Citrus Sinensis ID: 040309

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
GILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAIENQSQDKESMETQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSHYKITPILGVRSLIEAYP
ccccccccHHHHHHHHHHHHHccccccccEEEEEEEEccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccEEEEcccccEEEEEEc
ccEcccccHHHHHHHHHHHHHccccccccEEEEEEEEEcccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccEEEEEccccEEEEEcc
gilhnwndEESVKLLKKCKEaipskdeggkVIIIDMAIENQSQDKESMETQLCFDILMVSLfrgkersvdDWKKLFLAAGfshykitpilGVRSLIEAYP
gilhnwndeeSVKLLKKCKEaipskdeggkvIIIDMAIENQSQDKESMETQLCFDILMVSLFRGKERSVDDWKKLFLaagfshykitpilgvRSLIEAYP
GILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAIENQSQDKESMETQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSHYKITPILGVRSLIEAYP
****************************GKVIIIDMAI***********TQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSHYKITPILGVRSLIE***
GILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAIENQSQDKESMETQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSHYKITPILGVRSLIEAYP
GILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAIENQSQDKESMETQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSHYKITPILGVRSLIEAYP
GILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAIENQSQDKESMETQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSHYKITPILGVRSLIEAYP
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAIENQSQDKESMETQLCFDILMVSLFRGKERSVDDWKKLFLAAGFSHYKITPILGVRSLIEAYP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query100 2.2.26 [Sep-21-2011]
B6VJS4357 Trans-resveratrol di-O-me no no 0.99 0.277 0.636 7e-32
Q29U70364 Isoflavone 4'-O-methyltra N/A no 0.99 0.271 0.555 2e-26
O24305360 6a-hydroxymaackiain methy N/A no 0.99 0.275 0.555 3e-26
A8QW53374 5-pentadecatrienyl resorc N/A no 0.98 0.262 0.525 6e-26
Q6VMW0366 8-hydroxyquercetin 8-O-me N/A no 0.99 0.270 0.52 6e-25
C6TAY1358 Flavonoid 4'-O-methyltran no no 0.99 0.276 0.474 4e-23
O24529352 Isoflavone-7-O-methyltran N/A no 0.98 0.278 0.494 6e-23
O22308352 Isoflavone-7-O-methyltran N/A no 0.98 0.278 0.494 6e-23
O22309352 Isoflavone-7-O-methyltran N/A no 0.98 0.278 0.494 9e-23
Q84KK5357 Isoflavone 7-O-methyltran N/A no 0.98 0.274 0.525 2e-22
>sp|B6VJS4|ROMT_VITVI Trans-resveratrol di-O-methyltransferase OS=Vitis vinifera GN=ROMT PE=1 SV=2 Back     alignment and function desciption
 Score =  135 bits (340), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 63/99 (63%), Positives = 79/99 (79%)

Query: 2   ILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAIENQSQDKESMETQLCFDILMVSL 61
           ILH+W++EE VK+LK+C+EAIPSK+ GGKVIIIDM +     D +S ETQL FD+ M+  
Sbjct: 259 ILHDWSNEECVKILKRCREAIPSKENGGKVIIIDMIMMKNQGDYKSTETQLFFDMTMMIF 318

Query: 62  FRGKERSVDDWKKLFLAAGFSHYKITPILGVRSLIEAYP 100
             G+ER  ++W+KLFL AGFSHYKITPILG+RSLIE YP
Sbjct: 319 APGRERDENEWEKLFLDAGFSHYKITPILGLRSLIEVYP 357
Catalyzes the biosynthesis of pterostilbene from resveratrol. Pterostilbene has both antifungal and pharmacological properties. Also has activity toward resveratrol monomethyl ether (RME).
Vitis vinifera (taxid: 29760)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 4EC: 0
>sp|Q29U70|I4OMT_MEDTR Isoflavone 4'-O-methyltransferase OS=Medicago truncatula GN=HI4'OMT PE=1 SV=1 Back     alignment and function description
>sp|O24305|M3OM1_PEA 6a-hydroxymaackiain methyltransferase 1 OS=Pisum sativum GN=HMM1 PE=1 SV=1 Back     alignment and function description
>sp|A8QW53|OMT3_SORBI 5-pentadecatrienyl resorcinol O-methyltransferase OS=Sorghum bicolor GN=OMT3 PE=1 SV=1 Back     alignment and function description
>sp|Q6VMW0|Q8OMT_MENPI 8-hydroxyquercetin 8-O-methyltransferase OS=Mentha piperita GN=OMT2 PE=1 SV=1 Back     alignment and function description
>sp|C6TAY1|SOMT2_SOYBN Flavonoid 4'-O-methyltransferase OS=Glycine max PE=1 SV=1 Back     alignment and function description
>sp|O24529|7OMT8_MEDSA Isoflavone-7-O-methyltransferase 8 OS=Medicago sativa PE=1 SV=1 Back     alignment and function description
>sp|O22308|7OMT6_MEDSA Isoflavone-7-O-methyltransferase 6 OS=Medicago sativa PE=2 SV=1 Back     alignment and function description
>sp|O22309|7OMT9_MEDSA Isoflavone-7-O-methyltransferase 9 OS=Medicago sativa PE=2 SV=1 Back     alignment and function description
>sp|Q84KK5|D7OMT_GLYEC Isoflavone 7-O-methyltransferase OS=Glycyrrhiza echinata GN=D7OMT PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query100
302143363187 unnamed protein product [Vitis vinifera] 0.99 0.529 0.696 7e-34
147816431 357 hypothetical protein VITISV_020020 [Viti 0.99 0.277 0.696 1e-33
225446491 357 PREDICTED: 8-hydroxyquercetin 8-O-methyl 0.99 0.277 0.696 1e-33
225454044 358 PREDICTED: tabersonine 16-O-methyltransf 0.99 0.276 0.626 2e-32
297744847 270 unnamed protein product [Vitis vinifera] 0.99 0.366 0.626 2e-32
147826880 328 hypothetical protein VITISV_021918 [Viti 0.99 0.301 0.646 3e-32
225446489 357 PREDICTED: 8-hydroxyquercetin 8-O-methyl 0.99 0.277 0.646 3e-32
330375623 367 orcinol O-methyltransferase-like protein 0.99 0.269 0.686 3e-32
225446494 357 PREDICTED: tabersonine 16-O-methyltransf 0.99 0.277 0.656 1e-31
147865742 357 hypothetical protein VITISV_005827 [Viti 0.99 0.277 0.656 1e-31
>gi|302143363|emb|CBI21924.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  147 bits (371), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 69/99 (69%), Positives = 85/99 (85%)

Query: 2   ILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAIENQSQDKESMETQLCFDILMVSL 61
           ILH+WNDEE VK+L++C++AIPSK++GGKVIIIDM +ENQ  D ESMETQL FD+LM+ L
Sbjct: 89  ILHDWNDEECVKILQQCRQAIPSKEKGGKVIIIDMMMENQKGDDESMETQLFFDMLMMIL 148

Query: 62  FRGKERSVDDWKKLFLAAGFSHYKITPILGVRSLIEAYP 100
             G+ER+  +W+KLFL AGFS YKITPILG+RSLIE YP
Sbjct: 149 VTGQERNEKEWEKLFLDAGFSGYKITPILGLRSLIEVYP 187

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147816431|emb|CAN61955.1| hypothetical protein VITISV_020020 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225446491|ref|XP_002278211.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase [Vitis vinifera] Back     alignment and taxonomy information
>gi|225454044|ref|XP_002262833.1| PREDICTED: tabersonine 16-O-methyltransferase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297744847|emb|CBI38115.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147826880|emb|CAN73270.1| hypothetical protein VITISV_021918 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225446489|ref|XP_002278190.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase [Vitis vinifera] Back     alignment and taxonomy information
>gi|330375623|gb|AEC13057.1| orcinol O-methyltransferase-like protein [Rosa chinensis] Back     alignment and taxonomy information
>gi|225446494|ref|XP_002278294.1| PREDICTED: tabersonine 16-O-methyltransferase [Vitis vinifera] Back     alignment and taxonomy information
>gi|147865742|emb|CAN78992.1| hypothetical protein VITISV_005827 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query100
UNIPROTKB|Q84KK4365 HI4'OMT "Isoflavone 4'-O-methy 0.99 0.271 0.545 2.5e-26
UNIPROTKB|A8QW53374 OMT3 "5-pentadecatrienyl resor 0.98 0.262 0.525 3.2e-26
UNIPROTKB|Q84KK6367 HI4'OMT "Isoflavone 4'-O-methy 0.99 0.269 0.555 1.1e-25
UNIPROTKB|Q6VMW0366 OMT2 "8-hydroxyquercetin 8-O-m 0.99 0.270 0.52 7.6e-25
UNIPROTKB|Q84KK5357 D7OMT "Isoflavone 7-O-methyltr 0.97 0.271 0.54 2.9e-23
UNIPROTKB|B0EXJ8355 16OMT "Tabersonine 16-O-methyl 0.97 0.273 0.54 7e-22
UNIPROTKB|Q8GSN1348 Q8GSN1 "Myricetin O-methyltran 0.99 0.284 0.475 1.1e-21
TAIR|locus:2132806382 AT4G35160 [Arabidopsis thalian 0.96 0.251 0.367 9.1e-13
TAIR|locus:2034016363 AT1G51990 [Arabidopsis thalian 0.94 0.258 0.398 6.1e-12
TAIR|locus:2132801325 AT4G35150 [Arabidopsis thalian 0.95 0.292 0.355 2.7e-11
UNIPROTKB|Q84KK4 HI4'OMT "Isoflavone 4'-O-methyltransferase" [Lotus japonicus (taxid:34305)] Back     alignment and assigned GO terms
 Score = 297 (109.6 bits), Expect = 2.5e-26, P = 2.5e-26
 Identities = 54/99 (54%), Positives = 75/99 (75%)

Query:     2 ILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAIENQSQDKESMETQLCFDILMVSL 61
             +LH+WNDE S+K+LK CKEAI  + + GKVIIID++I+  S D+E  E +L +D++M+++
Sbjct:   267 VLHDWNDELSLKILKNCKEAISGRGKEGKVIIIDISIDETSDDRELTELKLDYDLVMLTM 326

Query:    62 FRGKERSVDDWKKLFLAAGFSHYKITPILGVRSLIEAYP 100
             F GKER   +W+KL   AGFS YKITPI G +SLIE +P
Sbjct:   327 FNGKEREKKEWEKLIYDAGFSSYKITPICGFKSLIEVFP 365
GO:0009701 "isoflavonoid phytoalexin biosynthetic process" evidence=IDA
GO:0030746 "isoflavone 4'-O-methyltransferase activity" evidence=IDA
UNIPROTKB|A8QW53 OMT3 "5-pentadecatrienyl resorcinol O-methyltransferase" [Sorghum bicolor (taxid:4558)] Back     alignment and assigned GO terms
UNIPROTKB|Q84KK6 HI4'OMT "Isoflavone 4'-O-methyltransferase" [Glycyrrhiza echinata (taxid:46348)] Back     alignment and assigned GO terms
UNIPROTKB|Q6VMW0 OMT2 "8-hydroxyquercetin 8-O-methyltransferase" [Mentha x piperita (taxid:34256)] Back     alignment and assigned GO terms
UNIPROTKB|Q84KK5 D7OMT "Isoflavone 7-O-methyltransferase" [Glycyrrhiza echinata (taxid:46348)] Back     alignment and assigned GO terms
UNIPROTKB|B0EXJ8 16OMT "Tabersonine 16-O-methyltransferase" [Catharanthus roseus (taxid:4058)] Back     alignment and assigned GO terms
UNIPROTKB|Q8GSN1 Q8GSN1 "Myricetin O-methyltransferase" [Catharanthus roseus (taxid:4058)] Back     alignment and assigned GO terms
TAIR|locus:2132806 AT4G35160 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034016 AT1G51990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132801 AT4G35150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query100
pfam00891239 pfam00891, Methyltransf_2, O-methyltransferase 2e-23
>gnl|CDD|216177 pfam00891, Methyltransf_2, O-methyltransferase Back     alignment and domain information 
 Score = 89.2 bits (222), Expect = 2e-23
 Identities = 33/77 (42%), Positives = 51/77 (66%), Gaps = 6/77 (7%)

Query: 2   ILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAI-ENQSQDKESMETQLCFDILMVS 60
           +LH+W+DE+ VK+LK+C EA+P    GGKVI+++M + E+   D E+    L  D+ M+ 
Sbjct: 168 VLHDWSDEDCVKILKRCYEALP---PGGKVIVVEMVLPEDPDDDLETEVLLL--DLNMLV 222

Query: 61  LFRGKERSVDDWKKLFL 77
           L  GKER+  +W+KL  
Sbjct: 223 LNGGKERTEKEWRKLLS 239

This family includes a range of O-methyltransferases. These enzymes utilise S-adenosyl methionine. Length = 239

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 100
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 99.87
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 99.85
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 99.48
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 98.81
TIGR00740239 methyltransferase, putative. A simple BLAST search 98.68
PLN02233261 ubiquinone biosynthesis methyltransferase 98.48
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.48
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.44
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 98.44
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.39
PLN02232160 ubiquinone biosynthesis methyltransferase 98.34
PLN02490340 MPBQ/MSBQ methyltransferase 98.33
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.29
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 98.22
TIGR00452314 methyltransferase, putative. Known examples to dat 98.21
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 98.2
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 98.03
PLN02336475 phosphoethanolamine N-methyltransferase 98.03
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 97.94
PLN02244340 tocopherol O-methyltransferase 97.91
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 97.89
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 97.8
TIGR03438301 probable methyltransferase. This model represents 97.78
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 97.69
PRK04266226 fibrillarin; Provisional 97.61
PRK08317241 hypothetical protein; Provisional 97.6
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 97.59
PLN02336 475 phosphoethanolamine N-methyltransferase 97.56
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 97.5
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 97.34
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 97.13
PRK11207197 tellurite resistance protein TehB; Provisional 97.1
KOG4300252 consensus Predicted methyltransferase [General fun 96.99
PLN02585315 magnesium protoporphyrin IX methyltransferase 96.97
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 96.97
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 96.96
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 96.95
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 96.9
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 96.78
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 96.72
PRK06202232 hypothetical protein; Provisional 96.57
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 96.47
KOG2361264 consensus Predicted methyltransferase [General fun 96.46
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 96.22
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 96.1
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 96.06
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 96.05
PRK06922677 hypothetical protein; Provisional 96.03
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 95.95
PTZ00146293 fibrillarin; Provisional 95.89
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 95.8
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 95.59
PRK12335287 tellurite resistance protein TehB; Provisional 95.43
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 94.82
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 94.64
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 94.48
COG4798238 Predicted methyltransferase [General function pred 94.39
PRK10611287 chemotaxis methyltransferase CheR; Provisional 94.3
PLN03075296 nicotianamine synthase; Provisional 94.27
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 94.18
PRK14968188 putative methyltransferase; Provisional 93.86
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 93.64
PRK13255218 thiopurine S-methyltransferase; Reviewed 93.38
KOG2899288 consensus Predicted methyltransferase [General fun 93.12
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 92.93
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 92.66
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 92.64
PRK10258251 biotin biosynthesis protein BioC; Provisional 92.62
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 92.26
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 92.26
PRK05785226 hypothetical protein; Provisional 92.24
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 92.14
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 90.42
PF10017127 Methyltransf_33: Histidine-specific methyltransfer 90.2
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 89.71
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 88.62
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 88.09
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 87.98
PRK13256226 thiopurine S-methyltransferase; Reviewed 87.6
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 86.9
TIGR00027260 mthyl_TIGR00027 methyltransferase, putative, TIGR0 86.45
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 86.22
COG4627185 Uncharacterized protein conserved in bacteria [Fun 85.96
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 85.68
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 85.67
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 84.88
KOG1270282 consensus Methyltransferases [Coenzyme transport a 84.58
PRK14967223 putative methyltransferase; Provisional 84.15
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 82.9
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 82.36
PF0884557 SymE_toxin: Toxin SymE, type I toxin-antitoxin sys 82.17
KOG3045325 consensus Predicted RNA methylase involved in rRNA 80.42
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 80.19
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information 
Probab=99.87  E-value=1.4e-22  Score=144.34  Aligned_cols=96  Identities=32%  Similarity=0.595  Sum_probs=83.4

Q ss_pred             ccccCChHHHHHHHHHHHHhCCCCCCCcEEEEEeeecCCC-CCCchhhhhhhhhhhhcccccC-ceecCHHHHHHHHHHc
Q 040309            2 ILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAIENQ-SQDKESMETQLCFDILMVSLFR-GKERSVDDWKKLFLAA   79 (100)
Q Consensus         2 vlHdw~d~~~~~iL~~~~~al~~~~pgg~lli~e~v~~~~-~~~~~~~~~~~~~dl~ml~~~~-g~~rt~~e~~~ll~~a   79 (100)
                      |||||+|++|++||+||+++|+   |+|+|+|+|+++|+. ...+-.+.....+|+.|++.+. |++||.+||+.++.++
T Consensus       245 iLhdwtDedcvkiLknC~~sL~---~~GkIiv~E~V~p~e~~~dd~~s~v~~~~d~lm~~~~~~Gkert~~e~q~l~~~~  321 (342)
T KOG3178|consen  245 ILHDWTDEDCVKILKNCKKSLP---PGGKIIVVENVTPEEDKFDDIDSSVTRDMDLLMLTQTSGGKERTLKEFQALLPEE  321 (342)
T ss_pred             ecccCChHHHHHHHHHHHHhCC---CCCEEEEEeccCCCCCCccccccceeehhHHHHHHHhccceeccHHHHHhcchhh
Confidence            7999999999999999999999   999999999999862 2221112344578999998886 9999999999999999


Q ss_pred             CCceeEEEecCCcceEEEEeC
Q 040309           80 GFSHYKITPILGVRSLIEAYP  100 (100)
Q Consensus        80 Gf~~~~v~~~~~~~~vie~~p  100 (100)
                      ||.+.++...+..+++||+++
T Consensus       322 gF~~~~~~~~~~~~~~Ie~~k  342 (342)
T KOG3178|consen  322 GFPVCMVALTAYSYSVIEFHK  342 (342)
T ss_pred             cCceeEEEeccCccchheeCC
Confidence            999999999988999999875

>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF10017 Methyltransf_33: Histidine-specific methyltransferase, SAM-dependent; InterPro: IPR019257 This domain is found in methyltransferases and various hypothetical proteins Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00027 mthyl_TIGR00027 methyltransferase, putative, TIGR00027 family Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PF08845 SymE_toxin: Toxin SymE, type I toxin-antitoxin system; InterPro: IPR014944 This entry represents a SOS-induced gene whose product shows homology to the antitoxin MazE (SymE), the coding region contains a cis-encoded antisense RNA Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query100
1zg3_A358 Crystal Structure Of The Isoflavanone 4'-O-Methyltr 1e-27
1zga_A357 Crystal Structure Of Isoflavanone 4'-o-methyltransf 1e-27
1zgj_A354 Crystal Structure Of Isoflavanone 4'-O-Methyltransf 1e-27
1fp2_A352 Crystal Structure Analysis Of Isoflavone O-Methyltr 4e-24
2qyo_A357 Crystal Structure Of Isoflavone O-Methyltransferase 8e-23
1fpx_A352 Crystal Structure Analysis Of Selenomethionine Subs 2e-22
3lst_A348 Crystal Structure Of Calo1, Methyltransferase In Ca 1e-08
1fp1_D372 Crystal Structure Analysis Of Chalcone O-Methyltran 1e-07
3reo_A368 Monolignol O-Methyltransferase (Momt) Length = 368 3e-07
1kyw_A365 Crystal Structure Analysis Of Caffeic Acid5-Hydroxy 5e-07
1fpq_A372 Crystal Structure Analysis Of Selenomethionine Subs 7e-07
3i53_A332 Crystal Structure Of An O-Methyltransferase (Ncsb1) 3e-06
3p9c_A364 Crystal Structure Of Perennial Ryegrass Lpomt1 Boun 7e-06
1qzz_A374 Crystal Structure Of Aclacinomycin-10-Hydroxylase ( 6e-04
1tw2_A360 Crystal Structure Of Carminomycin-4-O-Methyltransfe 7e-04
>pdb|1ZG3|A Chain A, Crystal Structure Of The Isoflavanone 4'-O-Methyltransferase Complexed With Sah And 2,7,4'-Trihydroxyisoflavanone Length = 358 Back     alignment and structure 
Iteration: 1

 Score =  117 bits (294), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 55/99 (55%), Positives = 75/99 (75%)
Query: 2   ILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAIENQSQDKESMETQLCFDILMVSL 61
           +LH+WNDE+S+K+LK  KEAI  K + GKVIIID++I+  S D+   E QL +D++M+++
Sbjct: 260 VLHDWNDEQSLKILKNSKEAISHKGKDGKVIIIDISIDETSDDRGLTELQLDYDLVMLTM 319
Query: 62  FRGKERSVDDWKKLFLAAGFSHYKITPILGVRSLIEAYP 100
           F GKER+  +W+KL   AGFS YKITPI G +SLIE YP
Sbjct: 320 FLGKERTKQEWEKLIYDAGFSSYKITPISGFKSLIEVYP 358
>pdb|1ZGA|A Chain A, Crystal Structure Of Isoflavanone 4'-o-methyltransferase Complexed With (+)-6a-hydroxymaackiain Length = 357 Back     alignment and structure
>pdb|1ZGJ|A Chain A, Crystal Structure Of Isoflavanone 4'-O-Methyltransferase Complexed With (+)-Pisatin Length = 354 Back     alignment and structure
>pdb|1FP2|A Chain A, Crystal Structure Analysis Of Isoflavone O-Methyltransferase Length = 352 Back     alignment and structure
>pdb|2QYO|A Chain A, Crystal Structure Of Isoflavone O-Methyltransferase Homolog In Complex With Biochanin A And Sah Length = 357 Back     alignment and structure
>pdb|1FPX|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Isoflavone O-Methyltransferase Length = 352 Back     alignment and structure
>pdb|3LST|A Chain A, Crystal Structure Of Calo1, Methyltransferase In Calicheamicin Biosynthesis, Sah Bound Form Length = 348 Back     alignment and structure
>pdb|1FP1|D Chain D, Crystal Structure Analysis Of Chalcone O-Methyltransferase Length = 372 Back     alignment and structure
>pdb|3REO|A Chain A, Monolignol O-Methyltransferase (Momt) Length = 368 Back     alignment and structure
>pdb|1KYW|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde Length = 365 Back     alignment and structure
>pdb|1FPQ|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Chalcone O- Methyltransferase Length = 372 Back     alignment and structure
>pdb|3I53|A Chain A, Crystal Structure Of An O-Methyltransferase (Ncsb1) From Neocarzinostatin Biosynthesis In Complex With S-Adenosyl-L- Homocysteine (Sah) Length = 332 Back     alignment and structure
>pdb|3P9C|A Chain A, Crystal Structure Of Perennial Ryegrass Lpomt1 Bound To Sah Length = 364 Back     alignment and structure
>pdb|1QZZ|A Chain A, Crystal Structure Of Aclacinomycin-10-Hydroxylase (Rdmb) In Complex With S-Adensyl-L-Methionine (Sam) Length = 374 Back     alignment and structure
>pdb|1TW2|A Chain A, Crystal Structure Of Carminomycin-4-O-Methyltransferase (Dnrk) In Complex With S-Adenosyl-L-Homocystein (Sah) And 4-Methoxy-E-Rhodomycin T (M-Et) Length = 360 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query100
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 5e-47
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 4e-45
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 8e-42
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 3e-41
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 4e-41
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 1e-40
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 2e-40
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 8e-40
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 1e-39
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 1e-37
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 2e-37
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 6e-37
2r3s_A335 Uncharacterized protein; methyltransferase domain, 3e-31
3dp7_A363 SAM-dependent methyltransferase; structural genomi 2e-28
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 1e-25
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Length = 358 Back     alignment and structure
 Score =  152 bits (386), Expect = 5e-47
 Identities = 55/99 (55%), Positives = 75/99 (75%)

Query: 2   ILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAIENQSQDKESMETQLCFDILMVSL 61
           +LH+WNDE+S+K+LK  KEAI  K + GKVIIID++I+  S D+   E QL +D++M+++
Sbjct: 260 VLHDWNDEQSLKILKNSKEAISHKGKDGKVIIIDISIDETSDDRGLTELQLDYDLVMLTM 319

Query: 62  FRGKERSVDDWKKLFLAAGFSHYKITPILGVRSLIEAYP 100
           F GKER+  +W+KL   AGFS YKITPI G +SLIE YP
Sbjct: 320 FLGKERTKQEWEKLIYDAGFSSYKITPISGFKSLIEVYP 358
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Length = 352 Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Length = 334 Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Length = 348 Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Length = 360 Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Length = 369 Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Length = 364 Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 1kyz_A* 1kyw_A* Length = 368 Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Length = 372 Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Length = 374 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Length = 332 Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Length = 359 Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Length = 335 Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Length = 363 Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Length = 352 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query100
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 99.95
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 99.88
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 99.87
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 99.83
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.83
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 99.83
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 99.81
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 99.81
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 99.8
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 99.78
3dp7_A363 SAM-dependent methyltransferase; structural genomi 99.75
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.7
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.7
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.68
2r3s_A335 Uncharacterized protein; methyltransferase domain, 99.68
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 99.63
3dtn_A234 Putative methyltransferase MM_2633; structural gen 98.95
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 98.77
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 98.71
3hnr_A220 Probable methyltransferase BT9727_4108; structural 98.71
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 98.63
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 98.62
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 98.61
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.59
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 98.56
3dh0_A219 SAM dependent methyltransferase; cystal structure, 98.55
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 98.53
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 98.53
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 98.49
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 98.48
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 98.47
3lcc_A235 Putative methyl chloride transferase; halide methy 98.47
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 98.46
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 98.43
1vl5_A260 Unknown conserved protein BH2331; putative methylt 98.42
3ocj_A305 Putative exported protein; structural genomics, PS 98.4
1xxl_A239 YCGJ protein; structural genomics, protein structu 98.39
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 98.39
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 98.38
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.36
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.35
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 98.35
3i9f_A170 Putative type 11 methyltransferase; structural gen 98.31
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 98.28
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 98.24
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 98.21
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 98.2
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.19
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 98.16
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 98.16
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.15
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 98.15
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 98.1
2p7i_A250 Hypothetical protein; putative methyltransferase, 98.08
1vlm_A219 SAM-dependent methyltransferase; possible histamin 98.07
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 98.06
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 98.01
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 98.0
3f4k_A257 Putative methyltransferase; structural genomics, P 97.99
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 97.97
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 97.95
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 97.94
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 97.89
3cc8_A230 Putative methyltransferase; structural genomics, j 97.89
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 97.84
3giw_A277 Protein of unknown function DUF574; rossmann-fold 97.81
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 97.8
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 97.78
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 97.69
3gu3_A284 Methyltransferase; alpha-beta protein, structural 97.69
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 97.61
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 97.6
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 97.6
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 97.55
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 97.55
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 97.54
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 97.54
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 97.5
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 97.49
2i62_A265 Nicotinamide N-methyltransferase; structural genom 97.47
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 97.46
3ege_A261 Putative methyltransferase from antibiotic biosyn 97.4
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 97.36
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 97.35
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 97.34
2kw5_A202 SLR1183 protein; structural genomics, northeast st 97.3
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 97.18
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 96.83
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 96.82
1wzn_A252 SAM-dependent methyltransferase; structural genomi 96.82
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 96.6
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 96.5
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 96.5
3m70_A286 Tellurite resistance protein TEHB homolog; structu 96.29
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 96.07
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 95.97
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 95.85
2b3t_A276 Protein methyltransferase HEMK; translation termin 95.84
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 95.8
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 95.62
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 95.56
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 95.31
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 95.12
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 95.03
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 94.97
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 94.6
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 94.33
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 93.98
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 93.79
3m33_A226 Uncharacterized protein; structural genomics, PSI- 93.75
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 93.75
3iei_A334 Leucine carboxyl methyltransferase 1; LCMT-1, S-ad 93.48
1rjd_A334 PPM1P, carboxy methyl transferase for protein phos 93.48
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 93.36
2h00_A254 Methyltransferase 10 domain containing protein; st 93.0
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 92.9
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 92.6
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 92.05
3lpm_A259 Putative methyltransferase; structural genomics, p 91.8
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 91.39
2uyo_A310 Hypothetical protein ML2640; putative methyltransf 91.24
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 90.76
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 90.67
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 90.65
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 90.44
4hg2_A257 Methyltransferase type 11; structural genomics, PS 89.45
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 89.19
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 89.1
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 89.09
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 88.73
2efj_A384 3,7-dimethylxanthine methyltransferase; SAM-depend 88.53
3duw_A223 OMT, O-methyltransferase, putative; alternating of 87.97
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 87.9
1yb2_A275 Hypothetical protein TA0852; structural genomics, 87.86
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 87.75
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 87.64
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 87.61
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 87.39
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 87.25
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 87.02
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 86.48
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 86.34
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 84.85
2frn_A278 Hypothetical protein PH0793; structural genomics, 84.64
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 84.37
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 83.28
2b25_A336 Hypothetical protein; structural genomics, methyl 83.22
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 81.39
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 81.01
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
Probab=99.95  E-value=2.3e-27  Score=169.15  Aligned_cols=94  Identities=20%  Similarity=0.423  Sum_probs=86.6

Q ss_pred             CccccCChHHHHHHHHHHHHhCCCCCCCcEEEEEeeecCCCCCCchhhhhhhhhhhhcccccCceecCHHHHHHHHHHcC
Q 040309            1 GILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAIENQSQDKESMETQLCFDILMVSLFRGKERSVDDWKKLFLAAG   80 (100)
Q Consensus         1 ~vlHdw~d~~~~~iL~~~~~al~~~~pgg~lli~e~v~~~~~~~~~~~~~~~~~dl~ml~~~~g~~rt~~e~~~ll~~aG   80 (100)
                      +|||||+|++|++||++|+++|+   |||+|+|+|.++++++..+   .....+|+.||+.++|++||.+||++||++||
T Consensus       252 ~vlh~~~d~~~~~iL~~~~~al~---pgg~lli~e~~~~~~~~~~---~~~~~~dl~ml~~~~g~ert~~e~~~ll~~AG  325 (353)
T 4a6d_A          252 RVLHDWADGKCSHLLERIYHTCK---PGGGILVIESLLDEDRRGP---LLTQLYSLNMLVQTEGQERTPTHYHMLLSSAG  325 (353)
T ss_dssp             SSGGGSCHHHHHHHHHHHHHHCC---TTCEEEEEECCCCTTSCCC---HHHHHHHHHHHHSSSCCCCCHHHHHHHHHHHT
T ss_pred             eecccCCHHHHHHHHHHHHhhCC---CCCEEEEEEeeeCCCCCCC---HHHHHHHHHHHHhCCCcCCCHHHHHHHHHHCC
Confidence            58999999999999999999999   9999999999998776553   24567899999999999999999999999999


Q ss_pred             CceeEEEecCCcceEEEEeC
Q 040309           81 FSHYKITPILGVRSLIEAYP  100 (100)
Q Consensus        81 f~~~~v~~~~~~~~vie~~p  100 (100)
                      |+.++++++++..++|++++
T Consensus       326 f~~v~v~~~~~~~~~i~ArK  345 (353)
T 4a6d_A          326 FRDFQFKKTGAIYDAILARK  345 (353)
T ss_dssp             CEEEEEECCSSSCEEEEEEC
T ss_pred             CceEEEEEcCCceEEEEEEe
Confidence            99999999999999999985
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3iei_A Leucine carboxyl methyltransferase 1; LCMT-1, S-adenosyl-L-methionine; HET: SAH MES; 1.90A {Homo sapiens} PDB: 3p71_T* 3mnt_A* 3o7w_A* Back     alignment and structure
>1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2uyo_A Hypothetical protein ML2640; putative methyltransferase, transferas; 1.7A {Mycobacterium leprae} SCOP: c.66.1.57 PDB: 2ckd_A 2uyq_A* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 100
d1fp2a2244 c.66.1.12 (A:109-352) Isoflavone O-methyltransfera 2e-34
d1fp1d2244 c.66.1.12 (D:129-372) Chalcone O-methyltransferase 3e-28
d1kyza2243 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferuli 5e-22
d1qzza2256 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase 5e-15
d1tw3a2253 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransf 1e-13
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Plant O-methyltransferase, C-terminal domain
domain: Isoflavone O-methyltransferase
species: Alfalfa (Medicago sativa) [TaxId: 3879]

 Score =  116 bits (291), Expect = 2e-34
 Identities = 48/99 (48%), Positives = 70/99 (70%), Gaps = 1/99 (1%)

Query: 2   ILHNWNDEESVKLLKKCKEAIPSKDEGGKVIIIDMAIENQSQDKESMETQLCFDILMVSL 61
           ILHNW D++ +++LKKCKEA+ +  + GKV IIDM I+ +  + +  + +L  D+ M + 
Sbjct: 147 ILHNWTDKDCLRILKKCKEAVTNDGKRGKVTIIDMVIDKKKDENQVTQIKLLMDVNM-AC 205

Query: 62  FRGKERSVDDWKKLFLAAGFSHYKITPILGVRSLIEAYP 100
             GKER+ ++WKKLF+ AGF HYKI+P+ G  SLIE YP
Sbjct: 206 LNGKERNEEEWKKLFIEAGFQHYKISPLTGFLSLIEIYP 244
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 243 Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Length = 256 Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Length = 253 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query100
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 99.96
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 99.95
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 99.93
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.9
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.84
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 98.89
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 98.88
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 98.78
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 98.56
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 98.45
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 98.19
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 98.14
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 97.84
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 97.8
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 97.75
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 97.69
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 97.68
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 97.39
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 97.33
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 97.3
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 97.26
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 97.19
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 97.17
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 96.68
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 96.66
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 96.63
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 96.27
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 96.2
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 95.54
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 95.47
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 95.14
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 94.67
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 94.27
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 92.02
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 91.82
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 91.61
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 90.49
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 84.46
d2uyoa1297 Putative methyltransferase ML2640 {Mycobacterium l 83.63
d2axla1144 Werner syndrome ATP-dependent helicase WRN {Human 80.98
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Plant O-methyltransferase, C-terminal domain
domain: Isoflavone O-methyltransferase
species: Alfalfa (Medicago sativa) [TaxId: 3879]

Probab=99.96  E-value=1.2e-29  Score=172.33  Aligned_cols=96  Identities=50%  Similarity=0.968  Sum_probs=86.3

Q ss_pred             CccccCChHHHHHHHHHHHHhCCCCCCC---cEEEEEeeecCCCCCCchhhhhhhhhhhhcccccCceecCHHHHHHHHH
Q 040309            1 GILHNWNDEESVKLLKKCKEAIPSKDEG---GKVIIIDMAIENQSQDKESMETQLCFDILMVSLFRGKERSVDDWKKLFL   77 (100)
Q Consensus         1 ~vlHdw~d~~~~~iL~~~~~al~~~~pg---g~lli~e~v~~~~~~~~~~~~~~~~~dl~ml~~~~g~~rt~~e~~~ll~   77 (100)
                      +|||||+|++|++||++|++||+   ||   |+++|+|.++++.+..++.......+|++|++ ++|++||.+||++||+
T Consensus       146 ~vLHdw~d~~~~~iL~~~~~al~---pgg~~~~lli~e~~~~~~~~~~~~~~~~~~~dl~m~~-~~G~ert~~e~~~ll~  221 (244)
T d1fp2a2         146 YILHNWTDKDCLRILKKCKEAVT---NDGKRGKVTIIDMVIDKKKDENQVTQIKLLMDVNMAC-LNGKERNEEEWKKLFI  221 (244)
T ss_dssp             SCGGGSCHHHHHHHHHHHHHHHS---GGGCCCEEEEEECEECTTTSCHHHHHHHHHHHHHGGG-GTCCCEEHHHHHHHHH
T ss_pred             eecccCChHHHHHHHHHHHHHcC---cccCCcEEEEEEeecCCCCCCchHHHHHHHHHHHHHh-CCCcCCCHHHHHHHHH
Confidence            68999999999999999999999   77   99999999999877665443445678888876 6899999999999999


Q ss_pred             HcCCceeEEEecCCcceEEEEeC
Q 040309           78 AAGFSHYKITPILGVRSLIEAYP  100 (100)
Q Consensus        78 ~aGf~~~~v~~~~~~~~vie~~p  100 (100)
                      +|||+.++++++.+..||||++|
T Consensus       222 ~AGf~~~~i~~~~~~~svIE~~p  244 (244)
T d1fp2a2         222 EAGFQHYKISPLTGFLSLIEIYP  244 (244)
T ss_dssp             HTTCCEEEEEEEETTEEEEEEEC
T ss_pred             HcCCceEEEEECCCCeEEEEEeC
Confidence            99999999999999999999998
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2uyoa1 c.66.1.57 (A:14-310) Putative methyltransferase ML2640 {Mycobacterium leprae [TaxId: 1769]} Back     information, alignment and structure
>d2axla1 a.4.5.43 (A:1-144) Werner syndrome ATP-dependent helicase WRN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure