Citrus Sinensis ID: 040420

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MGLHAPTRALSTTNSSTPPPLLAPTGNNAGLRRPADRFALKSSFSAPSLHLLLSPPHQQQLLASAAPKFSMRVASKQAYICRDCGYIYNERKPFDQLPDNYFCPVCGAPKRRFRPYTPAVTRGANDTAVRKARKEQIQRDEAIGKALPIAIAVAAVALAGLYFYLNSAF
cccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccEEEccccEEEcccccccccccccccccccccccccEEcccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccc
ccccccccHcccccccccccccccccccccccccccccccccccccccHHHccccHHHHHHHHcccccccccHHHHccEEHHHccEEEHccccHHHcccccEccccccEHHHEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
mglhaptralsttnsstpppllaptgnnaglrrpadrfalkssfsapslhlllspphqqQLLASAAPKFSMRVASKQAYICRDcgyiynerkpfdqlpdnyfcpvcgapkrrfrpytpavtrganDTAVRKARKEQIQRDEAIGKALPIAIAVAAVALAGLYFYLNSAF
mglhaptralsttnsstpppllaptgnnaGLRRPADRFALKSSFSAPSLHLLLSPPHQQQLLASAAPKFSMRVASKQAYICRDCGYIYNERKPFDQLPDNYFCPVCGApkrrfrpytpavtrgandtavrKARKEQIQRDEAIGKALPIAIAVAAVALAGLYFYLNSAF
MGLHAPTRALSTTNSSTPPPLLAPTGNNAGLRRPADRFALKssfsapslhlllspphqqqllasAAPKFSMRVASKQAYICRDCGYIYNERKPFDQLPDNYFCPVCGAPKRRFRPYTPAVTRGANDTAVRKARKEQIQRDEAIGKalpiaiavaavalaGLYFYLNSAF
********************************************************************FSMRVASKQAYICRDCGYIYNERKPFDQLPDNYFCPVCGAPKRRFRPYTPAVTR*****************DEAIGKALPIAIAVAAVALAGLYFYLN***
*************************************FALKSSFSAPSLH****************************YICRDCGYIYNERKPFDQLPDNYFCPVCGAPKRRFRPYTPA*************************KALPIAIAVAAVALAGLYFYLNSAF
****************TPPPLLAPTGNNAGLRRPADRFALKSSFSAPSLHLLLSPPHQQQLLASAAPKFSMRVASKQAYICRDCGYIYNERKPFDQLPDNYFCPVCGAPKRRFRPYTPAV*****************QRDEAIGKALPIAIAVAAVALAGLYFYLNSAF
*****************************GLRRPADRFALKSSFSAPSLHLLLSPPHQQQLLASAAPKFSMRVASKQAYICRDCGYIYNERKPFDQLPDNYFCPVCGAPKRRFRPYTPAVTR*ANDTAVRKARKEQIQRDEAIGKALPIAIAVAAVALAGLYFYLNSAF
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLHAPTRALSTTNSSTPPPLLAPTGNNAGLRRPADRFALKSSFSAPSLHLLLSPPHQQQLLASAAPKFSMRVASKQAYICRDCGYIYNERKPFDQLPDNYFCPVCGAPKRRFRPYTPAVTRGANDTAVRKARKEQIQRDEAIGKALPIAIAVAAVALAGLYFYLNSAF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query169 2.2.26 [Sep-21-2011]
P0417045 Rubredoxin-1 OS=Desulfovi yes no 0.230 0.866 0.511 2e-06
P2429754 Rubredoxin OS=Pyrococcus yes no 0.207 0.648 0.413 8e-06
O2625863 Probable rubredoxin OS=Me no no 0.260 0.698 0.4 4e-05
P5899269 Rubredoxin-1 OS=Chlorobiu yes no 0.230 0.565 0.38 5e-05
Q9V09953 Rubredoxin OS=Pyrococcus yes no 0.195 0.622 0.431 8e-05
Q9AL9454 Rubredoxin OS=Clostridium yes no 0.230 0.722 0.36 0.0009
>sp|P04170|RUBR1_DESDA Rubredoxin-1 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=rd1 PE=1 SV=1 Back     alignment and function desciption
 Score = 52.0 bits (123), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 4/43 (9%)

Query: 77  QAYICRDCGYIYN----ERKPFDQLPDNYFCPVCGAPKRRFRP 115
           Q Y+C  CGY Y+    +  PFDQLPD++ CPVCG  K +F P
Sbjct: 2   QKYVCNVCGYEYDPAEHDNVPFDQLPDDWCCPVCGVSKDQFSP 44
Electron acceptor for cytoplasmic lactate dehydrogenase.
Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) (taxid: 525146)
>sp|P24297|RUBR_PYRFU Rubredoxin OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rub PE=1 SV=2 Back     alignment and function description
>sp|O26258|RUBR_METTH Probable rubredoxin OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_155 PE=3 SV=1 Back     alignment and function description
>sp|P58992|RUBR1_CHLTE Rubredoxin-1 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) GN=rub1 PE=3 SV=1 Back     alignment and function description
>sp|Q9V099|RUBR_PYRAB Rubredoxin OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rub PE=1 SV=1 Back     alignment and function description
>sp|Q9AL94|RUBR_CLOAB Rubredoxin OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rd PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
224134208170 predicted protein [Populus trichocarpa] 0.994 0.988 0.733 2e-67
118485870170 unknown [Populus trichocarpa] 0.994 0.988 0.733 3e-67
118489155170 unknown [Populus trichocarpa x Populus d 0.994 0.988 0.727 1e-66
255540027170 electron transporter, putative [Ricinus 0.982 0.976 0.726 1e-61
317106608170 JHL07K02.5 [Jatropha curcas] 0.982 0.976 0.719 3e-61
225456515218 PREDICTED: uncharacterized protein LOC10 0.946 0.733 0.724 1e-59
346472619166 hypothetical protein [Amblyomma maculatu 0.970 0.987 0.625 2e-53
351724821171 uncharacterized protein LOC100500575 [Gl 0.964 0.953 0.639 2e-51
388512243161 unknown [Lotus japonicus] 0.834 0.875 0.697 7e-51
356512934154 PREDICTED: uncharacterized protein LOC10 0.875 0.961 0.682 3e-50
>gi|224134208|ref|XP_002321763.1| predicted protein [Populus trichocarpa] gi|222868759|gb|EEF05890.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 142/169 (84%), Gaps = 1/169 (0%)

Query: 1   MGLHAPTRALSTTNSSTPPPLLAPTGNNAGLRRPADRFALKSSFSAPSLHLLLSPPHQQQ 60
           M LHAP R L  T +S PP LLAP GNN GL+ P DRFALKSSF +PSLHLL++  +QQQ
Sbjct: 1   MALHAPIR-LQATKTSPPPSLLAPNGNNVGLKGPTDRFALKSSFFSPSLHLLIASYNQQQ 59

Query: 61  LLASAAPKFSMRVASKQAYICRDCGYIYNERKPFDQLPDNYFCPVCGAPKRRFRPYTPAV 120
            LASAAP+FSMR A+KQAYICRDCGYIYN+RKPFD+ PDNYFCPVCGAPKRRFR Y PAV
Sbjct: 60  PLASAAPRFSMRAATKQAYICRDCGYIYNDRKPFDKQPDNYFCPVCGAPKRRFREYMPAV 119

Query: 121 TRGANDTAVRKARKEQIQRDEAIGKALPIAIAVAAVALAGLYFYLNSAF 169
           T+  ND  VRKARKEQIQ+DEAIG+ALPIA+ V  VALAG+YFY+N++F
Sbjct: 120 TKNVNDKDVRKARKEQIQKDEAIGRALPIAVVVGIVALAGIYFYINNSF 168

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|118485870|gb|ABK94782.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118489155|gb|ABK96384.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|255540027|ref|XP_002511078.1| electron transporter, putative [Ricinus communis] gi|223550193|gb|EEF51680.1| electron transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|317106608|dbj|BAJ53115.1| JHL07K02.5 [Jatropha curcas] Back     alignment and taxonomy information
>gi|225456515|ref|XP_002284699.1| PREDICTED: uncharacterized protein LOC100259528 [Vitis vinifera] Back     alignment and taxonomy information
>gi|346472619|gb|AEO36154.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|351724821|ref|NP_001236303.1| uncharacterized protein LOC100500575 [Glycine max] gi|255630661|gb|ACU15690.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388512243|gb|AFK44183.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356512934|ref|XP_003525169.1| PREDICTED: uncharacterized protein LOC100812204 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query169
TAIR|locus:2157388154 AT5G51010 [Arabidopsis thalian 0.609 0.668 0.650 1.3e-34
TAIR|locus:2167150271 ENH1 "enhancer of sos3-1" [Ara 0.307 0.191 0.464 2.6e-09
UNIPROTKB|Q9AL9454 rd "Rubredoxin" [Clostridium a 0.218 0.685 0.395 0.00013
TIGR_CMR|GSU_084752 GSU_0847 "rubredoxin" [Geobact 0.230 0.75 0.36 0.00057
TIGR_CMR|GSU_318852 GSU_3188 "rubredoxin" [Geobact 0.136 0.442 0.565 0.00057
TAIR|locus:2157388 AT5G51010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 375 (137.1 bits), Expect = 1.3e-34, P = 1.3e-34
 Identities = 67/103 (65%), Positives = 78/103 (75%)

Query:    65 AAPKFSMRVASKQAYICRDCGYIYNERKPFDQLPDNYFCPVCGAPKRRFRPYTPAVTRGA 124
             +AP+FSMRV+SKQAYICRDCGYIYN+R PFD+LPDNYFCPVC APKRRFR Y P V++  
Sbjct:    50 SAPRFSMRVSSKQAYICRDCGYIYNDRTPFDKLPDNYFCPVCAAPKRRFRAYMPDVSKNV 109

Query:   125 NDTAVRKARKEQIQRDEAIGKXXXXXXXXXXXXXXGLYFYLNS 167
             ND  VRKARK ++QRDEA+GK               LYFY+NS
Sbjct:   110 NDKDVRKARKAELQRDEAVGKALPIGIAVGVLALAALYFYVNS 152
GO:0009507 "chloroplast" evidence=ISM
GO:0046872 "metal ion binding" evidence=ISS
TAIR|locus:2167150 ENH1 "enhancer of sos3-1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9AL94 rd "Rubredoxin" [Clostridium acetobutylicum ATCC 824 (taxid:272562)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0847 GSU_0847 "rubredoxin" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_3188 GSU_3188 "rubredoxin" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_XV2458
SubName- Full=Putative uncharacterized protein; (170 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
cd0073050 cd00730, rubredoxin, Rubredoxin; nonheme iron bind 2e-13
pfam0030147 pfam00301, Rubredoxin, Rubredoxin 2e-11
cd0035033 cd00350, rubredoxin_like, Rubredoxin_like; nonheme 4e-11
COG177355 COG1773, COG1773, Rubredoxin [Energy production an 3e-10
cd0072934 cd00729, rubredoxin_SM, Rubredoxin, Small Modular 2e-06
COG1592166 COG1592, COG1592, Rubrerythrin [Energy production 2e-05
PRK12496164 PRK12496, PRK12496, hypothetical protein; Provisio 4e-04
PRK05452479 PRK05452, PRK05452, anaerobic nitric oxide reducta 8e-04
>gnl|CDD|238372 cd00730, rubredoxin, Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center Back     alignment and domain information 
 Score = 60.8 bits (148), Expect = 2e-13
 Identities = 22/49 (44%), Positives = 27/49 (55%), Gaps = 11/49 (22%)

Query: 79  YICRDCGYIYNERK-----------PFDQLPDNYFCPVCGAPKRRFRPY 116
           Y CR CGYIY+  +           PF+ LPD++ CPVCGA K  F P 
Sbjct: 2   YECRICGYIYDPAEGDPDEGIPPGTPFEDLPDDWVCPVCGAGKDDFEPL 50

Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer. Length = 50
>gnl|CDD|189494 pfam00301, Rubredoxin, Rubredoxin Back     alignment and domain information
>gnl|CDD|238210 cd00350, rubredoxin_like, Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>gnl|CDD|224687 COG1773, COG1773, Rubredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|238371 cd00729, rubredoxin_SM, Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>gnl|CDD|224508 COG1592, COG1592, Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|237118 PRK12496, PRK12496, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235475 PRK05452, PRK05452, anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 169
cd0073050 rubredoxin Rubredoxin; nonheme iron binding domain 99.62
PF0030147 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubred 99.61
COG177355 Rubredoxin [Energy production and conversion] 99.6
PRK05452479 anaerobic nitric oxide reductase flavorubredoxin; 99.33
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 99.21
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 99.13
COG1592166 Rubrerythrin [Energy production and conversion] 98.58
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 97.54
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 97.42
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 97.34
PRK03824135 hypA hydrogenase nickel incorporation protein; Pro 96.31
PRK12496164 hypothetical protein; Provisional 96.25
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 95.65
PF0519136 ADK_lid: Adenylate kinase, active site lid; InterP 95.48
COG226059 Predicted Zn-ribbon RNA-binding protein [Translati 95.27
COG335797 Predicted transcriptional regulator containing an 95.25
PF09845131 DUF2072: Zn-ribbon containing protein (DUF2072); I 95.2
smart00531147 TFIIE Transcription initiation factor IIE. 95.13
PRK12380113 hydrogenase nickel incorporation protein HybF; Pro 95.11
PRK06266178 transcription initiation factor E subunit alpha; V 95.09
PF01155113 HypA: Hydrogenase expression/synthesis hypA family 95.08
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 94.94
TIGR00100115 hypA hydrogenase nickel insertion protein HypA. In 94.77
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 94.42
PRK03681114 hypA hydrogenase nickel incorporation protein; Val 94.39
COG233182 Uncharacterized protein conserved in bacteria [Fun 94.23
COG3364112 Zn-ribbon containing protein [General function pre 94.22
PF07295146 DUF1451: Protein of unknown function (DUF1451); In 94.17
PRK11823 446 DNA repair protein RadA; Provisional 94.15
COG4640 465 Predicted membrane protein [Function unknown] 94.03
TIGR00416 454 sms DNA repair protein RadA. The gene protuct code 94.02
COG1545140 Predicted nucleic-acid-binding protein containing 93.88
PF1420678 Cys_rich_CPCC: Cysteine-rich CPCC 93.67
PRK00564117 hypA hydrogenase nickel incorporation protein; Pro 93.5
COG1439177 Predicted nucleic acid-binding protein, consists o 92.69
PF1324826 zf-ribbon_3: zinc-ribbon domain 92.54
COG199649 RPC10 DNA-directed RNA polymerase, subunit RPC10 ( 92.1
PF0360432 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa 91.86
PRK05978148 hypothetical protein; Provisional 91.6
TIGR01384104 TFS_arch transcription factor S, archaeal. There h 91.5
PRK06260 397 threonine synthase; Validated 91.42
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This 91.38
PF13397105 DUF4109: Domain of unknown function (DUF4109) 91.23
PRK1313056 H/ACA RNA-protein complex component Nop10p; Review 90.97
PRK11788389 tetratricopeptide repeat protein; Provisional 90.97
PRK06450 338 threonine synthase; Validated 90.89
TIGR00686109 phnA alkylphosphonate utilization operon protein P 90.84
COG209364 DNA-directed RNA polymerase, subunit E'' [Transcri 90.81
PRK10220111 hypothetical protein; Provisional 90.73
PRK00762124 hypA hydrogenase nickel incorporation protein; Pro 90.73
PF1324023 zinc_ribbon_2: zinc-ribbon domain 90.67
PRK11032160 hypothetical protein; Provisional 90.63
PRK07591 421 threonine synthase; Validated 90.52
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 90.42
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 90.22
PRK08579625 anaerobic ribonucleoside triphosphate reductase; P 90.06
PF1431155 DUF4379: Domain of unknown function (DUF4379) 90.04
COG1066 456 Sms Predicted ATP-dependent serine protease [Postt 89.99
PRK08271623 anaerobic ribonucleoside triphosphate reductase; P 89.57
TIGR0120654 lysW lysine biosynthesis protein LysW. This very s 89.42
PF1217237 DUF35_N: Rubredoxin-like zinc ribbon domain (DUF35 89.36
PF1480334 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C. 89.23
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 88.98
PF0775424 DUF1610: Domain of unknown function (DUF1610); Int 88.76
PRK08270656 anaerobic ribonucleoside triphosphate reductase; P 88.61
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 88.45
PRK0639364 rpoE DNA-directed RNA polymerase subunit E''; Vali 88.4
cd01675555 RNR_III Class III ribonucleotide reductase. Ribonu 87.91
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 87.43
KOG2906105 consensus RNA polymerase III subunit C11 [Transcri 87.42
PRK0835161 DNA-directed RNA polymerase subunit E''; Validated 87.35
PF1371736 zinc_ribbon_4: zinc-ribbon domain 87.1
PF0827430 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 86.95
PF06676148 DUF1178: Protein of unknown function (DUF1178); In 86.58
PHA0062659 hypothetical protein 86.28
COG1645131 Uncharacterized Zn-finger containing protein [Gene 86.17
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 86.07
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 86.06
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 85.7
PF10263157 SprT-like: SprT-like family; InterPro: IPR006640 T 85.69
TIGR03844 398 cysteate_syn cysteate synthase. Members of this fa 85.49
PF04641260 Rtf2: Rtf2 RING-finger 85.32
PF09986214 DUF2225: Uncharacterized protein conserved in bact 85.29
TIGR00375374 conserved hypothetical protein TIGR00375. The memb 84.85
PF1371937 zinc_ribbon_5: zinc-ribbon domain 84.82
PF0064130 zf-RanBP: Zn-finger in Ran binding protein and oth 84.37
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 84.33
PRK07111735 anaerobic ribonucleoside triphosphate reductase; P 83.82
COG1867380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferas 83.72
PRK09263711 anaerobic ribonucleoside triphosphate reductase; P 83.48
PRK14704618 anaerobic ribonucleoside triphosphate reductase; P 83.46
PRK08197 394 threonine synthase; Validated 83.44
smart0066152 RPOL9 RNA polymerase subunit 9. 83.39
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 83.33
PF13597546 NRDD: Anaerobic ribonucleoside-triphosphate reduct 83.04
PRK04351149 hypothetical protein; Provisional 82.9
PRK00481242 NAD-dependent deacetylase; Provisional 82.88
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 82.85
PF0481040 zf-Sec23_Sec24: Sec23/Sec24 zinc finger; InterPro: 82.68
COG0375115 HybF Zn finger protein HypA/HybF (possibly regulat 82.58
TIGR02827586 RNR_anaer_Bdell anaerobic ribonucleoside-triphosph 82.5
COG0777 294 AccD Acetyl-CoA carboxylase beta subunit [Lipid me 81.76
PRK1489299 putative transcription elongation factor Elf1; Pro 81.65
COG1594113 RPB9 DNA-directed RNA polymerase, subunit M/Transc 81.08
PRK05654 292 acetyl-CoA carboxylase subunit beta; Validated 80.9
TIGR00515 285 accD acetyl-CoA carboxylase, carboxyl transferase, 80.83
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 80.71
PF1416959 YdjO: Cold-inducible protein YdjO 80.66
CHL00174 296 accD acetyl-CoA carboxylase beta subunit; Reviewed 80.52
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 80.18
PRK12860189 transcriptional activator FlhC; Provisional 80.15
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center Back     alignment and domain information 
Probab=99.62  E-value=1.2e-16  Score=107.38  Aligned_cols=39  Identities=56%  Similarity=1.327  Sum_probs=36.2

Q ss_pred             eEEcCCCCeeecC-----------CCCCCCCCCCCCCCCCCCCccCeeeC
Q 040420           78 AYICRDCGYIYNE-----------RKPFDQLPDNYFCPVCGAPKRRFRPY  116 (169)
Q Consensus        78 ~y~C~~CGyVYd~-----------~tpF~~lPd~~~CPvCgapK~~F~~~  116 (169)
                      .|+|.+||||||+           +|+|++||++|+||+|+++|++|+++
T Consensus         1 ~y~C~~CgyiYd~~~Gd~~~~i~pGt~f~~Lp~~w~CP~C~a~K~~F~~~   50 (50)
T cd00730           1 KYECRICGYIYDPAEGDPDEGIPPGTPFEDLPDDWVCPVCGAGKDDFEPL   50 (50)
T ss_pred             CcCCCCCCeEECCCCCCcccCcCCCCCHhHCCCCCCCCCCCCcHHHcEeC
Confidence            4999999999997           58999999999999999999999864

Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
>PF00301 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier [] Back     alignment and domain information
>COG1773 Rubredoxin [Energy production and conversion] Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>PRK12496 hypothetical protein; Provisional Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PF05191 ADK_lid: Adenylate kinase, active site lid; InterPro: IPR007862 Adenylate kinases (ADK; 2 Back     alignment and domain information
>COG2260 Predicted Zn-ribbon RNA-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription] Back     alignment and domain information
>PF09845 DUF2072: Zn-ribbon containing protein (DUF2072); InterPro: IPR018645 This archaeal Zinc-ribbon containing proteins have no known function Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PF01155 HypA: Hydrogenase expression/synthesis hypA family; InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>TIGR00100 hypA hydrogenase nickel insertion protein HypA Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated Back     alignment and domain information
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3364 Zn-ribbon containing protein [General function prediction only] Back     alignment and domain information
>PF07295 DUF1451: Protein of unknown function (DUF1451); InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>COG4640 Predicted membrane protein [Function unknown] Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only] Back     alignment and domain information
>PF14206 Cys_rich_CPCC: Cysteine-rich CPCC Back     alignment and domain information
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only] Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] Back     alignment and domain information
>PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates Back     alignment and domain information
>PRK05978 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01384 TFS_arch transcription factor S, archaeal Back     alignment and domain information
>PRK06260 threonine synthase; Validated Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PF13397 DUF4109: Domain of unknown function (DUF4109) Back     alignment and domain information
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK06450 threonine synthase; Validated Back     alignment and domain information
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA Back     alignment and domain information
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription] Back     alignment and domain information
>PRK10220 hypothetical protein; Provisional Back     alignment and domain information
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>PRK11032 hypothetical protein; Provisional Back     alignment and domain information
>PRK07591 threonine synthase; Validated Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PRK08579 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>PF14311 DUF4379: Domain of unknown function (DUF4379) Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08271 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>TIGR01206 lysW lysine biosynthesis protein LysW Back     alignment and domain information
>PF12172 DUF35_N: Rubredoxin-like zinc ribbon domain (DUF35_N); InterPro: IPR022002 This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins Back     alignment and domain information
>PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species Back     alignment and domain information
>PRK08270 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated Back     alignment and domain information
>cd01675 RNR_III Class III ribonucleotide reductase Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>KOG2906 consensus RNA polymerase III subunit C11 [Transcription] Back     alignment and domain information
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues Back     alignment and domain information
>PF06676 DUF1178: Protein of unknown function (DUF1178); InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PF10263 SprT-like: SprT-like family; InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT) Back     alignment and domain information
>TIGR03844 cysteate_syn cysteate synthase Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>TIGR00375 conserved hypothetical protein TIGR00375 Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PF00641 zf-RanBP: Zn-finger in Ran binding protein and others; InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PRK07111 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09263 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>PRK14704 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>PRK08197 threonine synthase; Validated Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13597 NRDD: Anaerobic ribonucleoside-triphosphate reductase; PDB: 1HK8_A 1H78_A 1H7A_A 1H79_A 1H7B_A Back     alignment and domain information
>PRK04351 hypothetical protein; Provisional Back     alignment and domain information
>PRK00481 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF04810 zf-Sec23_Sec24: Sec23/Sec24 zinc finger; InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only] Back     alignment and domain information
>TIGR02827 RNR_anaer_Bdell anaerobic ribonucleoside-triphosphate reductase Back     alignment and domain information
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] Back     alignment and domain information
>PRK14892 putative transcription elongation factor Elf1; Provisional Back     alignment and domain information
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription] Back     alignment and domain information
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF14169 YdjO: Cold-inducible protein YdjO Back     alignment and domain information
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PRK12860 transcriptional activator FlhC; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
6rxn_A46 The Structure Of Rubredoxin From Desulfovibrio Desu 4e-07
1bq8_A54 Rubredoxin (Methionine Mutant) From Pyrococcus Furi 2e-06
1bq9_A54 Rubredoxin (Formyl Methionine Mutant) From Pyrococc 3e-06
1brf_A53 Rubredoxin (Wild Type) From Pyrococcus Furiosus Len 3e-06
1iu5_A53 X-Ray Crystal Structure Of The Rubredoxin Mutant Fr 3e-06
3kyu_A54 X-Ray Crystal Structure Determination Of Fully Perd 3e-06
1yk5_A53 Pyrococcus Abyssi Rubredoxin Length = 53 3e-05
2pve_A54 Nmr And X-Ray Analysis Of Structural Additivity In 4e-05
1yk4_A52 Ultra-High Resolution Structure Of Pyrococcus Abyss 4e-05
2pya_A52 Ultra-high Resolution Structure Of P. Abyssi Rubred 8e-05
2pvx_A54 Nmr And X-ray Analysis Of Structural Additivity In 1e-04
1t9p_A54 Crystal Structure Of V44a, G45p Cp Rubredoxin Lengt 1e-04
1spw_A39 Solution Structure Of A Loop Truncated Mutant From 2e-04
2ql0_A52 Zinc-Substituted Rubredoxin From Desulfovibrio Vulg 5e-04
8rxn_A52 Refinement Of Rubredoxin From Desulfovibrio Vulgari 6e-04
1rb9_A52 Rubredoxin From Desulfovibrio Vulgaris Refined Anis 8e-04
1nnq_A171 Rubrerythrin From Pyrococcus Furiosus Pfu-1210814 L 8e-04
3mps_A170 Peroxide Bound Oxidized Rubrerythrin From Pyrococcu 8e-04
>pdb|6RXN|A Chain A, The Structure Of Rubredoxin From Desulfovibrio Desulfuricans Length = 46 Back     alignment and structure 
Iteration: 1

 Score = 50.4 bits (119), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 4/43 (9%)
Query: 77  QAYICRDCGYIYN----ERKPFDQLPDNYFCPVCGAPKRRFRP 115
           Q Y+C  CGY Y+    +  PFDQLPD++ CPVCG  K +F P
Sbjct: 3   QKYVCNVCGYEYDPAEHDNVPFDQLPDDWCCPVCGVSKDQFSP 45
>pdb|1BQ8|A Chain A, Rubredoxin (Methionine Mutant) From Pyrococcus Furiosus Length = 54 Back     alignment and structure
>pdb|1BQ9|A Chain A, Rubredoxin (Formyl Methionine Mutant) From Pyrococcus Furiosus Length = 54 Back     alignment and structure
>pdb|1BRF|A Chain A, Rubredoxin (Wild Type) From Pyrococcus Furiosus Length = 53 Back     alignment and structure
>pdb|1IU5|A Chain A, X-Ray Crystal Structure Of The Rubredoxin Mutant From Pyrococcus Furiosus Length = 53 Back     alignment and structure
>pdb|3KYU|A Chain A, X-Ray Crystal Structure Determination Of Fully Perdeuterated Rubredoxin At 100k Length = 54 Back     alignment and structure
>pdb|1YK5|A Chain A, Pyrococcus Abyssi Rubredoxin Length = 53 Back     alignment and structure
>pdb|2PVE|A Chain A, Nmr And X-Ray Analysis Of Structural Additivity In Metal Binding Site-Swapped Hybrids Of Rubredoxin Length = 54 Back     alignment and structure
>pdb|1YK4|A Chain A, Ultra-High Resolution Structure Of Pyrococcus Abyssi Rubredoxin W4lR5S Length = 52 Back     alignment and structure
>pdb|2PYA|A Chain A, Ultra-high Resolution Structure Of P. Abyssi Rubredoxin W4l/r5s/a44s Length = 52 Back     alignment and structure
>pdb|2PVX|A Chain A, Nmr And X-ray Analysis Of Structural Additivity In Metal Binding Site-swapped Hybrids Of Rubredoxin Length = 54 Back     alignment and structure
>pdb|1T9P|A Chain A, Crystal Structure Of V44a, G45p Cp Rubredoxin Length = 54 Back     alignment and structure
>pdb|1SPW|A Chain A, Solution Structure Of A Loop Truncated Mutant From D. Gigas Rubredoxin, Nmr Length = 39 Back     alignment and structure
>pdb|2QL0|A Chain A, Zinc-Substituted Rubredoxin From Desulfovibrio Vulgaris Length = 52 Back     alignment and structure
>pdb|8RXN|A Chain A, Refinement Of Rubredoxin From Desulfovibrio Vulgaris At 1.0 Angstroms With And Without Restraints Length = 52 Back     alignment and structure
>pdb|1RB9|A Chain A, Rubredoxin From Desulfovibrio Vulgaris Refined Anisotropically At 0.92 Angstroms Resolution Length = 52 Back     alignment and structure
>pdb|1NNQ|A Chain A, Rubrerythrin From Pyrococcus Furiosus Pfu-1210814 Length = 171 Back     alignment and structure
>pdb|3MPS|A Chain A, Peroxide Bound Oxidized Rubrerythrin From Pyrococcus Furiosus Length = 170 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query169
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 6e-19
4rxn_A54 Rubredoxin; electron transfer(iron-sulfur protein) 1e-15
1e8j_A52 Rubredoxin; iron-sulfur-protein, zinc-substitution 1e-15
2v3b_B55 Rubredoxin 2, rubredoxin; alkane degradation, iron 4e-15
2kn9_A81 Rubredoxin; metalloprotein, ssgcid, structural gen 4e-15
1dx8_A70 Rubredoxin; electron transport, zinc-substitution; 5e-15
1yk4_A52 Rubredoxin, RD; electron transport; 0.69A {Pyrococ 2e-14
1s24_A87 Rubredoxin 2; electron transport; NMR {Pseudomonas 1e-13
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 4e-07
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 5e-07
1lko_A191 Rubrerythrin all-iron(II) form; reduced form, DIIR 4e-06
3k1f_M197 Transcription initiation factor IIB; RNA polymeras 4e-04
2lcq_A165 Putative toxin VAPC6; PIN domain, Zn ribbon domain 8e-04
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Length = 46 Back     alignment and structure
 Score = 74.6 bits (184), Expect = 6e-19
 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 4/43 (9%)

Query: 77  QAYICRDCGYIYNERK----PFDQLPDNYFCPVCGAPKRRFRP 115
           Q Y+C  CGY Y+  +    PFDQLPD++ CPVCG  K +F P
Sbjct: 3   QKYVCNVCGYEYDPAEHDNVPFDQLPDDWCCPVCGVSKDQFSP 45
>4rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.20A {Clostridium pasteurianum} SCOP: g.41.5.1 PDB: 5rxn_A 1bfy_A 1fhh_A 1fhm_A 1irn_A 1iro_A 1r0f_A 1r0g_A 1r0h_A 1r0i_A 1r0j_A 1t9q_A 1c09_A 1b2j_A 1b13_A 1smm_A 1smu_A 1smw_A 1be7_A 1t9o_A ... Length = 54 Back     alignment and structure
>1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A Length = 52 Back     alignment and structure
>2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa} Length = 55 Back     alignment and structure
>2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} Length = 81 Back     alignment and structure
>1dx8_A Rubredoxin; electron transport, zinc-substitution; NMR {Guillardia theta} SCOP: g.41.5.1 PDB: 1h7v_A Length = 70 Back     alignment and structure
>1yk4_A Rubredoxin, RD; electron transport; 0.69A {Pyrococcus abyssi} PDB: 2pya_A 1yk5_A 1bq8_A 1bq9_A* 3kyu_A 3kyv_A 3kyw_A 3kyx_A 3kyy_A 3ryg_A 3rz6_A 3rzt_A 3ss2_A 1brf_A 1caa_A 1cad_A 1vcx_A 1zrp_A 1iu5_A 1iu6_A ... Length = 52 Back     alignment and structure
>1s24_A Rubredoxin 2; electron transport; NMR {Pseudomonas oleovorans} SCOP: g.41.5.1 Length = 87 Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Length = 170 Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Length = 202 Back     alignment and structure
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A Length = 191 Back     alignment and structure
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 Back     alignment and structure
>2lcq_A Putative toxin VAPC6; PIN domain, Zn ribbon domain, ribosome biogenesis, metal BIN protein; NMR {Pyrococcus horikoshii} Length = 165 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
1dx8_A70 Rubredoxin; electron transport, zinc-substitution; 99.78
1s24_A87 Rubredoxin 2; electron transport; NMR {Pseudomonas 99.71
4rxn_A54 Rubredoxin; electron transfer(iron-sulfur protein) 99.7
1e8j_A52 Rubredoxin; iron-sulfur-protein, zinc-substitution 99.68
2kn9_A81 Rubredoxin; metalloprotein, ssgcid, structural gen 99.67
2v3b_B55 Rubredoxin 2, rubredoxin; alkane degradation, iron 99.67
1yk4_A52 Rubredoxin, RD; electron transport; 0.69A {Pyrococ 99.67
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 99.66
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 98.92
1lko_A191 Rubrerythrin all-iron(II) form; reduced form, DIIR 98.9
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 98.89
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation prot 97.34
3a43_A139 HYPD, hydrogenase nickel incorporation protein HYP 96.89
2lcq_A165 Putative toxin VAPC6; PIN domain, Zn ribbon domain 96.51
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 96.32
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 95.33
2apo_B60 Ribosome biogenesis protein NOP10; protein-protein 93.94
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 93.76
3h0g_I113 DNA-directed RNA polymerases I, II, and III subuni 93.75
2aus_D60 NOP10, ribosome biogenesis protein NOP10; isomeras 91.89
1twf_I122 B12.6, DNA-directed RNA polymerase II 14.2 kDa pol 91.58
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 91.4
3h0g_L63 DNA-directed RNA polymerases I, II, and III subuni 90.35
2k16_A75 Transcription initiation factor TFIID subunit 3; p 90.18
3irb_A145 Uncharacterized protein from DUF35 family; 1381535 90.11
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 89.72
2akl_A138 PHNA-like protein PA0128; two domains, Zn binding 89.26
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 88.44
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 87.94
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 87.92
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 87.61
2gnr_A145 Conserved hypothetical protein; 13815350, structur 87.11
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 86.7
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 86.6
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 86.47
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 86.31
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 85.82
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 85.79
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 85.76
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 85.52
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 85.5
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 85.44
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 85.41
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 85.34
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 85.18
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 85.16
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 85.04
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 84.93
2lv2_A85 Insulinoma-associated protein 1; structural genomi 84.87
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 84.85
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 84.7
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 84.53
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 84.5
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 84.49
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 84.47
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 84.44
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 84.4
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 84.28
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 84.15
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 84.0
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 83.94
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 83.75
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 83.75
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 83.64
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 83.53
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 83.49
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 83.23
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 83.19
1vd4_A62 Transcription initiation factor IIE, alpha subunit 83.09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 82.93
1m2k_A249 Silent information regulator 2; protein-ligand com 82.88
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 82.8
1ltl_A279 DNA replication initiator (CDC21/CDC54); HET: DNA; 82.54
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 82.45
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 82.41
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 82.29
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 81.78
3qt1_I133 DNA-directed RNA polymerases I, II, and III subun; 81.76
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 81.54
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 81.22
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 81.18
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 81.18
3j21_g51 50S ribosomal protein L40E; archaea, archaeal, KIN 80.99
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 80.83
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 80.77
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 80.37
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 80.35
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 80.14
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 80.07
3p8b_A81 DNA-directed RNA polymerase, subunit E''; transcri 80.02
>1dx8_A Rubredoxin; electron transport, zinc-substitution; NMR {Guillardia theta} SCOP: g.41.5.1 PDB: 1h7v_A Back     alignment and structure
Probab=99.78  E-value=3.1e-20  Score=131.20  Aligned_cols=56  Identities=34%  Similarity=0.820  Sum_probs=49.3

Q ss_pred             CCCeEEcCCCCeeecC-----------CCCCCCCCCCCCCCCCCCCccCeeeCCCcccCCCChhHHHHHHHHHhhhcc
Q 040420           75 SKQAYICRDCGYIYNE-----------RKPFDQLPDNYFCPVCGAPKRRFRPYTPAVTRGANDTAVRKARKEQIQRDE  141 (169)
Q Consensus        75 ~~~~y~C~~CGyVYd~-----------~tpF~~lPd~~~CPvCgapK~~F~~~~~~~~~~~n~~~v~~ar~~~~~~~~  141 (169)
                      ....|+|++||||||+           +|+|+++|++|+||+|+++|++|+++....           ++|+|||+||
T Consensus         4 ~m~~y~C~vCGyiYd~~~Gdp~~gi~pGT~f~~lPddw~CP~Cga~K~~F~~~~~~~-----------sgf~en~~yg   70 (70)
T 1dx8_A            4 DEGKYECEACGYIYEPEKGDKFAGIPPGTPFVDLSDSFMCPACRSPKNQFKSIKKVI-----------AGFAENQKYG   70 (70)
T ss_dssp             CSSCEEETTTCCEECTTTCCTTTTCCSSCCGGGSCTTCBCTTTCCBGGGEEECCCBC-----------CCSCCCSCCC
T ss_pred             CCceEEeCCCCEEEcCCCCCcccCcCCCCchhhCCCCCcCCCCCCCHHHceEccccC-----------CChhhhcccC
Confidence            3557999999999996           689999999999999999999999986433           6899999886
>1s24_A Rubredoxin 2; electron transport; NMR {Pseudomonas oleovorans} SCOP: g.41.5.1 Back     alignment and structure
>4rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.20A {Clostridium pasteurianum} SCOP: g.41.5.1 PDB: 5rxn_A 1bfy_A 1fhh_A 1fhm_A 1irn_A 1iro_A 1r0f_A 1r0g_A 1r0h_A 1r0i_A 1r0j_A 1t9q_A 1c09_A 1b2j_A 1b13_A 1smm_A 1smu_A 1smw_A 1be7_A 1t9o_A ... Back     alignment and structure
>1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A Back     alignment and structure
>2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa} Back     alignment and structure
>1yk4_A Rubredoxin, RD; electron transport; 0.69A {Pyrococcus abyssi} PDB: 2pya_A 1yk5_A 1bq8_A 1bq9_A* 3kyu_A 3kyv_A 3kyw_A 3kyx_A 3kyy_A 3ryg_A 3rz6_A 3rzt_A 3ss2_A 1brf_A 1caa_A 1cad_A 1vcx_A 1zrp_A 1iu5_A 1iu6_A ... Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure
>3a43_A HYPD, hydrogenase nickel incorporation protein HYPA; [NIFE] hydrogenase maturation, zinc-finger, nickel binding, metal-binding; HET: FME; 2.30A {Pyrococcus kodakaraensis} PDB: 3a44_A* Back     alignment and structure
>2lcq_A Putative toxin VAPC6; PIN domain, Zn ribbon domain, ribosome biogenesis, metal BIN protein; NMR {Pyrococcus horikoshii} Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>2apo_B Ribosome biogenesis protein NOP10; protein-protein complex, box H/ACA, snoRNP, pseudouridine synthase, RNA modification; 1.95A {Methanocaldococcus jannaschii} SCOP: g.41.16.1 PDB: 2aqc_A Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>2aus_D NOP10, ribosome biogenesis protein NOP10; isomerase, structural protein, isomerase-structural protein; 2.10A {Pyrococcus abyssi} PDB: 3lwr_B 3lwo_B* 3lwq_B* 3lwp_B 3lwv_B 3hax_C* 2hvy_C* 3hay_C* 2ey4_E 3hjw_B* 2rfk_B* 3hjy_B 3mqk_B Back     alignment and structure
>1twf_I B12.6, DNA-directed RNA polymerase II 14.2 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.3.1 g.41.3.1 PDB: 1i3q_I 1i6h_I 1k83_I* 1nik_I 1nt9_I 1pqv_I 1r5u_I 1r9s_I* 1r9t_I* 1sfo_I* 1twa_I* 1twc_I* 1i50_I* 1twg_I* 1twh_I* 1wcm_I 1y1v_I 1y1w_I 1y1y_I 1y77_I* ... Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>3irb_A Uncharacterized protein from DUF35 family; 13815350, protein with unknown function from DUF35 family, S genomics; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2akl_A PHNA-like protein PA0128; two domains, Zn binding protein, beta-strand protein, structural genomics, PSI; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.34.11.2 g.41.3.5 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gnr_A Conserved hypothetical protein; 13815350, structural genomics, PSI, protein structure initiative; 1.80A {Sulfolobus solfataricus P2} PDB: 3irb_A Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1m2k_A Silent information regulator 2; protein-ligand complex, gene regulation; HET: APR; 1.47A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1m2g_A* 1m2h_A* 1m2j_A* 1m2n_A* 1ici_A* Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>1ltl_A DNA replication initiator (CDC21/CDC54); HET: DNA; 3.00A {Methanothermobacterthermautotrophicus} SCOP: b.40.4.11 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3qt1_I DNA-directed RNA polymerases I, II, and III subun; transferase-transcription complex, RNA polymerase II, transc elongation; 4.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>3j21_g 50S ribosomal protein L40E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>3p8b_A DNA-directed RNA polymerase, subunit E''; transcription elongation factor, RNA polymerase, transferase transcription complex; 1.80A {Pyrococcus furiosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 169
d6rxna_45 g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuric 5e-18
d1dx8a_70 g.41.5.1 (A:) Rubredoxin {Guillardia theta [TaxId: 3e-17
d1iroa_53 g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum 9e-17
d1brfa_53 g.41.5.1 (A:) Rubredoxin {Archaeon Pyrococcus furi 1e-16
d1s24a_56 g.41.5.1 (A:) Two-iron rubredoxin {Pseudomonas ole 2e-16
d2dsxa152 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio gigas 7e-16
d1nnqa237 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal doma 1e-09
d1yuza236 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domai 5e-09
d1lkoa244 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal doma 3e-07
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Length = 45 Back     information, alignment and structure

class: Small proteins
fold: Rubredoxin-like
superfamily: Rubredoxin-like
family: Rubredoxin
domain: Rubredoxin
species: Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]

 Score = 70.9 bits (174), Expect = 5e-18
 Identities = 22/43 (51%), Positives = 28/43 (65%), Gaps = 4/43 (9%)

Query: 77  QAYICRDCGYIYNERK----PFDQLPDNYFCPVCGAPKRRFRP 115
           Q Y+C  CGY Y+  +    PFDQLPD++ CPVCG  K +F P
Sbjct: 2   QKYVCNVCGYEYDPAEHDNVPFDQLPDDWCCPVCGVSKDQFSP 44
>d1dx8a_ g.41.5.1 (A:) Rubredoxin {Guillardia theta [TaxId: 55529]} Length = 70 Back     information, alignment and structure
>d1iroa_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]} Length = 53 Back     information, alignment and structure
>d1brfa_ g.41.5.1 (A:) Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 53 Back     information, alignment and structure
>d1s24a_ g.41.5.1 (A:) Two-iron rubredoxin {Pseudomonas oleovorans [TaxId: 301]} Length = 56 Back     information, alignment and structure
>d2dsxa1 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio gigas [TaxId: 879]} Length = 52 Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 37 Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Length = 36 Back     information, alignment and structure
>d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Length = 44 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query169
d1dx8a_70 Rubredoxin {Guillardia theta [TaxId: 55529]} 99.8
d1iroa_53 Rubredoxin {Clostridium pasteurianum [TaxId: 1501] 99.72
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 99.71
d1s24a_56 Two-iron rubredoxin {Pseudomonas oleovorans [TaxId 99.71
d1brfa_53 Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2 99.69
d2dsxa152 Rubredoxin {Desulfovibrio gigas [TaxId: 879]} 99.68
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 99.23
d1lkoa244 Rubrerythrin, C-terminal domain {Desulfovibrio vul 99.23
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 99.21
d2gmga1105 Hypothetical protein PF0610 {Pyrococcus furiosus [ 96.73
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 94.66
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 94.31
d1zina235 Microbial and mitochondrial ADK, insert "zinc fing 94.03
d1e4va235 Microbial and mitochondrial ADK, insert "zinc fing 93.96
d2akla238 Hypothetical protein PA0128, N-terminal domain {Ps 93.69
d1s3ga235 Microbial and mitochondrial ADK, insert "zinc fing 93.2
d2gnra1137 Hypothetical protein SSO2064 {Sulfolobus solfatari 90.22
d2apob155 Ribosome biogenesis protein Nop10 {Archaeon Methan 89.98
d2ey4e152 Ribosome biogenesis protein Nop10 {Archaeon Pyroco 89.82
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 88.26
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 84.96
d1hk8a_561 Class III anaerobic ribonucleotide reductase NRDD 84.93
d1ryqa_67 putative DNA-directed RNA polymerase subunit E'' ( 84.08
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 84.06
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 83.09
d1ltla_239 DNA replication initiator (cdc21/cdc54) N-terminal 80.56
d1pd0a585 Sec24 {Baker's yeast (Saccharomyces cerevisiae) [T 80.05
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 80.02
>d1dx8a_ g.41.5.1 (A:) Rubredoxin {Guillardia theta [TaxId: 55529]} Back     information, alignment and structure
class: Small proteins
fold: Rubredoxin-like
superfamily: Rubredoxin-like
family: Rubredoxin
domain: Rubredoxin
species: Guillardia theta [TaxId: 55529]

Probab=99.80  E-value=4.3e-21  Score=134.33  Aligned_cols=56  Identities=34%  Similarity=0.820  Sum_probs=50.1

Q ss_pred             CCCeEEcCCCCeeecC-----------CCCCCCCCCCCCCCCCCCCccCeeeCCCcccCCCChhHHHHHHHHHhhhcc
Q 040420           75 SKQAYICRDCGYIYNE-----------RKPFDQLPDNYFCPVCGAPKRRFRPYTPAVTRGANDTAVRKARKEQIQRDE  141 (169)
Q Consensus        75 ~~~~y~C~~CGyVYd~-----------~tpF~~lPd~~~CPvCgapK~~F~~~~~~~~~~~n~~~v~~ar~~~~~~~~  141 (169)
                      +...|+|++||||||+           +|+|++||++|+||+|+++|+.|+++.+..           ++|++||+||
T Consensus         4 ~~~ky~C~~CgyiYDp~~GD~~~gI~pGT~F~dLP~dW~CP~Cga~K~~F~~~~~~~-----------agf~~N~~yg   70 (70)
T d1dx8a_           4 DEGKYECEACGYIYEPEKGDKFAGIPPGTPFVDLSDSFMCPACRSPKNQFKSIKKVI-----------AGFAENQKYG   70 (70)
T ss_dssp             CSSCEEETTTCCEECTTTCCTTTTCCSSCCGGGSCTTCBCTTTCCBGGGEEECCCBC-----------CCSCCCSCCC
T ss_pred             cCCeEEcCCCCeEECcccCCcccCCCCCCChHHCCCCCCCcCCCCcHHHheEccccc-----------CChHHhcccC
Confidence            4568999999999997           589999999999999999999999997653           6899999886
>d1iroa_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure
>d1s24a_ g.41.5.1 (A:) Two-iron rubredoxin {Pseudomonas oleovorans [TaxId: 301]} Back     information, alignment and structure
>d1brfa_ g.41.5.1 (A:) Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2dsxa1 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2gmga1 a.4.5.82 (A:1-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zina2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e4va2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2akla2 g.41.3.5 (A:3-40) Hypothetical protein PA0128, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2gnra1 b.40.4.15 (A:8-144) Hypothetical protein SSO2064 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2apob1 g.41.16.1 (B:403-457) Ribosome biogenesis protein Nop10 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ey4e1 g.41.16.1 (E:4-55) Ribosome biogenesis protein Nop10 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hk8a_ c.7.1.3 (A:) Class III anaerobic ribonucleotide reductase NRDD subunit {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ryqa_ g.41.9.3 (A:) putative DNA-directed RNA polymerase subunit E'' (RpoE2) {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ltla_ b.40.4.11 (A:) DNA replication initiator (cdc21/cdc54) N-terminal domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1pd0a5 g.41.10.1 (A:216-300) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure