family Protein From Arabidopsis Thaliana At3g01520 With Amp Bound Length = 175 Back     alignment and structure 
Iteration: 1

 Score = 62.8 bits (151), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 70/141 (49%), Gaps = 8/141 (5%)
Query: 21  ALRWAIDNLKLRSPAPGSFIVLHVQPPPTIAAGLNPGAIPFGGPSHVEVPAFTAAIEAHQ 80
           A  W ++ +   + +    ++LHVQ       G +     +  P       F    ++++
Sbjct: 30  AFEWTLEKIVRSNTSDFKILLLHVQV--VDEDGFDDVDSIYASPED-----FRDXRQSNK 82
Query: 81  GRITQAIIDHALKICSEKNVNVKSEVVIGDAKEKVCELVEKLHADLLVMGSHTFGPIKRM 140
            +    +++  +  C E  V  ++ +  GD K+ +C+ V+++  D LV+GS   G  +++
Sbjct: 83  AKGLH-LLEFFVNKCHEIGVGCEAWIKTGDPKDVICQEVKRVRPDFLVVGSRGLGRFQKV 141
Query: 141 FLGSVSNYCANHAQCPVVVVK 161
           F+G+VS +C  HA+CPV  +K
Sbjct: 142 FVGTVSAFCVKHAECPVXTIK 162
>pdb|3CIS|A Chain A, The Crystal Structure Of Rv2623 From Mycobacterium Tuberculosis Length = 309 Back     alignment and structure
>pdb|1MJH|A Chain A, Structure-Based Assignment Of The Biochemical Function Of Hypothetical Protein Mj0577: A Test Case Of Structural Genomics Length = 162 Back     alignment and structure
>pdb|2JAX|A Chain A, Universal Stress Protein Rv2623 From Mycobaterium Tuberculosis Length = 305 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 8e-45
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 1e-36
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 2e-33
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 2e-28
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 3e-28
2z08_A137 Universal stress protein family; uncharacterized c 7e-27
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 4e-26
3s3t_A146 Nucleotide-binding protein, universal stress PROT 2e-25
3fdx_A143 Putative filament protein / universal stress PROT; 8e-25
3tnj_A150 Universal stress protein (USP); structural genomic 7e-24
3loq_A 294 Universal stress protein; structural genomics, PSI 1e-22
3loq_A294 Universal stress protein; structural genomics, PSI 6e-21
3ab8_A 268 Putative uncharacterized protein TTHA0350; tandem- 9e-22
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 2e-15
3dlo_A155 Universal stress protein; unknown function, struct 1e-21
3fg9_A156 Protein of universal stress protein USPA family; A 3e-21
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 4e-21
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 2e-17
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 4e-20
3olq_A319 Universal stress protein E; structural genomics, P 1e-17
3olq_A 319 Universal stress protein E; structural genomics, P 1e-16
3mt0_A290 Uncharacterized protein PA1789; structural genomic 1e-13
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 7e-10
1q77_A138 Hypothetical protein AQ_178; structural genomics, 1e-09
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Length = 175 Back     alignment and structure
 Score =  144 bits (365), Expect = 8e-45
 Identities = 37/165 (22%), Positives = 70/165 (42%), Gaps = 17/165 (10%)

Query: 8   VIVAVDGGE---------ESMDALRWAIDNLKLRSPAPGSFIVLHVQPPPTIAAGLNPGA 58
           V+VAV+                A  W ++ +   + +    ++LHVQ             
Sbjct: 8   VMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVVDEDGFD----- 62

Query: 59  IPFGGPSHVEVPAFTAAIEAHQGRITQAIIDHALKICSEKNVNVKSEVVIGDAKEKVCEL 118
                 S    P     +          +++  +  C E  V  ++ +  GD K+ +C+ 
Sbjct: 63  ---DVDSIYASPEDFRDMRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVICQE 119

Query: 119 VEKLHADLLVMGSHTFGPIKRMFLGSVSNYCANHAQCPVVVVKGK 163
           V+++  D LV+GS   G  +++F+G+VS +C  HA+CPV+ +K  
Sbjct: 120 VKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIKRN 164
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Length = 138 Back     alignment and structure
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Length = 162 Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Length = 163 Back     alignment and structure
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Length = 170 Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Length = 137 Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} Length = 147 Back     alignment and structure
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} Length = 146 Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Length = 143 Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Length = 150 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Length = 294 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Length = 268 Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Length = 155 Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Length = 156 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Length = 309 Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Length = 141 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Length = 319 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Length = 290 Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Length = 138 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
1mjh_A162 Protein (ATP-binding domain of protein MJ0577); hy 99.98
2dum_A170 Hypothetical protein PH0823; conserved hypothetica 99.98
3s3t_A146 Nucleotide-binding protein, universal stress PROT 99.98
3fg9_A156 Protein of universal stress protein USPA family; A 99.97
3hgm_A147 Universal stress protein TEAD; rossman fold, signa 99.97
3idf_A138 USP-like protein; universal, stress, PSI, MCSG, st 99.97
3tnj_A150 Universal stress protein (USP); structural genomic 99.97
1tq8_A163 Hypothetical protein RV1636; MTCY01B2.28, structur 99.97
3dlo_A155 Universal stress protein; unknown function, struct 99.96
2z08_A137 Universal stress protein family; uncharacterized c 99.96
2gm3_A175 Unknown protein; AT3G01520, putative ethylene-resp 99.96
3olq_A 319 Universal stress protein E; structural genomics, P 99.95
3fdx_A143 Putative filament protein / universal stress PROT; 99.95
3loq_A 294 Universal stress protein; structural genomics, PSI 99.95
1jmv_A141 USPA, universal stress protein A; chaperone; 1.85A 99.95
3mt0_A 290 Uncharacterized protein PA1789; structural genomic 99.93
3cis_A 309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.93
3ab8_A 268 Putative uncharacterized protein TTHA0350; tandem- 99.92
1q77_A138 Hypothetical protein AQ_178; structural genomics, 99.92
3mt0_A290 Uncharacterized protein PA1789; structural genomic 99.92
3loq_A294 Universal stress protein; structural genomics, PSI 99.91
3olq_A319 Universal stress protein E; structural genomics, P 99.9
3cis_A309 Uncharacterized protein; alpha/beta hydrolase, ATP 99.9
3ab8_A268 Putative uncharacterized protein TTHA0350; tandem- 99.86
2iel_A138 Hypothetical protein TT0030; TT0030,thermus thermo 97.6
3g40_A294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 96.22
1wy5_A 317 TILS, hypothetical UPF0072 protein AQ_1887; N-type 95.89
4b4k_A181 N5-carboxyaminoimidazole ribonucleotide mutase; is 95.88
3a2k_A 464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, 95.68
2xry_A 482 Deoxyribodipyrimidine photolyase; DNA damage, DNA 95.66
4grd_A173 N5-CAIR mutase, phosphoribosylaminoimidazole carbo 95.29
3trh_A169 Phosphoribosylaminoimidazole carboxylase carboxylt 95.1
2ywx_A157 Phosphoribosylaminoimidazole carboxylase catalyti; 95.08
3kuu_A174 Phosphoribosylaminoimidazole carboxylase catalyti 95.0
2wq7_A 543 RE11660P; lyase-DNA complex, DNA repair, DNA lesio 94.91
1np7_A 489 DNA photolyase; protein with FAD cofactor; HET: DN 94.9
1xmp_A170 PURE, phosphoribosylaminoimidazole carboxylase; pu 94.84
3oow_A166 Phosphoribosylaminoimidazole carboxylase,catalyic; 94.75
3umv_A 506 Deoxyribodipyrimidine photo-lyase; CPD cyclobutane 94.75
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 94.47
3ors_A163 N5-carboxyaminoimidazole ribonucleotide mutase; is 94.41
3lp6_A174 Phosphoribosylaminoimidazole carboxylase catalyti; 94.34
1u11_A182 PURE (N5-carboxyaminoimidazole ribonucleotide MUT; 94.31
1o4v_A183 Phosphoribosylaminoimidazole mutase PURE; structur 93.96
3ih5_A217 Electron transfer flavoprotein alpha-subunit; alph 93.82
1zun_A 325 Sulfate adenylyltransferase subunit 2; beta barrel 93.54
1o97_C 264 Electron transferring flavoprotein beta-subunit; F 92.51
3tvs_A 538 Cryptochrome-1; circadian clock light entrainment, 91.55
3g40_A 294 Na-K-CL cotransporter; alpha/beta fold 10-stranded 91.44
3kcq_A215 Phosphoribosylglycinamide formyltransferase; struc 91.0
1ni5_A 433 Putative cell cycle protein MESJ; structural genom 90.46
1iv0_A98 Hypothetical protein; rnaseh-like, YQGF, structura 90.12
3qjg_A175 Epidermin biosynthesis protein EPID; structural ge 90.02
1efp_B252 ETF, protein (electron transfer flavoprotein); ele 89.93
1efv_B255 Electron transfer flavoprotein; electron transport 88.65
3tqr_A215 Phosphoribosylglycinamide formyltransferase; purin 88.62
3fy4_A 537 6-4 photolyase; DNA repair, clock cryptochrome; HE 88.05
1owl_A 484 Photolyase, deoxyribodipyrimidine photolyase; DNA 88.04
3p9x_A211 Phosphoribosylglycinamide formyltransferase; struc 86.92
2j07_A 420 Deoxyribodipyrimidine photo-lyase; flavoprotein, n 86.28
2h31_A425 Multifunctional protein ADE2; alpha-beta-alpha, li 86.23
2e0i_A 440 432AA long hypothetical deoxyribodipyrimidine PHO; 86.06
3k32_A203 Uncharacterized protein MJ0690; predicted subunit 85.91
2r8w_A 332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 84.93
1sur_A215 PAPS reductase; assimilatory sulfate reduction, 3- 84.49
1dnp_A 471 DNA photolyase; DNA repair, electron transfer, exc 83.42
3da8_A215 Probable 5'-phosphoribosylglycinamide formyltransf 83.16
3fni_A159 Putative diflavin flavoprotein A 3; alpha-beta pro 82.71
3nbm_A108 PTS system, lactose-specific IIBC components; PTS_ 82.63
3hly_A161 Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein 81.99
2nz2_A 413 Argininosuccinate synthase; amino-acid biosynthesi 81.88
1k92_A 455 Argininosuccinate synthase, argininosuccinate SY; 81.4
>1mjh_A Protein (ATP-binding domain of protein MJ0577); hypothetical protein, structural genomics, functional assignment; HET: ATP; 1.70A {Methanocaldococcus jannaschii} SCOP: c.26.2.4 Back     alignment and structure
Probab=99.98  E-value=6.2e-31  Score=178.19  Aligned_cols=157  Identities=25%  Similarity=0.325  Sum_probs=122.7

Q ss_pred             CCCCCcEEEEeecCChhHHHHHHHHHHhccccCCCCCeEEEEEEeCCCCc---c-cCCCCCCCCCCCCCCCCCchHHHHH
Q 040308            1 MSGNLGCVIVAVDGGEESMDALRWAIDNLKLRSPAPGSFIVLHVQPPPTI---A-AGLNPGAIPFGGPSHVEVPAFTAAI   76 (167)
Q Consensus         1 ~~~~~~~ILv~id~s~~s~~al~~a~~la~~~~~~~~~l~~l~v~~~~~~---~-~~~~~~~~~~~~~~~~~~~~~~~~~   76 (167)
                      |.+||++||||+|+++.+..++++|+.+|+..   +++++++||+++...   . ..+....  .+...  .........
T Consensus         1 M~~~~~~ILv~vD~s~~s~~al~~a~~la~~~---~a~l~ll~v~~~~~~~~~~~~~~~~~~--~~~~~--~~~~~~~~~   73 (162)
T 1mjh_A            1 MSVMYKKILYPTDFSETAEIALKHVKAFKTLK---AEEVILLHVIDEREIKKRDIFSLLLGV--AGLNK--SVEEFENEL   73 (162)
T ss_dssp             --CCCCEEEEECCSCHHHHHHHHHHHHTCCSS---CCEEEEEEEEEGGGTC---------------------CHHHHHHH
T ss_pred             CccccceEEEEeCCCHHHHHHHHHHHHHHhhc---CCeEEEEEEecCccccccccccccccc--ccccc--chhhhHHHH
Confidence            66689999999999999999999999999999   899999999985410   0 0000000  00000  000012234


Q ss_pred             HHHHHHHHHHHHHHHHHHhhhcCCcEEEEEEecChHhHHHHHHHHhCCCEEEEeecCCCccceecccchhHHHHhcCCCC
Q 040308           77 EAHQGRITQAIIDHALKICSEKNVNVKSEVVIGDAKEKVCELVEKLHADLLVMGSHTFGPIKRMFLGSVSNYCANHAQCP  156 (167)
Q Consensus        77 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~g~~~~~I~~~a~~~~~dliV~g~~~~~~~~~~~~gs~~~~i~~~~~~p  156 (167)
                      .+...+..++.++.+.+.+...|+++++.+..|++.+.|++++++.++||||||+++++.+.++++||++++|+++++||
T Consensus        74 ~~~~~~~~~~~l~~~~~~~~~~g~~~~~~v~~G~~~~~I~~~a~~~~~dlIV~G~~g~~~~~~~~~GSv~~~vl~~~~~p  153 (162)
T 1mjh_A           74 KNKLTEEAKNKMENIKKELEDVGFKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLGSVTENVIKKSNKP  153 (162)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTTCEEEEEEEEECHHHHHHHHHHHTTCSEEEEESCCSSCCTTCSSCHHHHHHHHHCCSC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHcCCceEEEEcCCCHHHHHHHHHHHcCCCEEEEcCCCCCCccceEecchHHHHHHhCCCC
Confidence            45556677788888888888889999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEcCCC
Q 040308          157 VVVVKGKG  164 (167)
Q Consensus       157 Vliv~~~~  164 (167)
                      ||+||+..
T Consensus       154 Vlvv~~~~  161 (162)
T 1mjh_A          154 VLVVKRKN  161 (162)
T ss_dssp             EEEECCCC
T ss_pred             EEEEeCCC
Confidence            99999764
>2dum_A Hypothetical protein PH0823; conserved hypothetical protein, putative universal protein A structural genomics, NPPSFA; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3s3t_A Nucleotide-binding protein, universal stress PROT family; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ATP; 1.90A {Lactobacillus plantarum} SCOP: c.26.2.0 Back     alignment and structure
>3fg9_A Protein of universal stress protein USPA family; APC60691, nucleotide- binding, lactobacillus plantarum WCFS1, structural genomics PSI-2; 1.47A {Lactobacillus plantarum} Back     alignment and structure
>3hgm_A Universal stress protein TEAD; rossman fold, signaling protein; HET: ATP; 1.90A {Halomonas elongata} SCOP: c.26.2.0 Back     alignment and structure
>3idf_A USP-like protein; universal, stress, PSI, MCSG, structural genomics, midwest center for structural genomics structure initiative; 2.00A {Wolinella succinogenes} Back     alignment and structure
>3tnj_A Universal stress protein (USP); structural genomics, PSI-biology, midwest center for structu genomics, MCSG, chaperone; HET: AMP; 2.00A {Nitrosomonas europaea} PDB: 2pfs_A* Back     alignment and structure
>1tq8_A Hypothetical protein RV1636; MTCY01B2.28, structural target, NYSGXRC, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} SCOP: c.26.2.4 Back     alignment and structure
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics; HET: MSE; 1.97A {Archaeoglobus fulgidus} PDB: 3qtb_A* Back     alignment and structure
>2z08_A Universal stress protein family; uncharacterized conserved protein, structural genomics, unknown function, NPPSFA; HET: ATP; 1.55A {Thermus thermophilus} SCOP: c.26.2.4 PDB: 1wjg_A* 2z09_A* 2z3v_A Back     alignment and structure
>2gm3_A Unknown protein; AT3G01520, putative ethylene-responsive protein, USP domain, nucleotide binding domain, AMP; HET: MSE AMP; 2.46A {Arabidopsis thaliana} SCOP: c.26.2.4 Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3fdx_A Putative filament protein / universal stress PROT; structural genomics, APC60640.1, universal protein F, PSI-2; HET: MSE ATP; 1.58A {Klebsiella pneumoniae subsp} PDB: 3fh0_A* Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>1jmv_A USPA, universal stress protein A; chaperone; 1.85A {Haemophilus influenzae} SCOP: c.26.2.4 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4 Back     alignment and structure
>3mt0_A Uncharacterized protein PA1789; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 1.58A {Pseudomonas aeruginosa} Back     alignment and structure
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus} Back     alignment and structure
>3olq_A Universal stress protein E; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: UNL; 1.82A {Proteus mirabilis} Back     alignment and structure
>3cis_A Uncharacterized protein; alpha/beta hydrolase, ATP, universal stress protein, unknown function; HET: ATP; 2.90A {Mycobacterium tuberculosis} PDB: 2jax_A* Back     alignment and structure
>3ab8_A Putative uncharacterized protein TTHA0350; tandem-type universal stress protein, unknown function; HET: ATP; 1.70A {Thermus thermophilus} PDB: 3ab7_A* Back     alignment and structure
>2iel_A Hypothetical protein TT0030; TT0030,thermus thermophilus, structural genomics, PSI, protein structure initiative; 1.60A {Thermus thermophilus} SCOP: c.26.2.4 Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
>4b4k_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase; 2.50A {Bacillus anthracis} Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>2xry_A Deoxyribodipyrimidine photolyase; DNA damage, DNA repair; HET: FAD; 1.50A {Methanosarcina mazei} PDB: 2xrz_A* Back     alignment and structure
>4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} Back     alignment and structure
>2ywx_A Phosphoribosylaminoimidazole carboxylase catalyti; rossmann fold, structural genomics, NPPSFA; 2.31A {Methanocaldococcus jannaschii} Back     alignment and structure
>3kuu_A Phosphoribosylaminoimidazole carboxylase catalyti PURE; 3-layer (ABA) sandwich, rossmann fold, csgid, lyase, structu genomics; 1.41A {Yersinia pestis} SCOP: c.23.8.1 PDB: 1d7a_A* 1qcz_A 2ate_A* 2nsl_A* 2nsh_A* 2nsj_A* Back     alignment and structure
>2wq7_A RE11660P; lyase-DNA complex, DNA repair, DNA lesion, lyase; HET: TDY Z FAD; 2.00A {Drosophila melanogaster} PDB: 2wb2_A* 2wq6_A* 3cvu_A* 3cvv_A* 3cvy_A* 3cvw_A* 3cvx_A* Back     alignment and structure
>1np7_A DNA photolyase; protein with FAD cofactor; HET: DNA FAD; 1.90A {Synechocystis SP} SCOP: a.99.1.1 c.28.1.1 Back     alignment and structure
>1xmp_A PURE, phosphoribosylaminoimidazole carboxylase; purine biosynthesis, spine, lyase; 1.80A {Bacillus anthracis} SCOP: c.23.8.1 Back     alignment and structure
>3oow_A Phosphoribosylaminoimidazole carboxylase,catalyic; structural genomics, center for structural genomics of infec diseases, csgid; HET: MSE; 1.75A {Francisella tularensis subsp} SCOP: c.23.8.1 PDB: 3opq_A* Back     alignment and structure
>3umv_A Deoxyribodipyrimidine photo-lyase; CPD cyclobutane pyrimidine dimers, UV damaged DNA, DNA repai flavoprotein; HET: FAD; 1.71A {Oryza sativa japonica group} Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A* Back     alignment and structure
>3ors_A N5-carboxyaminoimidazole ribonucleotide mutase; isomerase, isomerase,biosynthetic protein; 1.45A {Staphylococcus aureus subsp} Back     alignment and structure
>3lp6_A Phosphoribosylaminoimidazole carboxylase catalyti; alpha and beta protein, structural genomics, PSI-2, protein initiative; 1.70A {Mycobacterium tuberculosis} SCOP: c.23.8.0 Back     alignment and structure
>1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A Back     alignment and structure
>1o4v_A Phosphoribosylaminoimidazole mutase PURE; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 1.77A {Thermotoga maritima} SCOP: c.23.8.1 Back     alignment and structure
>3ih5_A Electron transfer flavoprotein alpha-subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2, protein structure initiative; 2.60A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Back     alignment and structure
>1o97_C Electron transferring flavoprotein beta-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 PDB: 1o95_C* 1o96_A* 1o94_C* 3clr_C* 3cls_C* 3clt_C* 3clu_C* Back     alignment and structure
>3g40_A Na-K-CL cotransporter; alpha/beta fold 10-stranded twisted beta sheet, transport protein; 1.90A {Methanosarcina acetivorans} Back     alignment and structure
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural center for infectious disease, ssgcid; 2.20A {Anaplasma phagocytophilum} SCOP: c.65.1.0 Back     alignment and structure
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Back     alignment and structure
>1iv0_A Hypothetical protein; rnaseh-like, YQGF, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Thermus thermophilus} SCOP: c.55.3.8 Back     alignment and structure
>3qjg_A Epidermin biosynthesis protein EPID; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: FMN; 2.04A {Staphylococcus aureus} SCOP: c.34.1.0 Back     alignment and structure
>1efp_B ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 Back     alignment and structure
>1efv_B Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 PDB: 1t9g_S* 2a1u_B* 2a1t_S* Back     alignment and structure
>3tqr_A Phosphoribosylglycinamide formyltransferase; purines, pyrimidines, nucleosides, nucleotides; HET: NHE; 1.97A {Coxiella burnetii} SCOP: c.65.1.0 Back     alignment and structure
>3fy4_A 6-4 photolyase; DNA repair, clock cryptochrome; HET: MES FAD; 2.70A {Arabidopsis thaliana} Back     alignment and structure
>1owl_A Photolyase, deoxyribodipyrimidine photolyase; DNA repair, flavin enzyme, photoreactivating enzyme; HET: FAD; 1.80A {Synechococcus elongatus} SCOP: a.99.1.1 c.28.1.1 PDB: 1owm_A* 1own_A* 1owo_A* 1owp_A* 1qnf_A* 1tez_A* Back     alignment and structure
>3p9x_A Phosphoribosylglycinamide formyltransferase; structural genomics, PSI-biology, protein STRU initiative; 1.90A {Bacillus halodurans} Back     alignment and structure
>2j07_A Deoxyribodipyrimidine photo-lyase; flavoprotein, nucleotide-binding, DNA repair; HET: FAD HDF; 1.95A {Thermus thermophilus} SCOP: a.99.1.1 c.28.1.1 PDB: 1iqu_A* 1iqr_A* 2j08_A* 2j09_A* Back     alignment and structure
>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Back     alignment and structure
>2e0i_A 432AA long hypothetical deoxyribodipyrimidine PHO; photolyase, FAD, DNA repair, lyase; HET: FAD; 2.80A {Sulfolobus tokodaii} Back     alignment and structure
>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii} Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 Back     alignment and structure
>1dnp_A DNA photolyase; DNA repair, electron transfer, excitation energy transfer, carbon-carbon, lyase (carbon-carbon); HET: DNA FAD MHF; 2.30A {Escherichia coli} SCOP: a.99.1.1 c.28.1.1 Back     alignment and structure
>3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* Back     alignment and structure
>3fni_A Putative diflavin flavoprotein A 3; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; 2.30A {Nostoc SP} PDB: 2klb_A Back     alignment and structure
>3nbm_A PTS system, lactose-specific IIBC components; PTS_IIB_LACTOSE, phosphoenolpyruvate:carbohydrate system, P- phosphorylation; HET: MSE; 1.30A {Streptococcus pneumoniae} Back     alignment and structure
>3hly_A Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein, DFA1, SNR135D, NESG, structural genomics, PSI-2; 2.40A {Synechococcus elongatus pcc 6301} Back     alignment and structure
>2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, ST genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens} Back     alignment and structure
>1k92_A Argininosuccinate synthase, argininosuccinate SY; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 167
d2gm3a1171 c.26.2.4 (A:5-175) Putative ethylene-responsive pr 5e-29
d1mjha_160 c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archa 5e-26
d1tq8a_147 c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobac 3e-20
d2z3va1135 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 { 5e-19
d1jmva_140 c.26.2.4 (A:) Universal stress protein A, UspA {Ha 6e-15
d1q77a_138 c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex 8e-11
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 171 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: Putative ethylene-responsive protein AT3g01520/F4P13 7
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score =  103 bits (256), Expect = 5e-29
 Identities = 37/169 (21%), Positives = 71/169 (42%), Gaps = 17/169 (10%)

Query: 8   VIVAVDGGE---------ESMDALRWAIDNLKLRSPAPGSFIVLHVQPPPTIAAGLNPGA 58
           V+VAV+                A  W ++ +   + +    ++LHVQ             
Sbjct: 4   VMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVVDEDGFD----- 58

Query: 59  IPFGGPSHVEVPAFTAAIEAHQGRITQAIIDHALKICSEKNVNVKSEVVIGDAKEKVCEL 118
                 S    P     +          +++  +  C E  V  ++ +  GD K+ +C+ 
Sbjct: 59  ---DVDSIYASPEDFRDMRQSNKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVICQE 115

Query: 119 VEKLHADLLVMGSHTFGPIKRMFLGSVSNYCANHAQCPVVVVKGKGTSS 167
           V+++  D LV+GS   G  +++F+G+VS +C  HA+CPV+ +K     +
Sbjct: 116 VKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMTIKRNADET 164
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 160 Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 147 Back     information, alignment and structure
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Length = 135 Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Length = 140 Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Length = 138 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
d1mjha_160 "Hypothetical" protein MJ0577 {Archaeon Methanococ 100.0
d2z3va1135 Hypothetical protein TTHA0895 {Thermus thermophilu 99.96
d1tq8a_147 Hypothetical protein Rv1636 {Mycobacterium tubercu 99.96
d2gm3a1171 Putative ethylene-responsive protein AT3g01520/F4P 99.96
d1jmva_140 Universal stress protein A, UspA {Haemophilus infl 99.95
d1q77a_138 Hypothetical protein Aq_178 {Aquifex aeolicus [Tax 99.93
d1wy5a1216 TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId 96.42
d3clsc1 262 Small, beta subunit of electron transfer flavoprot 95.99
d1u11a_159 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 95.78
d1xmpa_155 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 95.69
d1efpb_246 Small, beta subunit of electron transfer flavoprot 95.67
d1qcza_163 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 95.57
d1np7a2204 Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 95.55
d1o4va_169 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 95.28
d2j07a2170 DNA photolyase {Thermus thermophilus [TaxId: 274]} 94.77
d1efvb_252 Small, beta subunit of electron transfer flavoprot 94.15
d1ni5a1227 tRNA-Ile-lysidine synthetase, TilS, N-terminal dom 93.98
d1owla2202 DNA photolyase {Synechococcus elongatus [TaxId: 32 93.64
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 91.23
d1p3y1_183 MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} 90.15
d1vbka1132 Hypothetical protein PH1313, C-terminal domain {Ar 89.44
d1g5qa_174 Epidermin modifying enzyme (peptidyl-cysteine deca 89.02
d1ycga1149 Nitric oxide reductase C-terminal domain {Moorella 88.58
d1u3da2185 Cryptochrome {Thale cress (Arabidopsis thaliana) [ 88.04
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 86.64
d1e5da1152 Rubredoxin oxygen:oxidoreductase (ROO), C-terminal 86.28
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 85.67
d1s8na_ 190 Probable two-component system transcriptional regu 85.55
d2bona1 295 Lipid kinase YegS {Escherichia coli [TaxId: 562]} 85.18
d1uf3a_ 228 Hypothetical protein TT1561 {Thermus thermophilus 84.18
d3clsd1192 Large, alpha subunit of electron transfer flavopro 83.89
d1nu0a_138 Hypothetical protein YqgF (RuvX) {Escherichia coli 83.64
d2pjua1 186 Propionate catabolism operon regulatory protein Pr 82.98
d1v6ta_254 Hypothetical protein PH0986 {Pyrococcus horikoshii 82.93
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 82.34
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 82.1
d3bzka5149 Transcriptional accessory factor Tex {Pseudomonas 81.99
d1iv0a_98 Hypothetical protein, YqgF homologue {Thermus ther 81.09
>d1mjha_ c.26.2.4 (A:) "Hypothetical" protein MJ0577 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: Universal stress protein-like
domain: "Hypothetical" protein MJ0577
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

Probab=100.00  E-value=1e-34  Score=195.09  Aligned_cols=159  Identities=22%  Similarity=0.250  Sum_probs=128.7

Q ss_pred             CCCcEEEEeecCChhHHHHHHHHHHhccccCCCCCeEEEEEEeCCCCcccCCCCCCCCCCCCCCCCCchHHHHHHHHHHH
Q 040308            3 GNLGCVIVAVDGGEESMDALRWAIDNLKLRSPAPGSFIVLHVQPPPTIAAGLNPGAIPFGGPSHVEVPAFTAAIEAHQGR   82 (167)
Q Consensus         3 ~~~~~ILv~id~s~~s~~al~~a~~la~~~~~~~~~l~~l~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (167)
                      +||+|||||+|+|+.+.++++||+.+|+.+   +++|+++||+++.......................+......+...+
T Consensus         1 ~m~~~ILvavD~s~~s~~al~~a~~la~~~---~a~l~llhV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   77 (160)
T d1mjha_           1 VMYKKILYPTDFSETAEIALKHVKAFKTLK---AEEVILLHVIDEREIKKRDIFSLLLGVAGLNKSVEEFENELKNKLTE   77 (160)
T ss_dssp             CCCCEEEEECCSCHHHHHHHHHHHHTCCSS---CCEEEEEEEEEGGGTC-----------------CHHHHHHHHHHHHH
T ss_pred             CCcCeEEEEECCCHHHHHHHHHHHHHHHhc---CCEEEEEEecccccccccccccccccccccchhHHHHHHHHHHHHHH
Confidence            589999999999999999999999999999   99999999987765432221111111111111123444455566677


Q ss_pred             HHHHHHHHHHHHhhhcCCcEEEEEEecChHhHHHHHHHHhCCCEEEEeecCCCccceecccchhHHHHhcCCCCEEEEcC
Q 040308           83 ITQAIIDHALKICSEKNVNVKSEVVIGDAKEKVCELVEKLHADLLVMGSHTFGPIKRMFLGSVSNYCANHAQCPVVVVKG  162 (167)
Q Consensus        83 ~~~~~~~~~~~~~~~~~~~~~~~v~~g~~~~~I~~~a~~~~~dliV~g~~~~~~~~~~~~gs~~~~i~~~~~~pVliv~~  162 (167)
                      .+++.++.+.+.+...|+++++++..|++.+.|.+++++.++||||||+++++.+.++|+||++++|+++++||||+||+
T Consensus        78 ~~~~~l~~~~~~~~~~gv~~~~~~~~G~~~~~I~~~a~~~~~dliV~G~~~~~~~~~~~~GS~a~~vl~~s~~pVlvV~~  157 (160)
T d1mjha_          78 EAKNKMENIKKELEDVGFKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLGSVTENVIKKSNKPVLVVKR  157 (160)
T ss_dssp             HHHHHHHHHHHHHHHTTCEEEEEEEEECHHHHHHHHHHHTTCSEEEEESCCSSCCTTCSSCHHHHHHHHHCCSCEEEECC
T ss_pred             HHHHHHHHHHHHHHhcCCeEEEEEEeccHHHHHhhhhhccccceEEeccCCCCcccccccCcHHHHHHhcCCCCEEEEcC
Confidence            88889999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             CC
Q 040308          163 KG  164 (167)
Q Consensus       163 ~~  164 (167)
                      +.
T Consensus       158 ~~  159 (160)
T d1mjha_         158 KN  159 (160)
T ss_dssp             CC
T ss_pred             CC
Confidence            75
>d2z3va1 c.26.2.4 (A:2-136) Hypothetical protein TTHA0895 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tq8a_ c.26.2.4 (A:) Hypothetical protein Rv1636 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gm3a1 c.26.2.4 (A:5-175) Putative ethylene-responsive protein AT3g01520/F4P13_7 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jmva_ c.26.2.4 (A:) Universal stress protein A, UspA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q77a_ c.26.2.4 (A:) Hypothetical protein Aq_178 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d3clsc1 c.26.2.3 (C:1-262) Small, beta subunit of electron transfer flavoprotein ETFP {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1efpb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qcza_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np7a2 c.28.1.1 (A:1-204) Cryptochrome {Synechocystis sp., pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2j07a2 c.28.1.1 (A:2-171) DNA photolyase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1efvb_ c.26.2.3 (B:) Small, beta subunit of electron transfer flavoprotein ETFP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1owla2 c.28.1.1 (A:3-204) DNA photolyase {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1p3y1_ c.34.1.1 (1:) MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} Back     information, alignment and structure
>d1vbka1 c.26.2.6 (A:176-307) Hypothetical protein PH1313, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g5qa_ c.34.1.1 (A:) Epidermin modifying enzyme (peptidyl-cysteine decarboxylase) EpiD {Staphylococcus epidermidis [TaxId: 1282]} Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1u3da2 c.28.1.1 (A:13-197) Cryptochrome {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bona1 e.52.1.2 (A:5-299) Lipid kinase YegS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3clsd1 c.26.2.3 (D:1-192) Large, alpha subunit of electron transfer flavoprotein ETFP, N-terminal domain {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1nu0a_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v6ta_ c.6.2.5 (A:) Hypothetical protein PH0986 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d3bzka5 c.55.3.13 (A:325-473) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1iv0a_ c.55.3.8 (A:) Hypothetical protein, YqgF homologue {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure