Citrus Sinensis ID: 040514

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50-
ENDFLKEQGMVLLESFVDPVVIYHSKGHTIPRIDERGQETMLSFIQKFQMI
cccHHHHHHHHHHHHHcccEEEEcccccccccccHHHHHHHHHHHHHHHHc
ccccccHHHHHHHHHccccEEEEcccccccccccHHHHHHHHHHHHHHHcc
ENDFLKEQGMVLLESFVDPvviyhskghtipriderGQETMLSFIQKFQMI
ENDFLKEQGMVLLESFVDPVVIYHSKGhtipridergQETMLSFIQKFQMI
ENDFLKEQGMVLLESFVDPVVIYHSKGHTIPRIDERGQETMLSFIQKFQMI
*******QGMVLLESFVDPVVIYHSKGHTIPRID*****************
*****KEQGMVLLESFVDPVVIYHSKGHTIPRIDERGQETMLSFIQKFQMI
ENDFLKEQGMVLLESFVDPVVIYHSKGHTIPRIDERGQETMLSFIQKFQMI
*NDFLKEQGMVLLESFVDPVVIYHSKGHTIPRIDERGQETMLSFIQKFQM*
ooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooo
iiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ENDFLKEQGMVLLESFVDPVVIYHSKGHTIPRIDERGQETMLSFIQKFQMI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query51
224063289 220 predicted protein [Populus trichocarpa] 0.960 0.222 0.693 5e-12
29773594382 unnamed protein product [Vitis vinifera] 1.0 0.621 0.627 2e-11
225459156 226 PREDICTED: UPF0483 protein AGAP003155 [V 0.960 0.216 0.571 9e-10
42568793 252 esterase/lipase domain-containing protei 0.960 0.194 0.612 2e-09
9759620 234 unnamed protein product [Arabidopsis tha 0.960 0.209 0.612 2e-09
255587568 287 conserved hypothetical protein [Ricinus 0.980 0.174 0.6 4e-09
357485613 227 Ovarian cancer-associated gene 2 protein 0.921 0.207 0.617 5e-09
357489905 227 Hydrolase, putative [Medicago truncatula 0.960 0.215 0.571 5e-09
297794139 253 hypothetical protein ARALYDRAFT_332756 [ 1.0 0.201 0.549 9e-09
356502051 226 PREDICTED: UPF0483 protein C25G4.2-like 0.960 0.216 0.551 1e-08
>gi|224063289|ref|XP_002301079.1| predicted protein [Populus trichocarpa] gi|118485376|gb|ABK94545.1| unknown [Populus trichocarpa] gi|222842805|gb|EEE80352.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 75.1 bits (183), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 40/49 (81%)

Query: 1   ENDFLKEQGMVLLESFVDPVVIYHSKGHTIPRIDERGQETMLSFIQKFQ 49
           E DFLK+ GM LL+  VDPVVI+H KGHTIPR+DE+G ETMLSFI + Q
Sbjct: 166 ETDFLKQYGMELLKCCVDPVVIHHPKGHTIPRLDEKGSETMLSFIDRIQ 214

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297735943|emb|CBI18719.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225459156|ref|XP_002285711.1| PREDICTED: UPF0483 protein AGAP003155 [Vitis vinifera] gi|302142025|emb|CBI19228.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|42568793|ref|NP_201343.2| esterase/lipase domain-containing protein [Arabidopsis thaliana] gi|111074304|gb|ABH04525.1| At5g65400 [Arabidopsis thaliana] gi|332010664|gb|AED98047.1| esterase/lipase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|9759620|dbj|BAB11562.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255587568|ref|XP_002534315.1| conserved hypothetical protein [Ricinus communis] gi|223525516|gb|EEF28071.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|357485613|ref|XP_003613094.1| Ovarian cancer-associated gene 2 protein-like protein [Medicago truncatula] gi|355514429|gb|AES96052.1| Ovarian cancer-associated gene 2 protein-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357489905|ref|XP_003615240.1| Hydrolase, putative [Medicago truncatula] gi|355516575|gb|AES98198.1| Hydrolase, putative [Medicago truncatula] gi|388521045|gb|AFK48584.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|297794139|ref|XP_002864954.1| hypothetical protein ARALYDRAFT_332756 [Arabidopsis lyrata subsp. lyrata] gi|297310789|gb|EFH41213.1| hypothetical protein ARALYDRAFT_332756 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356502051|ref|XP_003519835.1| PREDICTED: UPF0483 protein C25G4.2-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query51
TAIR|locus:2168230252 AT5G65400 "AT5G65400" [Arabido 1.0 0.202 0.615 3.1e-12
TAIR|locus:2135922234 AT4G24380 [Arabidopsis thalian 0.960 0.209 0.489 1.9e-09
TAIR|locus:2168230 AT5G65400 "AT5G65400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 164 (62.8 bits), Expect = 3.1e-12, P = 3.1e-12
 Identities = 32/52 (61%), Positives = 41/52 (78%)

Query:     1 ENDFLKEQGMVLLESFVDPVVIYHSKGHTIPRIDERGQETMLSFIQKF-QMI 51
             E DFLK +G VL+ESFV+PVVI+HS GH IP++D + +ETMLSF Q   QM+
Sbjct:   190 ERDFLKIEGEVLVESFVEPVVIHHSGGHIIPKLDTKAEETMLSFFQSIRQML 241
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM
GO:0005777 "peroxisome" evidence=IDA
TAIR|locus:2135922 AT4G24380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_II0938
SubName- Full=Putative uncharacterized protein; (220 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query51
pfam03959209 pfam03959, FSH1, Serine hydrolase (FSH1) 0.001
>gnl|CDD|217816 pfam03959, FSH1, Serine hydrolase (FSH1) Back     alignment and domain information 
 Score = 33.8 bits (78), Expect = 0.001
 Identities = 10/35 (28%), Positives = 17/35 (48%), Gaps = 3/35 (8%)

Query: 1   ENDFL--KEQGMVLLESFVD-PVVIYHSKGHTIPR 32
           E D +  +E+   L E+  +   V+ H  GH +P 
Sbjct: 167 ELDTVVPEERSEKLAEACKNSATVLEHPGGHFVPN 201

This is a family of serine hydrolases. Length = 209

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 51
KOG2551230 consensus Phospholipase/carboxyhydrolase [Amino ac 99.52
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 98.75
COG0400207 Predicted esterase [General function prediction on 95.14
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 94.3
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 93.67
TIGR03611257 RutD pyrimidine utilization protein D. This protei 92.93
PLN02578354 hydrolase 92.78
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 92.69
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 92.65
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 92.26
PRK07581339 hypothetical protein; Validated 92.03
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 91.8
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 91.41
PRK10673255 acyl-CoA esterase; Provisional 90.19
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 89.87
PRK00175379 metX homoserine O-acetyltransferase; Provisional 87.92
PRK11460232 putative hydrolase; Provisional 87.77
KOG1552258 consensus Predicted alpha/beta hydrolase [General 87.61
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 87.34
PRK02308 303 uvsE putative UV damage endonuclease; Provisional 87.14
PRK00870302 haloalkane dehalogenase; Provisional 85.96
PRK10349256 carboxylesterase BioH; Provisional 85.52
PRK05855 582 short chain dehydrogenase; Validated 84.73
PRK06489360 hypothetical protein; Provisional 83.38
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 83.29
PHA02857276 monoglyceride lipase; Provisional 83.18
PRK05077414 frsA fermentation/respiration switch protein; Revi 83.04
PLN02965255 Probable pheophorbidase 82.19
PF14538154 Raptor_N: Raptor N-terminal CASPase like domain 81.03
PLN02298330 hydrolase, alpha/beta fold family protein 80.36
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 80.26
>KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=99.52  E-value=1.6e-14  Score=93.92  Aligned_cols=49  Identities=35%  Similarity=0.530  Sum_probs=44.8

Q ss_pred             Ccchhhh--hHHHHHhhcCCCeEEEcCCCcccccCChHhHHHHHHHHHHHhc
Q 040514            1 ENDFLKE--QGMVLLESFVDPVVIYHSKGHTIPRIDERGQETMLSFIQKFQM   50 (51)
Q Consensus         1 e~D~~~~--~s~~L~~~F~~p~vi~H~gGH~VP~~~~~~~~~~~~Fl~~~~~   50 (51)
                      ++|+++|  +|+.|+++|.|++|+.|||||+||+.+ +.++.+++||+.+.+
T Consensus       172 ~~D~iv~~~~s~~L~~~~~~a~vl~HpggH~VP~~~-~~~~~i~~fi~~~~~  222 (230)
T KOG2551|consen  172 ETDTIVPSERSEQLAESFKDATVLEHPGGHIVPNKA-KYKEKIADFIQSFLQ  222 (230)
T ss_pred             ccceeecchHHHHHHHhcCCCeEEecCCCccCCCch-HHHHHHHHHHHHHHH
Confidence            5799888  589999999999999999999999998 799999999988753

>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PRK02308 uvsE putative UV damage endonuclease; Provisional Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PF14538 Raptor_N: Raptor N-terminal CASPase like domain Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query51
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 96.85
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 96.12
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 95.99
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 95.29
4f21_A246 Carboxylesterase/phospholipase family protein; str 95.28
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 95.04
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 95.0
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 94.94
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 94.88
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 94.61
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 94.61
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 94.51
3h04_A275 Uncharacterized protein; protein with unknown func 94.49
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 94.49
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 94.36
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 94.3
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 94.26
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 94.21
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 94.18
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 94.0
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 93.92
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 93.81
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 93.77
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 93.44
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 93.34
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 93.32
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 93.28
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 93.26
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 93.24
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 93.23
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 93.11
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 93.0
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 92.94
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 92.84
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 92.77
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 92.76
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 92.53
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 92.5
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 92.48
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 92.35
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 92.35
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 92.3
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 92.25
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 92.24
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 92.09
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 92.03
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 92.02
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 91.93
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 91.84
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 91.77
1iup_A282 META-cleavage product hydrolase; aromatic compound 91.7
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 91.59
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 91.37
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 91.35
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 91.33
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 90.93
4fle_A202 Esterase; structural genomics, PSI-biology, northe 90.6
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 90.55
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 90.55
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 90.55
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 90.53
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 90.38
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 90.34
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 90.02
2x5c_A131 Hypothetical protein ORF131; viral protein; HET: G 90.0
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 89.9
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 89.9
3llc_A270 Putative hydrolase; structural genomics, joint cen 89.79
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 89.77
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 89.67
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 89.66
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 89.65
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 89.39
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 89.29
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 89.14
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 88.99
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 88.96
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 88.88
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 88.87
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 88.74
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 88.73
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 88.69
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 88.6
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 88.57
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 88.43
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 87.95
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 87.85
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 87.74
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 87.72
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 87.65
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 87.6
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 87.59
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 87.34
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 87.29
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 87.08
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 86.76
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 86.69
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 86.48
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 86.25
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 86.14
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 86.11
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 85.97
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 85.91
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 85.73
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 85.34
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 85.23
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 84.8
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 84.79
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 84.76
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 84.61
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 84.59
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 84.5
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 84.44
4az3_B155 Lysosomal protective protein 20 kDa chain; hydrola 84.19
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 83.86
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 83.81
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 83.37
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 83.31
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 83.27
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 83.19
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 82.68
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 82.0
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 81.64
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 81.43
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 81.29
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 81.27
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 81.22
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 81.09
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 81.06
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 80.5
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=96.85  E-value=0.00063  Score=39.97  Aligned_cols=48  Identities=15%  Similarity=0.202  Sum_probs=36.0

Q ss_pred             Ccchhhhh--HHHHHhhcCC--------CeEEEcCCCcccccCChHhHHHHHHHHHHHh
Q 040514            1 ENDFLKEQ--GMVLLESFVD--------PVVIYHSKGHTIPRIDERGQETMLSFIQKFQ   49 (51)
Q Consensus         1 e~D~~~~~--s~~L~~~F~~--------p~vi~H~gGH~VP~~~~~~~~~~~~Fl~~~~   49 (51)
                      +.|.++|.  ++.+.+.+.+        ..++.+++||.+|... ...+.+.+||++..
T Consensus       181 ~~D~~vp~~~~~~~~~~~~~~~g~~~~~~~~~~~~~gH~~~~~~-~~~~~i~~fl~~~~  238 (243)
T 1ycd_A          181 ASDQAVPSVRSKYLYDIYLKAQNGNKEKVLAYEHPGGHMVPNKK-DIIRPIVEQITSSL  238 (243)
T ss_dssp             TTCSSSCHHHHHHHHHHHHHHTTTCTTTEEEEEESSSSSCCCCH-HHHHHHHHHHHHHH
T ss_pred             CCCCccCHHHHHHHHHHhhhhccccccccEEEecCCCCcCCchH-HHHHHHHHHHHHhh
Confidence            46887773  7788888854        4577899999998753 56778899998653
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>2x5c_A Hypothetical protein ORF131; viral protein; HET: GOL; 1.80A {Pyrobaculum spherical virus} Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>4az3_B Lysosomal protective protein 20 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_B* Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query51
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 96.92
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 96.59
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 96.38
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 96.22
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 95.56
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 95.46
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 95.4
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 95.33
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 95.01
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 94.87
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 94.84
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 94.58
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 94.47
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 94.46
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 94.03
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 93.99
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 93.8
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 93.36
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 93.04
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 92.41
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 92.13
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 92.05
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 92.04
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 91.72
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 91.38
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 91.29
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 90.17
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 89.84
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 89.57
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 88.92
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 87.46
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 85.96
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 85.5
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 83.84
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 82.22
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Carboxylesterase/thioesterase 1
domain: Carboxylesterase
species: Bacillus cereus [TaxId: 1396]

Probab=96.92  E-value=0.00028  Score=39.44  Aligned_cols=45  Identities=16%  Similarity=0.189  Sum_probs=34.0

Q ss_pred             Ccchhhh--hHHHHHhhcCC----CeEEEcCCCcccccCChHhHHHHHHHHHHH
Q 040514            1 ENDFLKE--QGMVLLESFVD----PVVIYHSKGHTIPRIDERGQETMLSFIQKF   48 (51)
Q Consensus         1 e~D~~~~--~s~~L~~~F~~----p~vi~H~gGH~VP~~~~~~~~~~~~Fl~~~   48 (51)
                      +.|.++|  .++++.+.+.+    -....+||||.++.   +..+.+.+||++.
T Consensus       151 ~~D~~vp~~~~~~~~~~l~~~g~~~~~~~~~ggH~~~~---~~~~~~~~wl~k~  201 (202)
T d2h1ia1         151 TNDPICSSAESEELKVLLENANANVTMHWENRGHQLTM---GEVEKAKEWYDKA  201 (202)
T ss_dssp             SSCSSSCHHHHHHHHHHHHTTTCEEEEEEESSTTSCCH---HHHHHHHHHHHHH
T ss_pred             cCCCccCHHHHHHHHHHHHHCCCCEEEEEECCCCcCCH---HHHHHHHHHHHHh
Confidence            4688776  37888888853    33567899998865   5677899999874
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure