Citrus Sinensis ID: 040317

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----

MAINHCSDILIRNVKIIDPTNSPTTDGIQMQSSTGVTITSSSIMTGEPFVNRLGDHLNEEGVQNVTVTSSSFTNTQNGVRIKLWARPRNGYARNIAFRNIIMNDIQNPIIIDRNYCSYNRGCPHQ

cEEEEEEcEEEEEEEEEccccccccccccccccccEEEEccEEEccccEEEEcccccccccEEEEEEEEEEEEccccEEEEEEEcccccEEEEEEEEEcEEEEcccccEEEcccccccccccccc

cEEccccEEEEEEEEEEccccccccccEEEEccccEEEEEcEEccccccEcEcccccccccEEEEEEEEEEEEcccccEEEEEcccccccEEEEEEEEEEEEEcccccEEEEccccccccccccc

mainhcsdilirnvkiidptnspttdgiqmqsstgvtitsssimtgepfvnrlgdhlneegvqNVTVTSssftntqngvriklwarprngyarnIAFRNIIMndiqnpiiidrnycsynrgcphq

mainhcsdILIRnvkiidptnspttdgiqmqsstGVTITSSSIMTGEPFVNRLGDHLNEEGVQNVtvtsssftntqngvriklwarprngYARNIAFRNIIMNDIQNPIIIDRNYCSYNRGCPHQ

MAINHCSDILIRNVKIIDPTNSPTTDGIQMQsstgvtitsssimtgEPFVNRLGDHLNEEGvqnvtvtsssftntqnGVRIKLWARPRNGYARNIAFRniimndiqnpiiiDRNYCSYNRGCPHQ

****HCSDILIRNVKIID****************************EPFVNRLGDHLNEEGVQNVTVTSSSFTNTQNGVRIKLWARPRNGYARNIAFRNIIMNDIQNPIIIDRNYCSYNR*****

MAINHCSDILIRNVKIIDPTNSPTTDGIQMQSSTGVTITSSSIMTGEPFVNRLGDHLNEEGVQNVTVTSSSFTNTQNGVRIKLWARPRNGYARNIAFRNIIMNDIQNPIIIDRNYCS********

MAINHCSDILIRNVKIIDPTNSPTTDGIQMQSSTGVTITSSSIMTGEPFVNRLGDHLNEEGVQNVTVTSSSFTNTQNGVRIKLWARPRNGYARNIAFRNIIMNDIQNPIIIDRNYCSYNRGCPHQ

MAINHCSDILIRNVKIIDPTNSPTTDGIQMQSSTGVTITSSSIMTGEPFVNRLGDHLNEEGVQNVTVTSSSFTNTQNGVRIKLWARPRNGYARNIAFRNIIMNDIQNPIIIDRNYCSYNR*****

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAINHCSDILIRNVKIIDPTNSPTTDGIQMQSSTGVTITSSSIMTGEPFVNRLGDHLNEEGVQNVTVTSSSFTNTQNGVRIKLWARPRNGYARNIAFRNIIMNDIQNPIIIDRNYCSYNRGCPHQ

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		125	2.2.26 [Sep-21-2011]
P48979		393	Polygalacturonase OS=Prun	N/A	no	1.0	0.318	0.409	4e-26
O22818		405	Probable polygalacturonas	no	no	0.992	0.306	0.382	1e-19
Q39786		407	Polygalacturonase OS=Goss	N/A	no	0.92	0.282	0.345	5e-18
Q39766		407	Polygalacturonase OS=Goss	N/A	no	0.92	0.282	0.345	5e-18
Q6H9K0		377	Exopolygalacturonase (Fra	N/A	no	0.96	0.318	0.337	6e-18
Q94AJ5		444	Probable polygalacturonas	no	no	0.992	0.279	0.328	1e-16
Q02096		462	Polygalacturonase OS=Pers	N/A	no	0.992	0.268	0.315	4e-16
Q05967		396	Polygalacturonase OS=Nico	N/A	no	0.944	0.297	0.323	8e-16
Q9SFB7		439	Polygalacturonase QRT2 OS	no	no	0.992	0.282	0.308	3e-15
P48978		460	Polygalacturonase OS=Malu	N/A	no	0.976	0.265	0.324	5e-15

>sp\|P48979\|PGLR_PRUPE Polygalacturonase OS=Prunus persica PE=2 SV=1	Back alignment and function desciption

 Score =  116 bits (291), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 61/149 (40%), Positives = 87/149 (58%), Gaps = 24/149 (16%)

Query: 1   MAINHCSDILIRNVKIIDPTNSPTTDGIQMQSSTGVTITSSSIMTGEPFVN--------- 51
           + IN   ++ ++ V++    NSP TDGI +Q S+GVTI +S I TG+  V+         
Sbjct: 173 IVINDFQNVQMQGVRVSRSGNSPNTDGIHVQMSSGVTILNSKIATGDDCVSIGPGTSNLW 232

Query: 52  ---------------RLGDHLNEEGVQNVTVTSSSFTNTQNGVRIKLWARPRNGYARNIA 96
                           LG    E GVQNVTV + +F+ TQNG+RIK W RP  G+ARNI 
Sbjct: 233 IEGVACGPGHGISIGSLGKEQEEAGVQNVTVKTVTFSGTQNGLRIKSWGRPSTGFARNIL 292

Query: 97  FRNIIMNDIQNPIIIDRNYCSYNRGCPHQ 125
           F++  M +++NPI+ID++YC  N+GCP Q
Sbjct: 293 FQHATMVNVENPIVIDQHYCPDNKGCPGQ 321

Acts in concert with the pectinesterase, in the ripening process. Is involved in cell wall metabolism, specifically in polyuronide degradation.
Prunus persica (taxid: 3760)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 5

>sp\|O22818\|PGLR6_ARATH Probable polygalacturonase At2g43860 OS=Arabidopsis thaliana GN=At2g43860 PE=2 SV=1	Back alignment and function description

>sp\|Q39786\|PGLR_GOSHI Polygalacturonase OS=Gossypium hirsutum GN=G9 PE=2 SV=1	Back alignment and function description

>sp\|Q39766\|PGLR_GOSBA Polygalacturonase OS=Gossypium barbadense GN=G9 PE=2 SV=1	Back alignment and function description

>sp\|Q6H9K0\|PGLR2_PLAAC Exopolygalacturonase (Fragment) OS=Platanus acerifolia GN=plaa2 PE=1 SV=1	Back alignment and function description

>sp\|Q94AJ5\|PGLR5_ARATH Probable polygalacturonase At1g80170 OS=Arabidopsis thaliana GN=At1g80170 PE=1 SV=1	Back alignment and function description

>sp\|Q02096\|PGLR_PERAE Polygalacturonase OS=Persea americana PE=2 SV=1	Back alignment and function description

>sp\|Q05967\|PGLR_TOBAC Polygalacturonase OS=Nicotiana tabacum GN=PG1 PE=2 SV=1	Back alignment and function description

>sp\|Q9SFB7\|QRT2_ARATH Polygalacturonase QRT2 OS=Arabidopsis thaliana GN=QRT2 PE=1 SV=2	Back alignment and function description

>sp\|P48978\|PGLR_MALDO Polygalacturonase OS=Malus domestica PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		125
224117794		390	predicted protein [Populus trichocarpa]	1.0	0.320	0.476	4e-34
15224381		394	putative polygalacturonase /pectinase [A	1.0	0.317	0.489	1e-33
15220596		394	Pectin lyase-like protein [Arabidopsis t	1.0	0.317	0.456	6e-33
224117798		390	predicted protein [Populus trichocarpa]	1.0	0.320	0.456	1e-32
297824381		393	hypothetical protein ARALYDRAFT_903792 [	1.0	0.318	0.483	1e-32
297848850		394	hypothetical protein ARALYDRAFT_887757 [	1.0	0.317	0.449	1e-32
15220597		394	Pectin lyase-like protein [Arabidopsis t	1.0	0.317	0.442	3e-32
224092830		390	predicted protein [Populus trichocarpa]	1.0	0.320	0.442	6e-32
357450573		391	Polygalacturonase [Medicago truncatula]	0.992	0.317	0.496	9e-32
356498258		395	PREDICTED: polygalacturonase-like [Glyci	1.0	0.316	0.442	5e-31

>gi\|224117794\|ref\|XP_002331633.1\| predicted protein [Populus trichocarpa] gi\|222874029\|gb\|EEF11160.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 71/149 (47%), Positives = 100/149 (67%), Gaps = 24/149 (16%)

Query: 1   MAINHCSDILIRNVKIIDPTNSPTTDGIQMQSSTGVTITSSSIMTGEPFVN--------- 51
           + IN C+++L+RNV++I P NSP TDGI +Q STGVTIT S++ TG+  ++         
Sbjct: 170 IVINSCNNVLVRNVRVIAPYNSPNTDGIHVQISTGVTITGSTLQTGDDCISIGPSTRNLL 229

Query: 52  ---------------RLGDHLNEEGVQNVTVTSSSFTNTQNGVRIKLWARPRNGYARNIA 96
                           LG   NE+GV+N+T+T+S F+ + NGVRIK WARP NG+ RN+ 
Sbjct: 230 MSSIKCGPGHGISIGSLGKDFNEDGVENITLTNSIFSGSDNGVRIKSWARPSNGFVRNVV 289

Query: 97  FRNIIMNDIQNPIIIDRNYCSYNRGCPHQ 125
           F+N+IM +++NPIIID+NYC  N+GCPHQ
Sbjct: 290 FQNLIMKNVKNPIIIDQNYCPNNQGCPHQ 318

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|15224381\|ref\|NP_181916.1\| putative polygalacturonase /pectinase [Arabidopsis thaliana] gi\|3212875\|gb\|AAC23426.1\| putative polygalacturonase [Arabidopsis thaliana] gi\|330255246\|gb\|AEC10340.1\| putative polygalacturonase /pectinase [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|15220596\|ref\|NP_172056.1\| Pectin lyase-like protein [Arabidopsis thaliana] gi\|4836915\|gb\|AAD30617.1\|AC007153_9 putative polygalacturonase [Arabidopsis thaliana] gi\|332189750\|gb\|AEE27871.1\| Pectin lyase-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|224117798\|ref\|XP_002331634.1\| predicted protein [Populus trichocarpa] gi\|222874030\|gb\|EEF11161.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|297824381\|ref\|XP_002880073.1\| hypothetical protein ARALYDRAFT_903792 [Arabidopsis lyrata subsp. lyrata] gi\|297325912\|gb\|EFH56332.1\| hypothetical protein ARALYDRAFT_903792 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|297848850\|ref\|XP_002892306.1\| hypothetical protein ARALYDRAFT_887757 [Arabidopsis lyrata subsp. lyrata] gi\|297338148\|gb\|EFH68565.1\| hypothetical protein ARALYDRAFT_887757 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|15220597\|ref\|NP_172057.1\| Pectin lyase-like protein [Arabidopsis thaliana] gi\|4836916\|gb\|AAD30618.1\|AC007153_10 putative polygalacturonase [Arabidopsis thaliana] gi\|332189751\|gb\|AEE27872.1\| Pectin lyase-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|224092830\|ref\|XP_002309713.1\| predicted protein [Populus trichocarpa] gi\|222852616\|gb\|EEE90163.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|357450573\|ref\|XP_003595563.1\| Polygalacturonase [Medicago truncatula] gi\|355484611\|gb\|AES65814.1\| Polygalacturonase [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356498258\|ref\|XP_003517970.1\| PREDICTED: polygalacturonase-like [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		125
TAIR\|locus:2043894		394	AT2G43880 [Arabidopsis thalian	0.608	0.192	0.368	3.4e-16
TAIR\|locus:2031963		394	AT1G05660 [Arabidopsis thalian	0.608	0.192	0.315	2e-15
TAIR\|locus:2031953		394	AT1G05650 [Arabidopsis thalian	0.592	0.187	0.351	3.6e-15
TAIR\|locus:2051764		392	AT2G43890 [Arabidopsis thalian	0.608	0.193	0.342	1e-14
TAIR\|locus:2080422		388	AT3G59850 [Arabidopsis thalian	0.608	0.195	0.355	1.4e-13
TAIR\|locus:2043924		384	AT2G43870 [Arabidopsis thalian	0.6	0.195	0.328	1.2e-11
TAIR\|locus:2034131		397	AT1G65570 [Arabidopsis thalian	0.608	0.191	0.25	1.4e-10
TAIR\|locus:2043974		405	AT2G43860 [Arabidopsis thalian	0.6	0.185	0.289	6.6e-08
TAIR\|locus:2156314		332	AT5G44830 [Arabidopsis thalian	0.336	0.126	0.395	8.1e-07
TAIR\|locus:2155292		381	AT5G44840 [Arabidopsis thalian	0.24	0.078	0.366	4e-06

TAIR\|locus:2043894 AT2G43880 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 150 (57.9 bits), Expect = 3.4e-16, Sum P(2) = 3.4e-16
 Identities = 28/76 (36%), Positives = 34/76 (44%)

Query:    50 VNRLGDHLNEEGXXXXXXXXXXXXXXXXGVRIKLWARPRNGYARNIAFRXXXXXXXXXXX 109
             +  LGD+ NEEG                GVRIK WARP  G+  N+ FR           
Sbjct:   247 IGSLGDYANEEGVQNVTVTSSVFTKTQNGVRIKTWARPSRGFVNNVVFRNLIMNNVENPV 306

Query:   110 XXDRNYCSYNRGCPHQ 125
               D+NYC   +GCP Q
Sbjct:   307 IIDQNYCPNGKGCPRQ 322

GO:0004650 "polygalacturonase activity" evidence=IEA;ISS

GO:0005576 "extracellular region" evidence=ISM

GO:0005975 "carbohydrate metabolic process" evidence=IEA;ISS

TAIR\|locus:2031963 AT1G05660 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2031953 AT1G05650 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2051764 AT2G43890 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2080422 AT3G59850 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2043924 AT2G43870 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2034131 AT1G65570 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2043974 AT2G43860 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2156314 AT5G44830 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2155292 AT5G44840 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.2.1	0.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		125
PLN02155		394	PLN02155, PLN02155, polygalacturonase	4e-42
PLN02188		404	PLN02188, PLN02188, polygalacturonase/glycoside hy	6e-28
PLN02793		443	PLN02793, PLN02793, Probable polygalacturonase	4e-22
pfam00295		325	pfam00295, Glyco_hydro_28, Glycosyl hydrolases fam	6e-22
PLN03010		409	PLN03010, PLN03010, polygalacturonase	5e-19
PLN02218		431	PLN02218, PLN02218, polygalacturonase ADPG	7e-18
PLN03003		456	PLN03003, PLN03003, Probable polygalacturonase At3	5e-16
COG5434		542	COG5434, PGU1, Endopygalactorunase [Cell envelope	1e-05

>gnl\|CDD\|165802 PLN02155, PLN02155, polygalacturonase	Back alignment and domain information

 Score =  142 bits (359), Expect = 4e-42
 Identities = 67/149 (44%), Positives = 96/149 (64%), Gaps = 24/149 (16%)

Query: 1   MAINHCSDILIRNVKIIDPTNSPTTDGIQMQSSTGVTITSSSIMTGEPFV---------- 50
           M +N C+++++RNVK++ P NSP TDG  +Q STGVT T S++ TG+  V          
Sbjct: 171 MTLNGCTNVVVRNVKLVAPGNSPNTDGFHVQFSTGVTFTGSTVQTGDDCVAIGPGTRNFL 230

Query: 51  --------------NRLGDHLNEEGVQNVTVTSSSFTNTQNGVRIKLWARPRNGYARNIA 96
                           L   LNE+GV+NVTV+SS FT +QNGVRIK WARP  G+ RN+ 
Sbjct: 231 ITKLACGPGHGVSIGSLAKELNEDGVENVTVSSSVFTGSQNGVRIKSWARPSTGFVRNVF 290

Query: 97  FRNIIMNDIQNPIIIDRNYCSYNRGCPHQ 125
           F++++M +++NPIIID+NYC  + GCP++
Sbjct: 291 FQDLVMKNVENPIIIDQNYCPTHEGCPNE 319

Length = 394

>gnl\|CDD\|215120 PLN02188, PLN02188, polygalacturonase/glycoside hydrolase family protein	Back alignment and domain information

>gnl\|CDD\|215426 PLN02793, PLN02793, Probable polygalacturonase	Back alignment and domain information

>gnl\|CDD\|215843 pfam00295, Glyco_hydro_28, Glycosyl hydrolases family 28	Back alignment and domain information

>gnl\|CDD\|215540 PLN03010, PLN03010, polygalacturonase	Back alignment and domain information

>gnl\|CDD\|177865 PLN02218, PLN02218, polygalacturonase ADPG	Back alignment and domain information

>gnl\|CDD\|178580 PLN03003, PLN03003, Probable polygalacturonase At3g15720	Back alignment and domain information

>gnl\|CDD\|227721 COG5434, PGU1, Endopygalactorunase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		125
PLN02155		394	polygalacturonase	100.0
PLN02218		431	polygalacturonase ADPG	100.0
PLN02793		443	Probable polygalacturonase	100.0
PLN03010		409	polygalacturonase	100.0
PLN03003		456	Probable polygalacturonase At3g15720	100.0
PLN02188		404	polygalacturonase/glycoside hydrolase family prote	100.0
PF00295		326	Glyco_hydro_28: Glycosyl hydrolases family 28; Int	99.97
COG5434		542	PGU1 Endopygalactorunase [Cell envelope biogenesis	99.87
PF00295		326	Glyco_hydro_28: Glycosyl hydrolases family 28; Int	99.03
PLN03010		409	polygalacturonase	98.98
PLN02218		431	polygalacturonase ADPG	98.97
PLN02188		404	polygalacturonase/glycoside hydrolase family prote	98.94
PLN02793		443	Probable polygalacturonase	98.91
PLN03003		456	Probable polygalacturonase At3g15720	98.89
PLN02155		394	polygalacturonase	98.84
COG5434		542	PGU1 Endopygalactorunase [Cell envelope biogenesis	98.46
smart00656		190	Amb_all Amb_all domain.	98.24
PF03718		582	Glyco_hydro_49: Glycosyl hydrolase family 49; Inte	98.18
PF12541		277	DUF3737: Protein of unknown function (DUF3737) ; I	97.9
TIGR03805		314	beta_helix_1 parallel beta-helix repeat-containing	97.83
TIGR03805		314	beta_helix_1 parallel beta-helix repeat-containing	97.79
PF00544		200	Pec_lyase_C: Pectate lyase; InterPro: IPR002022 Pe	97.37
PF12541		277	DUF3737: Protein of unknown function (DUF3737) ; I	97.23
PF13229		158	Beta_helix: Right handed beta helix region; PDB: 2	97.02
PF12708		225	Pectate_lyase_3: Pectate lyase superfamily protein	96.96
PF13229		158	Beta_helix: Right handed beta helix region; PDB: 2	96.9
COG3866		345	PelB Pectate lyase [Carbohydrate transport and met	96.57
PF05048		236	NosD: Periplasmic copper-binding protein (NosD); I	96.36
PF05048		236	NosD: Periplasmic copper-binding protein (NosD); I	95.83
PF12708		225	Pectate_lyase_3: Pectate lyase superfamily protein	95.44
TIGR03808		455	RR_plus_rpt_1 twin-arg-translocated uncharacterize	94.89
PF09251		549	PhageP22-tail: Salmonella phage P22 tail-spike; In	93.88
PF07602		246	DUF1565: Protein of unknown function (DUF1565); In	92.67
smart00656		190	Amb_all Amb_all domain.	90.14
PF00544		200	Pec_lyase_C: Pectate lyase; InterPro: IPR002022 Pe	89.32
TIGR03808		455	RR_plus_rpt_1 twin-arg-translocated uncharacterize	89.24
TIGR03804		44	para_beta_helix parallel beta-helix repeat (two co	89.05

>PLN02155 polygalacturonase	Back alignment and domain information

Probab=100.00  E-value=1.7e-34  Score=234.28  Aligned_cols=124  Identities=53%  Similarity=1.016  Sum_probs=111.8

Q ss_pred             CeEEeeecEEEEeEEEECCCCCCCCCeEEecCcccEEEEeeEEeeCCCc------------------------eeeccCC
Q 040317            1 MAINHCSDILIRNVKIIDPTNSPTTDGIQMQSSTGVTITSSSIMTGEPF------------------------VNRLGDH   56 (125)
Q Consensus         1 ~~i~~c~nV~i~~i~I~~~~~~~ntDGid~~~s~nV~I~n~~i~~gDD~------------------------igs~G~~   56 (125)
                      |++.+|++|+|++++|.+|.++|||||||+.+|+||+|+||+|.+||||                        +||+|++
T Consensus       171 i~~~~~~nv~i~~v~I~~p~~~~NtDGidi~~s~nV~I~~~~I~~gDDcIaik~gs~nI~I~n~~c~~GhGisIGS~g~~  250 (394)
T PLN02155        171 MTLNGCTNVVVRNVKLVAPGNSPNTDGFHVQFSTGVTFTGSTVQTGDDCVAIGPGTRNFLITKLACGPGHGVSIGSLAKE  250 (394)
T ss_pred             EEEECeeeEEEEEEEEECCCCCCCCCccccccceeEEEEeeEEecCCceEEcCCCCceEEEEEEEEECCceEEecccccc
Confidence            5788999999999999999889999999999999999999999999999                        2345545


Q ss_pred             CCcCCeEEEEEEeeEecCCCceEEEEeecCCCCceEEeEEEEcEEEeccCccEEEEeeeCCCCCCCCC
Q 040317           57 LNEEGVQNVTVTSSSFTNTQNGVRIKLWARPRNGYARNIAFRNIIMNDIQNPIIIDRNYCSYNRGCPH  124 (125)
Q Consensus        57 ~~~~~i~nV~v~n~~~~~t~~gi~Ikt~~g~~~G~v~nI~~~ni~~~~v~~~i~i~~~y~~~~~~c~~  124 (125)
                      +..++|+||+|+||+|.++.+|+|||||+++++|+|+||+|+||+|+++++||+|+|+|++....|++
T Consensus       251 ~~~~~V~nV~v~n~~~~~t~~GirIKT~~~~~gG~v~nI~f~ni~m~~v~~pI~i~q~Y~~~~~~~~~  318 (394)
T PLN02155        251 LNEDGVENVTVSSSVFTGSQNGVRIKSWARPSTGFVRNVFFQDLVMKNVENPIIIDQNYCPTHEGCPN  318 (394)
T ss_pred             CCCCcEEEEEEEeeEEeCCCcEEEEEEecCCCCEEEEEEEEEeEEEcCccccEEEEecccCCCCCCcC
Confidence            44688999999999999999999999998667899999999999999999999999999886555753

>PLN02218 polygalacturonase ADPG	Back alignment and domain information

>PLN02793 Probable polygalacturonase	Back alignment and domain information

>PLN03010 polygalacturonase	Back alignment and domain information

>PLN03003 Probable polygalacturonase At3g15720	Back alignment and domain information

>PLN02188 polygalacturonase/glycoside hydrolase family protein	Back alignment and domain information

>PF00295 Glyco_hydro_28: Glycosyl hydrolases family 28; InterPro: IPR000743 O-Glycosyl hydrolases 3	Back alignment and domain information

>COG5434 PGU1 Endopygalactorunase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF00295 Glyco_hydro_28: Glycosyl hydrolases family 28; InterPro: IPR000743 O-Glycosyl hydrolases 3	Back alignment and domain information

>PLN03010 polygalacturonase	Back alignment and domain information

>PLN02218 polygalacturonase ADPG	Back alignment and domain information

>PLN02188 polygalacturonase/glycoside hydrolase family protein	Back alignment and domain information

>PLN02793 Probable polygalacturonase	Back alignment and domain information

>PLN03003 Probable polygalacturonase At3g15720	Back alignment and domain information

>PLN02155 polygalacturonase	Back alignment and domain information

>COG5434 PGU1 Endopygalactorunase [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>smart00656 Amb_all Amb_all domain	Back alignment and domain information

>PF03718 Glyco_hydro_49: Glycosyl hydrolase family 49; InterPro: IPR005192 O-Glycosyl hydrolases 3	Back alignment and domain information

>PF12541 DUF3737: Protein of unknown function (DUF3737) ; InterPro: IPR022208 This family of proteins is found in bacteria, archaea and eukaryotes	Back alignment and domain information

>TIGR03805 beta_helix_1 parallel beta-helix repeat-containing protein	Back alignment and domain information

>TIGR03805 beta_helix_1 parallel beta-helix repeat-containing protein	Back alignment and domain information

>PF00544 Pec_lyase_C: Pectate lyase; InterPro: IPR002022 Pectate lyase 4	Back alignment and domain information

>PF12541 DUF3737: Protein of unknown function (DUF3737) ; InterPro: IPR022208 This family of proteins is found in bacteria, archaea and eukaryotes	Back alignment and domain information

>PF13229 Beta_helix: Right handed beta helix region; PDB: 2INV_C 2INU_C 1RU4_A	Back alignment and domain information

>PF12708 Pectate_lyase_3: Pectate lyase superfamily protein; PDB: 3EQN_A 3EQO_A 2PYG_A 2PYH_A 3SUC_A 3GQ7_A 3GQ9_A 3GQA_A 3GQ8_A 2VBE_A	Back alignment and domain information

>PF13229 Beta_helix: Right handed beta helix region; PDB: 2INV_C 2INU_C 1RU4_A	Back alignment and domain information

>COG3866 PelB Pectate lyase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF05048 NosD: Periplasmic copper-binding protein (NosD); InterPro: IPR007742 Bacterial nitrous oxide (N(2)O) reductase is the terminal oxidoreductase of a respiratory process that generates dinitrogen from N(2)O	Back alignment and domain information

>PF05048 NosD: Periplasmic copper-binding protein (NosD); InterPro: IPR007742 Bacterial nitrous oxide (N(2)O) reductase is the terminal oxidoreductase of a respiratory process that generates dinitrogen from N(2)O	Back alignment and domain information

>PF12708 Pectate_lyase_3: Pectate lyase superfamily protein; PDB: 3EQN_A 3EQO_A 2PYG_A 2PYH_A 3SUC_A 3GQ7_A 3GQ9_A 3GQA_A 3GQ8_A 2VBE_A	Back alignment and domain information

>TIGR03808 RR_plus_rpt_1 twin-arg-translocated uncharacterized repeat protein	Back alignment and domain information

>PF09251 PhageP22-tail: Salmonella phage P22 tail-spike; InterPro: IPR015331 This entry is represented by the Bacteriophage P22, Gp9, tailspike protein (TSP)	Back alignment and domain information

>PF07602 DUF1565: Protein of unknown function (DUF1565); InterPro: IPR011459 These proteins share a region of homology in their N termini, and are found in several phylogenetically diverse bacteria and in the archaeon Methanosarcina acetivorans	Back alignment and domain information

>smart00656 Amb_all Amb_all domain	Back alignment and domain information

>PF00544 Pec_lyase_C: Pectate lyase; InterPro: IPR002022 Pectate lyase 4	Back alignment and domain information

>TIGR03808 RR_plus_rpt_1 twin-arg-translocated uncharacterized repeat protein	Back alignment and domain information

>TIGR03804 para_beta_helix parallel beta-helix repeat (two copies)	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		125
1bhe_A		376	PEHA, polygalacturonase; family 28 glycosyl hydrol	1e-30
1ia5_A		339	Polygalacturonase; glycosylhydrolase, hydrolase; H	6e-25
2iq7_A		339	Endopolygalacturonase; parallel beta helix, hydrol	5e-24
1k5c_A		335	Endopolygalacturonase; beta helical structure, gly	4e-23
1nhc_A		336	Polygalacturonase I; beta-helix, hydrolase; HET: M	5e-23
1czf_A		362	Polygalacturonase II; beta helix, hydrolase; HET:	6e-23
1rmg_A		422	Rgase A, rhamnogalacturonase A; hydrolase, inverti	1e-22
3jur_A		448	EXO-poly-alpha-D-galacturonosidase; beta-helix, ce	5e-22
2uvf_A		608	Exopolygalacturonase; GH28, pectin, cell WALL, hyd	4e-21
1hg8_A		349	Endopolygalacturonase; hydrolase, pectin degradati	7e-21
1h80_A		464	IOTA-carrageenase; hydrolase, IOTA-carrageenan dou	1e-07
3gqn_A		772	Preneck appendage protein; beta helix, beta barrel	2e-07
3gq8_A		609	Preneck appendage protein; beta helix, viral prote	1e-06

>1bhe_A PEHA, polygalacturonase; family 28 glycosyl hydrolase, hydrolyses polygalacturonic acid, glycosidase; 1.90A {Pectobacterium carotovorum subsp} SCOP: b.80.1.3 Length = 376	Back alignment and structure

 Score =  111 bits (279), Expect = 1e-30
 Identities = 36/146 (24%), Positives = 52/146 (35%), Gaps = 25/146 (17%)

Query: 1   MAINHCSDILIRNVKIIDPTNSPTTDGIQMQSSTGVTITSSSIMTG------------EP 48
           +  +           I  P+ +  TDGI   SS  +TI  S+I TG              
Sbjct: 177 VVFSDGDGFTAWKTTIKTPSTARNTDGIDPMSSKNITIAYSNIATGDDNVAIKAYKGRAE 236

Query: 49  FVNRLGDHLN------------EEGVQNVTVTSSSFTNTQNGVRIKLWARPRNGYARNIA 96
             N    H +              GV NVTV       T NG+RIK   +   G    + 
Sbjct: 237 TRNISILHNDFGTGHGMSIGSETMGVYNVTVDDLKMNGTTNGLRIKSD-KSAAGVVNGVR 295

Query: 97  FRNIIMNDIQNPIIIDRNYCSYNRGC 122
           + N++M ++  PI+ID  Y       
Sbjct: 296 YSNVVMKNVAKPIVIDTVYEKKEGSN 321

PyMOL of 1bhe

>1ia5_A Polygalacturonase; glycosylhydrolase, hydrolase; HET: MAN NAG; 2.00A {Aspergillus aculeatus} SCOP: b.80.1.3 PDB: 1ib4_A* Length = 339	Back alignment and structure

>2iq7_A Endopolygalacturonase; parallel beta helix, hydrolase; HET: NAG MAN PG4; 1.94A {Colletotrichum lupini} Length = 339	Back alignment and structure

>1k5c_A Endopolygalacturonase; beta helical structure, glycoside hydrolase, silver-LEAF IND substance, hydrolase; HET: NAG; 0.96A {Chondrostereum purpureum} SCOP: b.80.1.3 PDB: 1kcc_A* 1kcd_A* Length = 335	Back alignment and structure

>1nhc_A Polygalacturonase I; beta-helix, hydrolase; HET: MAN NAG BMA; 1.70A {Aspergillus niger} SCOP: b.80.1.3 Length = 336	Back alignment and structure

>1czf_A Polygalacturonase II; beta helix, hydrolase; HET: NAG; 1.68A {Aspergillus niger} SCOP: b.80.1.3 Length = 362	Back alignment and structure

>1rmg_A Rgase A, rhamnogalacturonase A; hydrolase, inverting, parallel beta-helix, glycosidase; HET: NAG BMA MAN GLC; 2.00A {Aspergillus aculeatus} SCOP: b.80.1.3 Length = 422	Back alignment and structure

>3jur_A EXO-poly-alpha-D-galacturonosidase; beta-helix, cell WALL biogenesis/degradation, glycosidase; 2.05A {Thermotoga maritima} Length = 448	Back alignment and structure

>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Length = 608	Back alignment and structure

>1hg8_A Endopolygalacturonase; hydrolase, pectin degradation; HET: NAG; 1.73A {Fusarium moniliforme} SCOP: b.80.1.3 Length = 349	Back alignment and structure

>1h80_A IOTA-carrageenase; hydrolase, IOTA-carrageenan double helix degradation; 1.6A {Alteromonas SP} SCOP: b.80.1.8 PDB: 1ktw_A* 3lmw_A Length = 464	Back alignment and structure

>3gq8_A Preneck appendage protein; beta helix, viral protein; HET: NHE; 2.00A {Bacillus phage PHI29} PDB: 3gq7_A* 3gq9_A* 3gqa_A Length = 609	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		125
1bhe_A		376	PEHA, polygalacturonase; family 28 glycosyl hydrol	99.97
2iq7_A		339	Endopolygalacturonase; parallel beta helix, hydrol	99.96
1ia5_A		339	Polygalacturonase; glycosylhydrolase, hydrolase; H	99.96
1nhc_A		336	Polygalacturonase I; beta-helix, hydrolase; HET: M	99.96
1czf_A		362	Polygalacturonase II; beta helix, hydrolase; HET:	99.96
1k5c_A		335	Endopolygalacturonase; beta helical structure, gly	99.96
1hg8_A		349	Endopolygalacturonase; hydrolase, pectin degradati	99.96
3jur_A		448	EXO-poly-alpha-D-galacturonosidase; beta-helix, ce	99.95
2uvf_A		608	Exopolygalacturonase; GH28, pectin, cell WALL, hyd	99.94
1rmg_A		422	Rgase A, rhamnogalacturonase A; hydrolase, inverti	99.93
1h80_A		464	IOTA-carrageenase; hydrolase, IOTA-carrageenan dou	99.73
2x6w_A		600	Tail spike protein; viral protein, beta-helix, hyd	99.73
1x0c_A		549	Isopullulanase; glycoside hydrolase family 49, gly	99.71
1ogo_X		574	Dextranase; hydrolase, dextran degradation, glycos	99.67
1h80_A		464	IOTA-carrageenase; hydrolase, IOTA-carrageenan dou	99.63
3gq8_A		609	Preneck appendage protein; beta helix, viral prote	99.56
3gqn_A		772	Preneck appendage protein; beta helix, beta barrel	99.55
1rmg_A		422	Rgase A, rhamnogalacturonase A; hydrolase, inverti	99.32
1czf_A		362	Polygalacturonase II; beta helix, hydrolase; HET:	99.25
1ia5_A		339	Polygalacturonase; glycosylhydrolase, hydrolase; H	99.18
2iq7_A		339	Endopolygalacturonase; parallel beta helix, hydrol	99.16
1k5c_A		335	Endopolygalacturonase; beta helical structure, gly	99.12
1nhc_A		336	Polygalacturonase I; beta-helix, hydrolase; HET: M	99.12
2uvf_A		608	Exopolygalacturonase; GH28, pectin, cell WALL, hyd	99.03
1hg8_A		349	Endopolygalacturonase; hydrolase, pectin degradati	98.99
3jur_A		448	EXO-poly-alpha-D-galacturonosidase; beta-helix, ce	98.92
1bhe_A		376	PEHA, polygalacturonase; family 28 glycosyl hydrol	98.9
2vbk_A		514	Tailspike-protein; viral adhesion protein, viral p	98.59
1ogo_X		574	Dextranase; hydrolase, dextran degradation, glycos	98.54
1x0c_A		549	Isopullulanase; glycoside hydrolase family 49, gly	98.45
2pyg_A		377	Poly(beta-D-mannuronate) C5 epimerase 4; beta-heli	98.38
1pxz_A		346	Major pollen allergen JUN A 1; parallel beta-helix	98.09
1air_A		353	Pectate lyase C, PELC; pectate cleavage, pectinoly	97.95
1pcl_A		355	Pectate lyase E; lyase (acting on polysaccharides)	97.85
3zsc_A		340	Pectate trisaccharide-lyase; hydrolase; HET: ADA A	97.8
2pyg_A		377	Poly(beta-D-mannuronate) C5 epimerase 4; beta-heli	97.67
2qy1_A		330	Pectate lyase II; GAG lyase; 1.90A {Xanthomonas ca	97.62
3vmv_A		326	Pectate lyase; polysaccharide lyase family 1, beta	97.6
1vbl_A		416	Pectate lyase 47; PL 47, thermostable, bacillus su	97.5
3eqn_A		758	Glucan 1,3-beta-glucosidase; tandem beta-helix dom	97.48
2x6w_A		600	Tail spike protein; viral protein, beta-helix, hyd	97.46
1idk_A		359	Pectin lyase A; signal, glycoprotein, multigene fa	97.43
3gq8_A		609	Preneck appendage protein; beta helix, viral prote	97.35
2o04_A		399	Pectate lyase, PL; hexasaccharide compound II, cal	97.31
1qcx_A		359	Pectin lyase B; beta-helix protein, plant cell WAL	97.17
3gqn_A		772	Preneck appendage protein; beta helix, beta barrel	96.97
1pe9_A		361	Pectate lyase A; parallel beta helix; 1.60A {Erwin	96.96
3eqn_A		758	Glucan 1,3-beta-glucosidase; tandem beta-helix dom	95.21
3riq_A		543	Tailspike protein; right handed beta-helix, endorh	93.93
1pxz_A		346	Major pollen allergen JUN A 1; parallel beta-helix	93.86
3zsc_A		340	Pectate trisaccharide-lyase; hydrolase; HET: ADA A	93.17
2vfm_A		559	Bifunctional tail protein; P22 tailspike protein,	92.62
2v5i_A		559	Salmonella typhimurium DB7155 bacteriophage DET7 t	92.44
1ru4_A		400	Pectate lyase, PEL9A; parallel beta-helix; 1.60A {	92.44
2xc1_A		666	Bifunctional tail protein; hydrolase, endoglycosid	91.47
1air_A		353	Pectate lyase C, PELC; pectate cleavage, pectinoly	91.15
2qy1_A		330	Pectate lyase II; GAG lyase; 1.90A {Xanthomonas ca	91.15
1pcl_A		355	Pectate lyase E; lyase (acting on polysaccharides)	90.03
1vbl_A		416	Pectate lyase 47; PL 47, thermostable, bacillus su	89.49
3t9g_A		196	Pectate lyase; PL3, parallel beta-helix; HET: GOL;	88.88
1idk_A		359	Pectin lyase A; signal, glycoprotein, multigene fa	87.78
2o04_A		399	Pectate lyase, PL; hexasaccharide compound II, cal	87.03
1pe9_A		361	Pectate lyase A; parallel beta helix; 1.60A {Erwin	85.86
2inu_A		410	Insulin fructotransferase; right-handed parallel b	84.72
3vmv_A		326	Pectate lyase; polysaccharide lyase family 1, beta	84.15
1qcx_A		359	Pectin lyase B; beta-helix protein, plant cell WAL	83.88

>1bhe_A PEHA, polygalacturonase; family 28 glycosyl hydrolase, hydrolyses polygalacturonic acid, glycosidase; 1.90A {Pectobacterium carotovorum subsp} SCOP: b.80.1.3	Back alignment and structure

Probab=99.97  E-value=5e-30  Score=205.25  Aligned_cols=115  Identities=31%  Similarity=0.480  Sum_probs=105.3

Q ss_pred             CeEEeeecEEEEeEEEECCCCCCCCCeEEecCcccEEEEeeEEeeCCCce-------------------------e-ecc
Q 040317            1 MAINHCSDILIRNVKIIDPTNSPTTDGIQMQSSTGVTITSSSIMTGEPFV-------------------------N-RLG   54 (125)
Q Consensus         1 ~~i~~c~nV~i~~i~I~~~~~~~ntDGid~~~s~nV~I~n~~i~~gDD~i-------------------------g-s~G   54 (125)
                      +++..|++|+|++++|.++..+||+||||+.+|+||+|+||+|.+||||+                         | ++|
T Consensus       177 i~~~~~~~v~i~~v~I~~~~~~~NtDGid~~~s~nV~I~n~~i~~gDDcIaiks~~~~~~s~nI~I~n~~~~~ghGisiG  256 (376)
T 1bhe_A          177 VVFSDGDGFTAWKTTIKTPSTARNTDGIDPMSSKNITIAYSNIATGDDNVAIKAYKGRAETRNISILHNDFGTGHGMSIG  256 (376)
T ss_dssp             EEEESCEEEEEEEEEEECCTTCSSCCSEEEESCEEEEEESCEEECSSCSEEEEECTTSCCEEEEEEEEEEECSSSCEEEE
T ss_pred             EEEeCCCcEEEEeEEEECCCCCCCCceEeecCCceEEEEeCEEecCCCeEEEcccCCCCCceEEEEEeeEEEccccEEec
Confidence            35778999999999999988889999999999999999999999999993                         1 467


Q ss_pred             CCCCcCCeEEEEEEeeEecCCCceEEEEeecCCCCceEEeEEEEcEEEeccCccEEEEeeeCCC
Q 040317           55 DHLNEEGVQNVTVTSSSFTNTQNGVRIKLWARPRNGYARNIAFRNIIMNDIQNPIIIDRNYCSY  118 (125)
Q Consensus        55 ~~~~~~~i~nV~v~n~~~~~t~~gi~Ikt~~g~~~G~v~nI~~~ni~~~~v~~~i~i~~~y~~~  118 (125)
                      +++ . .++||+|+||+|.++.+|+|||||++ ++|.|+||+|+||+|+++++||+|+|+|+++
T Consensus       257 Se~-~-~v~nV~v~n~~~~~t~~GirIKt~~g-~~G~v~ni~f~ni~~~~v~~~i~i~~~y~~~  317 (376)
T 1bhe_A          257 SET-M-GVYNVTVDDLKMNGTTNGLRIKSDKS-AAGVVNGVRYSNVVMKNVAKPIVIDTVYEKK  317 (376)
T ss_dssp             EEE-S-SEEEEEEEEEEEESCSEEEEEECCTT-TCCEEEEEEEEEEEEESCSEEEEEETTSSCC
T ss_pred             cCC-c-cEeeEEEEeeEEeCCCcEEEEEEecC-CCceEeeEEEEeEEEeCCCceEEEEeeccCC
Confidence            665 3 89999999999999999999999997 7899999999999999999999999999874

PyMOL of 1bhe

>2iq7_A Endopolygalacturonase; parallel beta helix, hydrolase; HET: NAG MAN PG4; 1.94A {Colletotrichum lupini}	Back alignment and structure

>1ia5_A Polygalacturonase; glycosylhydrolase, hydrolase; HET: MAN NAG; 2.00A {Aspergillus aculeatus} SCOP: b.80.1.3 PDB: 1ib4_A*	Back alignment and structure

>1nhc_A Polygalacturonase I; beta-helix, hydrolase; HET: MAN NAG BMA; 1.70A {Aspergillus niger} SCOP: b.80.1.3	Back alignment and structure

>1czf_A Polygalacturonase II; beta helix, hydrolase; HET: NAG; 1.68A {Aspergillus niger} SCOP: b.80.1.3	Back alignment and structure

>1k5c_A Endopolygalacturonase; beta helical structure, glycoside hydrolase, silver-LEAF IND substance, hydrolase; HET: NAG; 0.96A {Chondrostereum purpureum} SCOP: b.80.1.3 PDB: 1kcc_A* 1kcd_A*	Back alignment and structure

>1hg8_A Endopolygalacturonase; hydrolase, pectin degradation; HET: NAG; 1.73A {Fusarium moniliforme} SCOP: b.80.1.3	Back alignment and structure

>3jur_A EXO-poly-alpha-D-galacturonosidase; beta-helix, cell WALL biogenesis/degradation, glycosidase; 2.05A {Thermotoga maritima}	Back alignment and structure

>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A*	Back alignment and structure

>1rmg_A Rgase A, rhamnogalacturonase A; hydrolase, inverting, parallel beta-helix, glycosidase; HET: NAG BMA MAN GLC; 2.00A {Aspergillus aculeatus} SCOP: b.80.1.3	Back alignment and structure

>1h80_A IOTA-carrageenase; hydrolase, IOTA-carrageenan double helix degradation; 1.6A {Alteromonas SP} SCOP: b.80.1.8 PDB: 1ktw_A* 3lmw_A	Back alignment and structure

>2x6w_A Tail spike protein; viral protein, beta-helix, hydrolase; HET: RAM GLC GLA NAG NDG; 1.35A {Enterobacteria phage HK620} PDB: 2vji_A 2vjj_A* 2x85_A* 2x6x_A* 2x6y_A*	Back alignment and structure

>1x0c_A Isopullulanase; glycoside hydrolase family 49, glycoprotein, hydro; HET: NAG; 1.70A {Aspergillus niger} PDB: 1wmr_A* 2z8g_A*	Back alignment and structure

>1ogo_X Dextranase; hydrolase, dextran degradation, glycosidase; HET: BGC GLC; 1.65A {Penicillium minioluteum} SCOP: b.133.1.1 b.80.1.10 PDB: 1ogm_X*	Back alignment and structure

>1h80_A IOTA-carrageenase; hydrolase, IOTA-carrageenan double helix degradation; 1.6A {Alteromonas SP} SCOP: b.80.1.8 PDB: 1ktw_A* 3lmw_A	Back alignment and structure

>3gq8_A Preneck appendage protein; beta helix, viral protein; HET: NHE; 2.00A {Bacillus phage PHI29} PDB: 3gq7_A* 3gq9_A* 3gqa_A	Back alignment and structure

>1rmg_A Rgase A, rhamnogalacturonase A; hydrolase, inverting, parallel beta-helix, glycosidase; HET: NAG BMA MAN GLC; 2.00A {Aspergillus aculeatus} SCOP: b.80.1.3	Back alignment and structure

>1czf_A Polygalacturonase II; beta helix, hydrolase; HET: NAG; 1.68A {Aspergillus niger} SCOP: b.80.1.3	Back alignment and structure

>1ia5_A Polygalacturonase; glycosylhydrolase, hydrolase; HET: MAN NAG; 2.00A {Aspergillus aculeatus} SCOP: b.80.1.3 PDB: 1ib4_A*	Back alignment and structure

>2iq7_A Endopolygalacturonase; parallel beta helix, hydrolase; HET: NAG MAN PG4; 1.94A {Colletotrichum lupini}	Back alignment and structure

>1k5c_A Endopolygalacturonase; beta helical structure, glycoside hydrolase, silver-LEAF IND substance, hydrolase; HET: NAG; 0.96A {Chondrostereum purpureum} SCOP: b.80.1.3 PDB: 1kcc_A* 1kcd_A*	Back alignment and structure

>1nhc_A Polygalacturonase I; beta-helix, hydrolase; HET: MAN NAG BMA; 1.70A {Aspergillus niger} SCOP: b.80.1.3	Back alignment and structure

>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A*	Back alignment and structure

>1hg8_A Endopolygalacturonase; hydrolase, pectin degradation; HET: NAG; 1.73A {Fusarium moniliforme} SCOP: b.80.1.3	Back alignment and structure

>3jur_A EXO-poly-alpha-D-galacturonosidase; beta-helix, cell WALL biogenesis/degradation, glycosidase; 2.05A {Thermotoga maritima}	Back alignment and structure

>1bhe_A PEHA, polygalacturonase; family 28 glycosyl hydrolase, hydrolyses polygalacturonic acid, glycosidase; 1.90A {Pectobacterium carotovorum subsp} SCOP: b.80.1.3	Back alignment and structure

>2vbk_A Tailspike-protein; viral adhesion protein, viral protein, hydrolase, endorhamnosidase, right-handed parallel beta-helix; 1.25A {Enterobacteria phage SF6} PDB: 2vbe_A 2vbm_A*	Back alignment and structure

>1ogo_X Dextranase; hydrolase, dextran degradation, glycosidase; HET: BGC GLC; 1.65A {Penicillium minioluteum} SCOP: b.133.1.1 b.80.1.10 PDB: 1ogm_X*	Back alignment and structure

>1x0c_A Isopullulanase; glycoside hydrolase family 49, glycoprotein, hydro; HET: NAG; 1.70A {Aspergillus niger} PDB: 1wmr_A* 2z8g_A*	Back alignment and structure

>2pyg_A Poly(beta-D-mannuronate) C5 epimerase 4; beta-helix, isomerase; 2.10A {Azotobacter vinelandii} PDB: 2pyh_A*	Back alignment and structure

>1pxz_A Major pollen allergen JUN A 1; parallel beta-helix, cedar pollen; 1.70A {Juniperus ashei} SCOP: b.80.1.1	Back alignment and structure

>1air_A Pectate lyase C, PELC; pectate cleavage, pectinolyitc activity, trans-elimination; 2.20A {Erwinia chrysanthemi} SCOP: b.80.1.1 PDB: 1o88_A 1o8d_A 1o8e_A 1o8f_A 1o8g_A 1o8h_A 1o8i_A 1o8j_A 1o8k_A 1o8l_A 1o8m_A 1plu_A 2pec_A 2ewe_A*	Back alignment and structure

>1pcl_A Pectate lyase E; lyase (acting on polysaccharides); 2.20A {Erwinia chrysanthemi} SCOP: b.80.1.1	Back alignment and structure

>3zsc_A Pectate trisaccharide-lyase; hydrolase; HET: ADA AQA; 1.94A {Thermotoga maritima}	Back alignment and structure

>2pyg_A Poly(beta-D-mannuronate) C5 epimerase 4; beta-helix, isomerase; 2.10A {Azotobacter vinelandii} PDB: 2pyh_A*	Back alignment and structure

>2qy1_A Pectate lyase II; GAG lyase; 1.90A {Xanthomonas campestris PV} PDB: 2qxz_A 2qx3_A	Back alignment and structure

>3vmv_A Pectate lyase; polysaccharide lyase family 1, beta-helix, pectolytic, polygalacturonate; 1.54A {Bacillus} PDB: 3vmw_A*	Back alignment and structure

>1vbl_A Pectate lyase 47; PL 47, thermostable, bacillus subtilis, pectin, calcium ION; 1.91A {Bacillus SP}	Back alignment and structure

>3eqn_A Glucan 1,3-beta-glucosidase; tandem beta-helix domains, glycosidase, hydrolase; HET: NAG BMA; 1.70A {Phanerochaete chrysosporium} PDB: 3eqo_A*	Back alignment and structure

>2x6w_A Tail spike protein; viral protein, beta-helix, hydrolase; HET: RAM GLC GLA NAG NDG; 1.35A {Enterobacteria phage HK620} PDB: 2vji_A 2vjj_A* 2x85_A* 2x6x_A* 2x6y_A*	Back alignment and structure

>1idk_A Pectin lyase A; signal, glycoprotein, multigene family; 1.93A {Aspergillus niger} SCOP: b.80.1.2 PDB: 1idj_A	Back alignment and structure

>3gq8_A Preneck appendage protein; beta helix, viral protein; HET: NHE; 2.00A {Bacillus phage PHI29} PDB: 3gq7_A* 3gq9_A* 3gqa_A	Back alignment and structure

>2o04_A Pectate lyase, PL; hexasaccharide compound II, calciums; HET: ADA; 1.70A {Bacillus subtilis} PDB: 2nzm_A* 2o0v_A* 2o0w_A 2o17_A* 2o1d_A* 2bsp_A 1bn8_A 3krg_A*	Back alignment and structure

>1qcx_A Pectin lyase B; beta-helix protein, plant cell WALL; 1.70A {Aspergillus niger} SCOP: b.80.1.2	Back alignment and structure

>1pe9_A Pectate lyase A; parallel beta helix; 1.60A {Erwinia chrysanthemi} SCOP: b.80.1.1 PDB: 1ooc_A 1jta_A 1jrg_A	Back alignment and structure

>3eqn_A Glucan 1,3-beta-glucosidase; tandem beta-helix domains, glycosidase, hydrolase; HET: NAG BMA; 1.70A {Phanerochaete chrysosporium} PDB: 3eqo_A*	Back alignment and structure

>3riq_A Tailspike protein; right handed beta-helix, endorhamnosidase, lipopolysaccharide, viral protein; 1.50A {Siphovirus 9na}	Back alignment and structure

>1pxz_A Major pollen allergen JUN A 1; parallel beta-helix, cedar pollen; 1.70A {Juniperus ashei} SCOP: b.80.1.1	Back alignment and structure

>3zsc_A Pectate trisaccharide-lyase; hydrolase; HET: ADA AQA; 1.94A {Thermotoga maritima}	Back alignment and structure

>2vfm_A Bifunctional tail protein; P22 tailspike protein, salmonella bacteriophage P22, protein folding, protein stability; 1.50A {Enterobacteria phage P22} PDB: 2vfp_A 2vfo_A 2vfq_A 2vfn_A 1tsp_A 1qrb_A 1qq1_A 1qrc_A 1tyu_A* 1tyv_A 1tyw_A* 1tyx_A* 1qa2_A 1clw_A 1qa3_A 1qa1_A	Back alignment and structure

>2v5i_A Salmonella typhimurium DB7155 bacteriophage DET7 tailspike; O-antigen binding and hydrolysis, beta-helix, viral protein; 1.60A {Bacteriophage}	Back alignment and structure

>1ru4_A Pectate lyase, PEL9A; parallel beta-helix; 1.60A {Erwinia chrysanthemi} SCOP: b.80.1.9	Back alignment and structure

>2xc1_A Bifunctional tail protein; hydrolase, endoglycosidase, salmonella phage P22; HET: PE4; 1.65A {Enterobacteria phage P22} PDB: 1lkt_A	Back alignment and structure

>1air_A Pectate lyase C, PELC; pectate cleavage, pectinolyitc activity, trans-elimination; 2.20A {Erwinia chrysanthemi} SCOP: b.80.1.1 PDB: 1o88_A 1o8d_A 1o8e_A 1o8f_A 1o8g_A 1o8h_A 1o8i_A 1o8j_A 1o8k_A 1o8l_A 1o8m_A 1plu_A 2pec_A 2ewe_A*	Back alignment and structure

>2qy1_A Pectate lyase II; GAG lyase; 1.90A {Xanthomonas campestris PV} PDB: 2qxz_A 2qx3_A	Back alignment and structure

>1pcl_A Pectate lyase E; lyase (acting on polysaccharides); 2.20A {Erwinia chrysanthemi} SCOP: b.80.1.1	Back alignment and structure

>1vbl_A Pectate lyase 47; PL 47, thermostable, bacillus subtilis, pectin, calcium ION; 1.91A {Bacillus SP}	Back alignment and structure

>3t9g_A Pectate lyase; PL3, parallel beta-helix; HET: GOL; 1.50A {Caldicellulosiruptor bescii}	Back alignment and structure

>1idk_A Pectin lyase A; signal, glycoprotein, multigene family; 1.93A {Aspergillus niger} SCOP: b.80.1.2 PDB: 1idj_A	Back alignment and structure

>2o04_A Pectate lyase, PL; hexasaccharide compound II, calciums; HET: ADA; 1.70A {Bacillus subtilis} PDB: 2nzm_A* 2o0v_A* 2o0w_A 2o17_A* 2o1d_A* 2bsp_A 1bn8_A 3krg_A*	Back alignment and structure

>1pe9_A Pectate lyase A; parallel beta helix; 1.60A {Erwinia chrysanthemi} SCOP: b.80.1.1 PDB: 1ooc_A 1jta_A 1jrg_A	Back alignment and structure

>2inu_A Insulin fructotransferase; right-handed parallel beta-helix, lyase; 1.80A {Bacillus SP} PDB: 2inv_A*	Back alignment and structure

>3vmv_A Pectate lyase; polysaccharide lyase family 1, beta-helix, pectolytic, polygalacturonate; 1.54A {Bacillus} PDB: 3vmw_A*	Back alignment and structure

>1qcx_A Pectin lyase B; beta-helix protein, plant cell WALL; 1.70A {Aspergillus niger} SCOP: b.80.1.2	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		125
d1k5ca_		333	b.80.1.3 (A:) Polygalacturonase {Fungus (Stereum p	1e-18
d1rmga_		422	b.80.1.3 (A:) Rhamnogalacturonase A {Aspergillus a	7e-15
d1bhea_		376	b.80.1.3 (A:) Polygalacturonase {Erwinia carotovor	9e-13
d1czfa_		335	b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergill	1e-12
d1ogmx2		373	b.80.1.10 (X:202-574) Dextranase, catalytic domain	2e-12
d1ia5a_		339	b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergill	5e-12
d1hg8a_		349	b.80.1.3 (A:) Polygalacturonase {Fusarium monilifo	5e-11
d1nhca_		336	b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergill	3e-09

>d1k5ca_ b.80.1.3 (A:) Polygalacturonase {Fungus (Stereum purpureum), endo-polygalacturonase I [TaxId: 58369]} Length = 333	Back information, alignment and structure


class: All beta proteins
fold: Single-stranded right-handed beta-helix
superfamily: Pectin lyase-like
family: Galacturonase
domain: Polygalacturonase
species: Fungus (Stereum purpureum), endo-polygalacturonase I [TaxId: 58369]

 Score = 77.3 bits (190), Expect = 1e-18
 Identities = 23/139 (16%), Positives = 48/139 (34%), Gaps = 23/139 (16%)

Query: 6   CSDILIRNVKIIDPTNSPTTDGIQMQSSTGVTITSSSIMTGEPFV--------------- 50
              I + +           TDG  + S+  VTI +  +   +  +               
Sbjct: 131 LDGITVDDFAGDTKNLGHNTDGFDV-SANNVTIQNCIVKNQDDCIAINDGNNIRFENNQC 189

Query: 51  -----NRLGDHLNEEGVQNVTVTSSSFTNTQNGVRIKLWARPRNGYARNIAFRNIIMNDI 105
                  +G     + V NV +  ++ T +  GVRIK      +     + +    ++ I
Sbjct: 190 SGGHGISIGSIATGKHVSNVVIKGNTVTRSMYGVRIKAQRTATSASVSGVTYDANTISGI 249

Query: 106 -QNPIIIDRNYCSYNRGCP 123
            +  ++I ++Y   + G P
Sbjct: 250 AKYGVLISQSYPD-DVGNP 267

PyMOL of d1k5ca_

>d1rmga_ b.80.1.3 (A:) Rhamnogalacturonase A {Aspergillus aculeatus [TaxId: 5053]} Length = 422	Back information, alignment and structure

>d1bhea_ b.80.1.3 (A:) Polygalacturonase {Erwinia carotovora, subsp. carotovora [TaxId: 554]} Length = 376	Back information, alignment and structure

>d1czfa_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase II [TaxId: 5061]} Length = 335	Back information, alignment and structure

>d1ogmx2 b.80.1.10 (X:202-574) Dextranase, catalytic domain {Penicillium minioluteum [TaxId: 28574]} Length = 373	Back information, alignment and structure

>d1ia5a_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Length = 339	Back information, alignment and structure

>d1hg8a_ b.80.1.3 (A:) Polygalacturonase {Fusarium moniliforme [TaxId: 117187]} Length = 349	Back information, alignment and structure

>d1nhca_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase I [TaxId: 5061]} Length = 336	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		125
d1ia5a_		339	Polygalacturonase {Fungus (Aspergillus aculeatus)	100.0
d1hg8a_		349	Polygalacturonase {Fusarium moniliforme [TaxId: 11	99.97
d1czfa_		335	Polygalacturonase {Fungus (Aspergillus niger), end	99.97
d1nhca_		336	Polygalacturonase {Fungus (Aspergillus niger), end	99.97
d1k5ca_		333	Polygalacturonase {Fungus (Stereum purpureum), end	99.97
d1bhea_		376	Polygalacturonase {Erwinia carotovora, subsp. caro	99.95
d1rmga_		422	Rhamnogalacturonase A {Aspergillus aculeatus [TaxI	99.93
d1ogmx2		373	Dextranase, catalytic domain {Penicillium miniolut	99.79
d1ia5a_		339	Polygalacturonase {Fungus (Aspergillus aculeatus)	99.01
d1hg8a_		349	Polygalacturonase {Fusarium moniliforme [TaxId: 11	98.93
d1bhea_		376	Polygalacturonase {Erwinia carotovora, subsp. caro	98.93
d1nhca_		336	Polygalacturonase {Fungus (Aspergillus niger), end	98.91
d1czfa_		335	Polygalacturonase {Fungus (Aspergillus niger), end	98.9
d1rmga_		422	Rhamnogalacturonase A {Aspergillus aculeatus [TaxI	98.74
d1k5ca_		333	Polygalacturonase {Fungus (Stereum purpureum), end	98.45
d1o88a_		353	Pectate lyase {Erwinia chrysanthemi, type C [TaxId	98.38
d1ogmx2		373	Dextranase, catalytic domain {Penicillium miniolut	98.3
d1pxza_		346	Major pollen allergen Jun a 1 {Ozark white cedar (	97.14
d1pcla_		355	Pectate lyase {Erwinia chrysanthemi, type E [TaxId	97.12
d1qcxa_		359	Pectin lyase {Aspergillus niger, type B [TaxId: 50	96.9
d1bn8a_		399	Pectate lyase {Bacillus subtilis [TaxId: 1423]}	96.84
d1idka_		359	Pectin lyase {Aspergillus niger, type A [TaxId: 50	96.77
d1pe9a_		361	Pectate lyase {Erwinia chrysanthemi, type A [TaxId	95.96
d1tywa_		554	P22 tailspike protein {Salmonella phage P22 [TaxId	92.86
d1pxza_		346	Major pollen allergen Jun a 1 {Ozark white cedar (	90.58
d1o88a_		353	Pectate lyase {Erwinia chrysanthemi, type C [TaxId	85.87

>d1ia5a_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus aculeatus) [TaxId: 5053]}	Back information, alignment and structure

class: All beta proteins
fold: Single-stranded right-handed beta-helix
superfamily: Pectin lyase-like
family: Galacturonase
domain: Polygalacturonase
species: Fungus (Aspergillus aculeatus) [TaxId: 5053]

Probab=100.00  E-value=1.9e-32  Score=215.65  Aligned_cols=117  Identities=23%  Similarity=0.453  Sum_probs=106.3

Q ss_pred             CeEEeeecEEEEeEEEECCC----CCCCCCeEEecCcccEEEEeeEEeeCCCc-----------------------eeec
Q 040317            1 MAINHCSDILIRNVKIIDPT----NSPTTDGIQMQSSTGVTITSSSIMTGEPF-----------------------VNRL   53 (125)
Q Consensus         1 ~~i~~c~nV~i~~i~I~~~~----~~~ntDGid~~~s~nV~I~n~~i~~gDD~-----------------------igs~   53 (125)
                      |++.+|++|+|+|++|.++.    .+||+||||+.+|+||+|+||+|.+||||                       +|++
T Consensus       130 ~~~~~s~nv~i~~v~I~~~~~~~~~~~NtDGidi~~s~nV~I~n~~i~~gDDcIaiks~~ni~i~n~~c~~ghG~sigsl  209 (339)
T d1ia5a_         130 FSVAGSDYLTLKDITIDNSDGDDNGGHNTDAFDIGTSTYVTISGATVYNQDDCVAVNSGENIYFSGGYCSGGHGLSIGSV  209 (339)
T ss_dssp             EEEESCEEEEEESCEEECGGGTTTTCCSCCSEEEESCEEEEEESCEEECSSCSEEESSEEEEEEESCEEESSSCEEEEEE
T ss_pred             EEEecccEEEEEEEEEecccCCccCCCCCCccccCCCCeEEEeeeEEEcCCCeEEecCccEEEEEEeEEeccccceeccc
Confidence            47889999999999999874    36899999999999999999999999999                       3478


Q ss_pred             cCCCCcCCeEEEEEEeeEecCCCceEEEEeecCCCCceEEeEEEEcEEEecc-CccEEEEeeeCCCC
Q 040317           54 GDHLNEEGVQNVTVTSSSFTNTQNGVRIKLWARPRNGYARNIAFRNIIMNDI-QNPIIIDRNYCSYN  119 (125)
Q Consensus        54 G~~~~~~~i~nV~v~n~~~~~t~~gi~Ikt~~g~~~G~v~nI~~~ni~~~~v-~~~i~i~~~y~~~~  119 (125)
                      |+++ .+.|+||+|+||+|.++.+|+|||||++ ++|.|+||+|+||+|+++ ++||+|+|+|++..
T Consensus       210 G~~~-~~~v~nV~v~n~~~~~t~~GirIKt~~g-~~G~v~nV~f~ni~~~~v~~~pI~I~~~Y~~~~  274 (339)
T d1ia5a_         210 GGRS-DNTVKNVTFVDSTIINSDNGVRIKTNID-TTGSVSDVTYKDITLTSIAKYGIVVQQNYGDTS  274 (339)
T ss_dssp             CSSS-CCEEEEEEEEEEEEESCSEEEEEEEETT-CCCEEEEEEEEEEEEEEESSEEEEEEEEETCTT
T ss_pred             ccCc-cccEEEEEEECCcccCCcceeEEeeeCC-CCEEEEEEEEEEEEEeccccccEEEEeecCCCC
Confidence            8887 6779999999999999999999999997 679999999999999999 57999999998754

PyMOL of d1ia5a_

>d1hg8a_ b.80.1.3 (A:) Polygalacturonase {Fusarium moniliforme [TaxId: 117187]}	Back information, alignment and structure

>d1czfa_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase II [TaxId: 5061]}	Back information, alignment and structure

>d1nhca_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase I [TaxId: 5061]}	Back information, alignment and structure

>d1k5ca_ b.80.1.3 (A:) Polygalacturonase {Fungus (Stereum purpureum), endo-polygalacturonase I [TaxId: 58369]}	Back information, alignment and structure

>d1bhea_ b.80.1.3 (A:) Polygalacturonase {Erwinia carotovora, subsp. carotovora [TaxId: 554]}	Back information, alignment and structure

>d1rmga_ b.80.1.3 (A:) Rhamnogalacturonase A {Aspergillus aculeatus [TaxId: 5053]}	Back information, alignment and structure

>d1ogmx2 b.80.1.10 (X:202-574) Dextranase, catalytic domain {Penicillium minioluteum [TaxId: 28574]}	Back information, alignment and structure

>d1ia5a_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus aculeatus) [TaxId: 5053]}	Back information, alignment and structure

>d1hg8a_ b.80.1.3 (A:) Polygalacturonase {Fusarium moniliforme [TaxId: 117187]}	Back information, alignment and structure

>d1bhea_ b.80.1.3 (A:) Polygalacturonase {Erwinia carotovora, subsp. carotovora [TaxId: 554]}	Back information, alignment and structure

>d1nhca_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase I [TaxId: 5061]}	Back information, alignment and structure

>d1czfa_ b.80.1.3 (A:) Polygalacturonase {Fungus (Aspergillus niger), endo-polygalacturonase II [TaxId: 5061]}	Back information, alignment and structure

>d1rmga_ b.80.1.3 (A:) Rhamnogalacturonase A {Aspergillus aculeatus [TaxId: 5053]}	Back information, alignment and structure

>d1k5ca_ b.80.1.3 (A:) Polygalacturonase {Fungus (Stereum purpureum), endo-polygalacturonase I [TaxId: 58369]}	Back information, alignment and structure

>d1o88a_ b.80.1.1 (A:) Pectate lyase {Erwinia chrysanthemi, type C [TaxId: 556]}	Back information, alignment and structure

>d1ogmx2 b.80.1.10 (X:202-574) Dextranase, catalytic domain {Penicillium minioluteum [TaxId: 28574]}	Back information, alignment and structure

>d1pxza_ b.80.1.1 (A:) Major pollen allergen Jun a 1 {Ozark white cedar (Juniperus ashei) [TaxId: 13101]}	Back information, alignment and structure

>d1pcla_ b.80.1.1 (A:) Pectate lyase {Erwinia chrysanthemi, type E [TaxId: 556]}	Back information, alignment and structure

>d1qcxa_ b.80.1.2 (A:) Pectin lyase {Aspergillus niger, type B [TaxId: 5061]}	Back information, alignment and structure

>d1bn8a_ b.80.1.1 (A:) Pectate lyase {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1idka_ b.80.1.2 (A:) Pectin lyase {Aspergillus niger, type A [TaxId: 5061]}	Back information, alignment and structure

>d1pe9a_ b.80.1.1 (A:) Pectate lyase {Erwinia chrysanthemi, type A [TaxId: 556]}	Back information, alignment and structure

>d1tywa_ b.80.1.6 (A:) P22 tailspike protein {Salmonella phage P22 [TaxId: 10754]}	Back information, alignment and structure

>d1pxza_ b.80.1.1 (A:) Major pollen allergen Jun a 1 {Ozark white cedar (Juniperus ashei) [TaxId: 13101]}	Back information, alignment and structure

>d1o88a_ b.80.1.1 (A:) Pectate lyase {Erwinia chrysanthemi, type C [TaxId: 556]}	Back information, alignment and structure