Citrus Sinensis ID: 040540

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------67
MTTLNDLTTDQSSLLAFKAHAFDYRSALANNWSISYPICSWAGISCGSRHQRVTALNLSDMGLGGTIPLHFGNLSFLVSLDISENNFHGHLPKELGQLRRLRVMSLAYNKLSGSFPSWIGVLSKLRILRLDYNNFTGPIPNSLFNLSRLEMLRAEFNIIGGTIPSRIGNLRKLVNLGLWSCNLQGQIPTEIGSLQNLKNLDLADNKLSGLIPPTIFNISTMRILTLESNQLSGRLPSTIGHSLRNIEYLALSTNNLIGKIPNSITNATKLIGLDLGFNSFSGHIPNTFGNLRHLSVLNVMMNNLTTESSSADQWSFLSSLTNCRNLSNLALASNPLGGILPQLIGNFSASLQNIYAFELGFNDLNGTIPTSIGTLQQLQGFYVPENNLQGYVPHDLCHLERLNILNLSGNKLSGHIPPCLASLTSLRELHLGSNKLSSSIPSSLAFRSFDSECEVLRNVRHRNLIKIISSCSNPDFKALVLEFMPNGSLEKWLYSHNYFLDILERLNIMIDVGSALEYLRHGHSSAPIIHCEGEDSVTQTTTMATIGYMAPEYGSEGIVSAKCDVYSYGVLLMETFTRKRPTDEMFTGEMSLRRWVKESLPHRLSEVVDTNLVREEQAFSAKMDCLLSIMDLALDCCMESPDKRMHMTDAAAKLKKIKVKFLDDVAASS
cccccccHHHHHHHHHHHHccccccccccccccccccccccEEEEEccccccEEEEEccccccEEEccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccEEcccccccccccHHHHHHcccccccccccccEEcccccccccccccEEEcccccccccccccccccccHHHHccccccEEEccccccccccccHHHHHcccccccccccccccEEEEEccccccccccccEEccccccccccccHHHHHcccccEEEccccEEEEEccccccccccccEEEccccEEEEEccccccccccccHHHccccccccccHHHHHccccccccccccccccccccHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccccccccccEEccccccccccccccccccccHHHHHHHHHcccccccccccccccHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHcccc
ccccccccHHHHHHHHHHHHccccccccccccccccccccccEEEEccccccEEEEEEccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEEccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccccEEEccccEEEEEccHHHHHcccccEEEcccccccccccHHHcccccccEEEEccccccccccccccccccHHHcccccccEEEcccccccccccHHHcccccccccEEEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHccccccHEEEEcccccccccccHHHcccccHHHHHHHHHccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccHHEHHccccccccHHcEEEEEcccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHccccHHHccHHHccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccccccc
mttlndlttdqSSLLAFKAHAFDYRSALAnnwsisypicswagiscgsrhqrvtalnlsdmglggtiplhfgnLSFLVSLDisennfhghlpkeLGQLRRLRVMSLAYNklsgsfpswIGVLSKLRILRLdynnftgpipnslfnLSRLEMLRAEFNIIggtipsriGNLRKLVNLGLwscnlqgqipteigslqnlknldladnklsglipptifnISTMRILTLEsnqlsgrlpstighslRNIEYLALSTnnligkipnsiTNATKLIgldlgfnsfsghipntfgnLRHLSVLNVMMNnlttesssaDQWSFLSSLtncrnlsnlalasnplggilpqLIGNFSASLQNIYAFElgfndlngtiptsIGTLQQLqgfyvpennlqgyvphdlchleRLNIlnlsgnklsghippclasltslrelhlgsnklsssipsslafrsfdSECEVLRNVRHRNLIKIISSCSNPDFKALVLefmpngslekwLYSHNYFLDILERLNIMIDVGSALEYLrhghssapiihcegedsvtqttTMATigymapeygsegivsakcDVYSYGVLLMETftrkrptdemftgemSLRRWVKEslphrlsevvdtnlvREEQAFSAKMDCLLSIMDLALDccmespdkrmHMTDAAAKLKKIKVKFLDDVAASS
mttlndlttdqSSLLAFKAHAFDYRSALANNWSISYPICSWAGISCGSRHQRVTALNLSDMGLGGTIPLHFGNLSFLVSLDISENNFHGHLPKELGQLRRLRVMSLAYnklsgsfpswIGVLSKLRILRLDYNNFTGPIPNSLFNLSRLEMLRAEFNIIGGTIPSRIGNLRKLVNLGLWSCNLQGQIPTEIGSLQNLKNLDLADNKLSGLIPPTIFNISTMRILTLESNQLSGRLPSTIGHSLRNIEYLALSTNNLIGKIPNSITNATKLIGLDLGFNSFSGHIPNTFGNLRHLSVLNVMMNNLTTESSSADQWSFLSSLTNCRNLSNLALASNPLGGILPQLIGNFSASLQNIYAFELGFNDLNGTIPTSIGTLQQLQGFYVPENNLQGYVPHDLCHLERLNILNLSGNKLSGHIPPCLASLTSLRELHLGSNKLSSSIPSSLAFRSFDSECEVLRNVRHRNLIKIISSCSNPDFKALVLEFMPNGSLEKWLYSHNYFLDILERLNIMIDVGSALEYLRHGHSSAPIIHCEGEDSVTQTTTMATIGYMAPEYGSEGIVSAKCDVYSYGVLLMEtftrkrptdemftgemslrrwvkeslphrlsevvdtnlVREEQAFSAKMDCLLSIMDLALDCCMESPDKRMHMTDAAAKLKKIKVKFLDDVAASS
MTTLNDLTTDQSSLLAFKAHAFDYRSALANNWSISYPICSWAGISCGSRHQRVTALNLSDMGLGGTIPLHFGNLSFLVSLDISENNFHGHLPKELGQLRRLRVMSLAYNKLSGSFPSWIGVLSKLRILRLDYNNFTGPIPNSLFNLSRLEMLRAEFNIIGGTIPSRIGNLRKLVNLGLWSCNLQGQIPTEIGSlqnlknldladnklSGLIPPTIFNISTMRILTLESNQLSGRLPSTIGHSLRNIEYLALSTNNLIGKIPNSITNATKLIGLDLGFNSFSGHIPNTFGNLRHLSVLNVMMNNLTTESSSADQWSFLSSLTNCRnlsnlalasnPLGGILPQLIGNFSASLQNIYAFELGFNDLNGTIPTSIGTLQQLQGFYVPENNLQGYVPHDLCHLERLNILNLSGNKLSGHIPPCLASLTSLRELHlgsnklsssipsslafrsFDSECEVLRNVRHRNLIKIISSCSNPDFKALVLEFMPNGSLEKWLYSHNYFLDILERLNIMIDVGSALEYLRHGHSSAPIIHCEGEDSVTQTTTMATIGYMAPEYGSEGIVSAKCDVYSYGVLLMETFTRKRPTDEMFTGEMSLRRWVKESLPHRLSEVVDTNLVREEQAFSAKMDCLLSIMDLALDCCMESPDKRMHMTDAAAKLKKIKVKFLDDVAASS
*************LLAFKAHAFDYRSALANNWSISYPICSWAGISCGSRHQRVTALNLSDMGLGGTIPLHFGNLSFLVSLDISENNFHGHLPKELGQLRRLRVMSLAYNKLSGSFPSWIGVLSKLRILRLDYNNFTGPIPNSLFNLSRLEMLRAEFNIIGGTIPSRIGNLRKLVNLGLWSCNLQGQIPTEIGSLQNLKNLDLADNKLSGLIPPTIFNISTMRILTLESNQLSGRLPSTIGHSLRNIEYLALSTNNLIGKIPNSITNATKLIGLDLGFNSFSGHIPNTFGNLRHLSVLNVMMNNLTTESSSADQWSFLSSLTNCRNLSNLALASNPLGGILPQLIGNFSASLQNIYAFELGFNDLNGTIPTSIGTLQQLQGFYVPENNLQGYVPHDLCHLERLNILNLSGNKLSGHIPPCLASLTSLRELHLG***********LAFRSFDSECEVLRNVRHRNLIKIISSCSNPDFKALVLEFMPNGSLEKWLYSHNYFLDILERLNIMIDVGSALEYLRHGHSSAPIIHCEGEDSVTQTTTMATIGYMAPEYGSEGIVSAKCDVYSYGVLLMETFTRKRPTDEMFTGEMSLRRWVKESLPHRLSEVVDTNLVREEQAFSAKMDCLLSIMDLALDCCME*************KLKKIKVKFL*******
MTTLNDLTTDQSSLLAFKAHAFD*R******WSISYPICSWAGISCGSRHQRVTALNLSDMGLGGTIPLHFGNLSFLVSLDISENNFHGHLPKELGQLRRLRVMSLAYNKLSGSFPSWIGVLSKLRILRLDYNNFTGPIPNSLFNLSRLEMLRAEFNIIGGTIPSRIGNLRKLVNLGLWSCNLQGQIPTEIGSLQNLKNLDLADNKLSGLIPPTIFNISTMRILTLESNQLSGRLPSTIGHSLRNIEYLALSTNNLIGKIPNSITNATKLIGLDLGFNSFSGHIPNTFGNLRHLSVLNVMMNNLTTESSSADQWSFLSSLTNCRNLSNLALASNPLGGILPQLIGNFSASLQNIYAFELGFNDLNGTIPTSIGTLQQLQGFYVPENNLQGYVPHDLCHLERLNILNLSGNKLSGHIPPCLASLTSLRELHLGSNKLSSSIPSSLAFRSFDSECEVLRNVRHRNLIKIISSCSNPDFKALVLEFMPNGSLEKWLYSHNYFLDILERLNIMIDVGSALEYLRHGHSSAPIIHCEGEDSVTQTTTMATIGYMAPEYGSEGIVSAKCDVYSYGVLLMETFTRKRPTDEMFTGEMSLRRWVKESLPHRLSEVVDTNLVREEQAFSAKMDCLLSIMDLALDCCMESPDKRMHMTDAAAKLKKIKVKF*DD*****
********TDQSSLLAFKAHAFDYRSALANNWSISYPICSWAGISCGSRHQRVTALNLSDMGLGGTIPLHFGNLSFLVSLDISENNFHGHLPKELGQLRRLRVMSLAYNKLSGSFPSWIGVLSKLRILRLDYNNFTGPIPNSLFNLSRLEMLRAEFNIIGGTIPSRIGNLRKLVNLGLWSCNLQGQIPTEIGSLQNLKNLDLADNKLSGLIPPTIFNISTMRILTLESNQLSGRLPSTIGHSLRNIEYLALSTNNLIGKIPNSITNATKLIGLDLGFNSFSGHIPNTFGNLRHLSVLNVMMNNLTTESSSADQWSFLSSLTNCRNLSNLALASNPLGGILPQLIGNFSASLQNIYAFELGFNDLNGTIPTSIGTLQQLQGFYVPENNLQGYVPHDLCHLERLNILNLSGNKLSGHIPPCLASLTSLRELHLGSNKLSSSIPSSLAFRSFDSECEVLRNVRHRNLIKIISSCSNPDFKALVLEFMPNGSLEKWLYSHNYFLDILERLNIMIDVGSALEYLRHGHSSAPIIHCEGEDSVTQTTTMATIGYMAPEYGSEGIVSAKCDVYSYGVLLMETFTRKRPTDEMFTGEMSLRRWVKESLPHRLSEVVDTNLVREEQAFSAKMDCLLSIMDLALDCCMESPDKRMHMTDAAAKLKKIKVKFLDDVAASS
*****DLTTDQSSLLAFKAHAFDYRSALANNWSISYPICSWAGISCGSRHQRVTALNLSDMGLGGTIPLHFGNLSFLVSLDISENNFHGHLPKELGQLRRLRVMSLAYNKLSGSFPSWIGVLSKLRILRLDYNNFTGPIPNSLFNLSRLEMLRAEFNIIGGTIPSRIGNLRKLVNLGLWSCNLQGQIPTEIGSLQNLKNLDLADNKLSGLIPPTIFNISTMRILTLESNQLSGRLPSTIGHSLRNIEYLALSTNNLIGKIPNSITNATKLIGLDLGFNSFSGHIPNTFGNLRHLSVLNVMMNNLTTESSSADQWSFLSSLTNCRNLSNLALASNPLGGILPQLIGNFSASLQNIYAFELGFNDLNGTIPTSIGTLQQLQGFYVPENNLQGYVPHDLCHLERLNILNLSGNKLSGHIPPCLASLTSLRELHLGSNKLSSSIPSSLAFRSFDSECEVLRNVRHRNLIKIISSCSNPDFKALVLEFMPNGSLEKWLYSHNYFLDILERLNIMIDVGSALEYLRHGHSSAPIIHCEGEDSVTQTTTMATIGYMAPEYGSEGIVSAKCDVYSYGVLLMETFTRKRPTDEMFTGEMSLRRWVKESLPHRLSEVVDTNLVREEQAFSAKMDCLLSIMDLALDCCMESPDKRMHMTDAAAKLKKIK***********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTLNDLTTDQSSLLAFKAHAFDYRSALANNWSISYPICSWAGISCGSRHQRVTALNLSDMGLGGTIPLHFGNLSFLVSLDISENNFHGHLPKELGQLRRLRVMSLAYNKLSGSFPSWIGVLSKLRILRLDYNNFTGPIPNSLFNLSRLEMLRAEFNIIGGTIPSRIGNLRKLVNLGLWSCNLQGQIPTEIGSLQNLKNLDLADNKLSGLIPPTIFNISTMRILTLESNQLSGRLPSTIGHSLRNIEYLALSTNNLIGKIPNSITNATKLIGLDLGFNSFSGHIPNTFGNLRHLSVLNVMMNNLTTESSSADQWSFLSSLTNCRNLSNLALASNPLGGILPQLIGNFSASLQNIYAFELGFNDLNGTIPTSIGTLQQLQGFYVPENNLQGYVPHDLCHLERLNILNLSGNKLSGHIPPCLASLTSLRELHLGSNKLSSSIPSSLAFRSFDSECEVLRNVRHRNLIKIISSCSNPDFKALVLEFMPNGSLEKWLYSHNYFLDILERLNIMIDVGSALEYLRHGHSSAPIIHCEGEDSVTQTTTMATIGYMAPEYGSEGIVSAKCDVYSYGVLLMETFTRKRPTDEMFTGEMSLRRWVKESLPHRLSEVVDTNLVREEQAFSAKMDCLLSIMDLALDCCMESPDKRMHMTDAAAKLKKIKVKFLDDVAASS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query669 2.2.26 [Sep-21-2011]
C0LGP4 1010 Probable LRR receptor-lik yes no 0.644 0.426 0.384 2e-74
C0LGT6 1031 LRR receptor-like serine/ no no 0.644 0.418 0.371 4e-66
Q9SD62 1025 Putative receptor-like pr no no 0.651 0.425 0.360 3e-61
Q9LVP0 1102 Probable leucine-rich rep no no 0.675 0.410 0.342 9e-58
C0LGQ5 1249 LRR receptor-like serine/ no no 0.617 0.330 0.328 1e-55
Q9LP24 1120 Probable leucine-rich rep no no 0.563 0.336 0.343 1e-55
Q9SGP2996 Receptor-like protein kin no no 0.859 0.577 0.293 2e-55
Q9FL28 1173 LRR receptor-like serine/ no no 0.550 0.313 0.364 7e-54
P93194 1109 Receptor-like protein kin N/A no 0.641 0.386 0.315 8e-54
Q9SHI2 1101 Leucine-rich repeat recep no no 0.633 0.385 0.348 4e-53
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function desciption
 Score =  280 bits (717), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 168/437 (38%), Positives = 252/437 (57%), Gaps = 6/437 (1%)

Query: 9   TDQSSLLAFKAHAFDYRSALANNWSISYPICSWAGISCGSRHQRVTALNLSDMGLGGTIP 68
           TD+ +LL FK+   + +  + ++W+ S+P+C+W G++CG +++RVT L L  + LGG I 
Sbjct: 24  TDRQALLQFKSQVSEDKRVVLSSWNHSFPLCNWKGVTCGRKNKRVTHLELGRLQLGGVIS 83

Query: 69  LHFGNLSFLVSLDISENNFHGHLPKELGQLRRLRVMSLAYNKLSGSFPSWIGVLSKLRIL 128
              GNLSFLVSLD+ EN F G +P+E+GQL RL  + +  N L G  P  +   S+L  L
Sbjct: 84  PSIGNLSFLVSLDLYENFFGGTIPQEVGQLSRLEYLDMGINYLRGPIPLGLYNCSRLLNL 143

Query: 129 RLDYNNFTGPIPNSLFNLSRLEMLRAEFNIIGGTIPSRIGNLRKLVNLGLWSCNLQGQIP 188
           RLD N   G +P+ L +L+ L  L    N + G +P+ +GNL  L  L L   NL+G+IP
Sbjct: 144 RLDSNRLGGSVPSELGSLTNLVQLNLYGNNMRGKLPTSLGNLTLLEQLALSHNNLEGEIP 203

Query: 189 TEIGSLQNLKNLDLADNKLSGLIPPTIFNISTMRILTLESNQLSGRLPSTIGHSLRNIEY 248
           +++  L  + +L L  N  SG+ PP ++N+S++++L +  N  SGRL   +G  L N+  
Sbjct: 204 SDVAQLTQIWSLQLVANNFSGVFPPALYNLSSLKLLGIGYNHFSGRLRPDLGILLPNLLS 263

Query: 249 LALSTNNLIGKIPNSITNATKLIGLDLGFNSFSGHIPNTFGNLRHLSVLNVMMNNLTTES 308
             +  N   G IP +++N + L  L +  N+ +G IP TFGN+ +L +L +  N+L ++S
Sbjct: 264 FNMGGNYFTGSIPTTLSNISTLERLGMNENNLTGSIP-TFGNVPNLKLLFLHTNSLGSDS 322

Query: 309 SSADQWSFLSSLTNCRNLSNLALASNPLGGILPQLIGNFSASLQNIYAFELGFNDLNGTI 368
           S      FL+SLTNC  L  L +  N LGG LP  I N SA L      +LG   ++G+I
Sbjct: 323 SR--DLEFLTSLTNCTQLETLGIGRNRLGGDLPISIANLSAKL---VTLDLGGTLISGSI 377

Query: 369 PTSIGTLQQLQGFYVPENNLQGYVPHDLCHLERLNILNLSGNKLSGHIPPCLASLTSLRE 428
           P  IG L  LQ   + +N L G +P  L  L  L  L+L  N+LSG IP  + ++T L  
Sbjct: 378 PYDIGNLINLQKLILDQNMLSGPLPTSLGKLLNLRYLSLFSNRLSGGIPAFIGNMTMLET 437

Query: 429 LHLGSNKLSSSIPSSLA 445
           L L +N     +P+SL 
Sbjct: 438 LDLSNNGFEGIVPTSLG 454

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 Back     alignment and function description
>sp|Q9SD62|Y3471_ARATH Putative receptor-like protein kinase At3g47110 OS=Arabidopsis thaliana GN=At3g47110 PE=3 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q9SGP2|HSL1_ARATH Receptor-like protein kinase HSL1 OS=Arabidopsis thaliana GN=HSL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query669
297740829 1892 unnamed protein product [Vitis vinifera] 0.961 0.339 0.382 1e-134
297743586737 unnamed protein product [Vitis vinifera] 0.925 0.839 0.392 1e-127
302143440 929 unnamed protein product [Vitis vinifera] 0.893 0.643 0.401 1e-119
297740823 791 unnamed protein product [Vitis vinifera] 0.892 0.754 0.412 1e-112
147866276 1326 hypothetical protein VITISV_033547 [Viti 0.872 0.440 0.389 1e-108
302143445 2843 unnamed protein product [Vitis vinifera] 0.769 0.181 0.374 1e-107
297740824725 unnamed protein product [Vitis vinifera] 0.866 0.8 0.387 1e-103
302143439 830 unnamed protein product [Vitis vinifera] 0.871 0.702 0.353 1e-103
255585401 843 serine-threonine protein kinase, plant-t 0.892 0.708 0.388 1e-101
296086336628 unnamed protein product [Vitis vinifera] 0.829 0.883 0.372 1e-101
>gi|297740829|emb|CBI31011.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  484 bits (1246), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 316/826 (38%), Positives = 434/826 (52%), Gaps = 183/826 (22%)

Query: 9    TDQSSLLAFKAH-AFDYRSALANNWSISYPICSWAGISCGSRHQRVTALNLSDMGLGGTI 67
             D+ +L+A KAH  +D +  LA NWS     C+W GISC +  QRV+A+NLS+MGL GTI
Sbjct: 1077 VDEFALIALKAHITYDSQGILATNWSTKSSYCNWYGISCNAPQQRVSAINLSNMGLEGTI 1136

Query: 68   PLHFGNLSFLV-SLDISENNFHGHLPKELGQLRRLRVMSLAYNKLSGSFPSWIGVLSKLR 126
                GNLSFL+  L++  N   G +P+ +  L +L  + L  N+L G  P  +  L  L+
Sbjct: 1137 APQVGNLSFLLQQLNLFNNKLVGGIPEAICNLSKLEELYLGNNQLIGEIPKKMNHLQNLK 1196

Query: 127  ILRLDYNNFTGPIPNSLFNLS------------------RLEMLRAEFNIIGGTIPSRIG 168
            +L    NN TG IP ++FN+S                  +L+++   +N   G+IP+ IG
Sbjct: 1197 VLSFPMNNLTGSIPATIFNISSLLNISLSNNNLSGSQCIQLQVISLAYNDFTGSIPNGIG 1256

Query: 169  NLRKLVNLGLWSCNLQGQIPTEIGSLQNLKNLDLADNKLSGLIPPTIFNISTMRILTLES 228
            NL + ++L +      G IP  IGSL NL+ L L  NKL+G IP  I N+S + IL L S
Sbjct: 1257 NLLRGLSLSI--NQFTGGIPQAIGSLSNLEELYLNYNKLTGGIPREIGNLSNLNILQLGS 1314

Query: 229  -------------NQLSGRLPSTIGHSLRNIEYLALSTNNLIGKIPNSITNATKLIGLDL 275
                         N LSG+LP+T+    R +  LAL  N   G IP  I N +KL  +DL
Sbjct: 1315 NGISGPIPAEIFTNHLSGQLPTTLSLC-RELLSLALPMNKFTGSIPREIGNLSKLEEIDL 1373

Query: 276  GFNSFSGHIPNTFGNLRHLSVLNVMMNNLTTESSSADQWSFLSSLTNCRNLSNLALASNP 335
              NS  G IP +FGNL  L  L + +     E S     +   S++N   L+ L+L+ N 
Sbjct: 1374 SENSLIGSIPTSFGNLMTLKFLRLYIG--INEFSG----TIPMSISNMSKLTVLSLSDNS 1427

Query: 336  LGGILPQLIGNFSASLQ---------------------NIYAFELGFNDLNGTIPTSIGT 374
              G LP  +GN   +L+                     N+   +LG NDL G+IPT++G 
Sbjct: 1428 FTGTLPNSLGNLPIALEIFIASACQFRGTIPTGIGNLTNLIWLDLGANDLTGSIPTTLGQ 1487

Query: 375  LQQLQGFYVPENNLQGYVPHDLCHLERL--------------NI---------------- 404
            LQ+LQ   +  N ++G +P+DLCHL+ L              NI                
Sbjct: 1488 LQKLQALSIVGNRIRGSIPNDLCHLKNLGYLQLSLDSNVLAFNIPMSFWSLRDLLVLNLS 1547

Query: 405  ---------------LNLSGNKLSGHIPPCLASLTSLRELHLGSNKLSSSIPSSLAFRSF 449
                           L+LS N LSG IP  L +L  L+ L++  NKL   IP+   F  F
Sbjct: 1548 SNFLTEFGDLVSLESLDLSQNNLSGTIPKTLEALIYLKYLNVSFNKLQGEIPNGGPFVKF 1607

Query: 450  ----------------------------------------------DSECEVLRNVRHRN 463
                                                          +SECEV++ +RHRN
Sbjct: 1608 TAESFMFNEALCGAPHFQVMAWVLSNGLTVAIKVFNLEFQGALRSFNSECEVMQGIRHRN 1667

Query: 464  LIKIISSCSNPDFKALVLEFMPNGSLEKWLYSHNYFLDILERLNIMIDVGSALEYLRHGH 523
            L++II+ CSN DFKALVL++MPNGSLEK LYSH YFLD+++RLNIMIDV SALEYL H  
Sbjct: 1668 LVRIITCCSNLDFKALVLKYMPNGSLEKLLYSHYYFLDLIQRLNIMIDVASALEYLHHDC 1727

Query: 524  SSAPIIHCEGE--------------------------DSVTQTTTMATIGYMAPEYGSEG 557
            SS  ++HC+ +                          +S+ QT T++TIGYMAPE+GS G
Sbjct: 1728 SSL-VVHCDLKPSNVLLDDDMVAHVADFGIAKLLTETESMQQTKTLSTIGYMAPEHGSAG 1786

Query: 558  IVSAKCDVYSYGVLLMETFTRKRPTDEMFTGEMSLRRWVKESLPHRLSEVVDTNLV-REE 616
            IVS K DVYSYG+LLME F RK+P DEMFTG+++L+ WV ESL + + +VVD NL+ RE+
Sbjct: 1787 IVSTKSDVYSYGILLMEVFARKKPMDEMFTGDLTLKTWV-ESLSNSVIQVVDVNLLRRED 1845

Query: 617  QAFSAKMDCLLSIMDLALDCCMESPDKRMHMTDAAAKLKKIKVKFL 662
            +  + K+ CL SIM LAL C  +SP++R+ M DA  +LKK ++K L
Sbjct: 1846 EDLATKLSCLSSIMALALACTTDSPEERIDMKDAVVELKKSRIKLL 1891

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297743586|emb|CBI36453.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143440|emb|CBI22001.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297740823|emb|CBI31005.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147866276|emb|CAN79935.1| hypothetical protein VITISV_033547 [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143445|emb|CBI22006.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297740824|emb|CBI31006.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143439|emb|CBI22000.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255585401|ref|XP_002533396.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223526770|gb|EEF28996.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|296086336|emb|CBI31777.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query669
TAIR|locus:2079142 1010 AT3G47570 [Arabidopsis thalian 0.620 0.410 0.370 3.4e-111
TAIR|locus:2075631 1009 AT3G47090 [Arabidopsis thalian 0.623 0.413 0.355 4.5e-105
TAIR|locus:2079157 1011 AT3G47580 [Arabidopsis thalian 0.623 0.412 0.348 2e-104
UNIPROTKB|Q40640 1025 Xa21 "Receptor kinase-like pro 0.624 0.407 0.365 1.6e-102
TAIR|locus:2075661 1025 AT3G47110 [Arabidopsis thalian 0.623 0.406 0.343 4.1e-100
TAIR|locus:2149922 1031 EFR "EF-TU receptor" [Arabidop 0.621 0.403 0.353 1e-99
TAIR|locus:2131518 1091 AT4G26540 [Arabidopsis thalian 0.544 0.333 0.351 1.7e-74
TAIR|locus:2085949 1141 AT3G24240 [Arabidopsis thalian 0.559 0.327 0.338 2.4e-74
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.606 0.362 0.330 2.5e-70
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.584 0.312 0.329 2.5e-70
TAIR|locus:2079142 AT3G47570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 685 (246.2 bits), Expect = 3.4e-111, Sum P(3) = 3.4e-111
 Identities = 156/421 (37%), Positives = 235/421 (55%)

Query:     9 TDQSSLLAFKAHAFDYRSALANNWSISYPICSWAGISCGSRHQRVTALNLSDMGLGGTIP 68
             TD+ +LL FK+   + +  + ++W+ S+P+C+W G++CG +++RVT L L  + LGG I 
Sbjct:    24 TDRQALLQFKSQVSEDKRVVLSSWNHSFPLCNWKGVTCGRKNKRVTHLELGRLQLGGVIS 83

Query:    69 LHFGNLSFLVSLDISENNFHGHLPKELGQLRRLRVMSLAYNKLSGSFPSWIGVLSKLRIL 128
                GNLSFLVSLD+ EN F G +P+E+GQL RL  + +  N L G  P  +   S+L  L
Sbjct:    84 PSIGNLSFLVSLDLYENFFGGTIPQEVGQLSRLEYLDMGINYLRGPIPLGLYNCSRLLNL 143

Query:   129 RLDYNNFTGPIPNSLFNLSRLEMLRAEFNIIGGTIPSRIGNLRKLVNLGLWSCNLQGQIP 188
             RLD N   G +P+ L +L+ L  L    N + G +P+ +GNL  L  L L   NL+G+IP
Sbjct:   144 RLDSNRLGGSVPSELGSLTNLVQLNLYGNNMRGKLPTSLGNLTLLEQLALSHNNLEGEIP 203

Query:   189 TEIGSXXXXXXXXXXXXXXSGLIPPTIFNISTMRILTLESNQLSGRLPSTIGHSLRNIEY 248
             +++                SG+ PP ++N+S++++L +  N  SGRL   +G  L N+  
Sbjct:   204 SDVAQLTQIWSLQLVANNFSGVFPPALYNLSSLKLLGIGYNHFSGRLRPDLGILLPNLLS 263

Query:   249 LALSTNNLIGKIPNSITNATKLIGLDLGFNSFSGHIPNTFGNLRHLSVLNVMMNNLTTES 308
               +  N   G IP +++N + L  L +  N+ +G IP TFGN+ +L +L +  N+L ++S
Sbjct:   264 FNMGGNYFTGSIPTTLSNISTLERLGMNENNLTGSIP-TFGNVPNLKLLFLHTNSLGSDS 322

Query:   309 SSADQWSFLSSLTNCRXXXXXXXXXXPLGGILPQLIGNFSASLQNIYAFELGFNDLNGTI 368
             S      FL+SLTNC            LGG LP  I N SA L  +   +LG   ++G+I
Sbjct:   323 SR--DLEFLTSLTNCTQLETLGIGRNRLGGDLPISIANLSAKLVTL---DLGGTLISGSI 377

Query:   369 PTSIGTLQQLQGFYVPENNLQGYVPHDLCHLERLNILNLSGNKLSGHIPPCLASLTSLRE 428
             P  IG L  LQ   + +N L G +P  L  L  L  L+L  N+LSG IP  + ++T L  
Sbjct:   378 PYDIGNLINLQKLILDQNMLSGPLPTSLGKLLNLRYLSLFSNRLSGGIPAFIGNMTMLET 437

Query:   429 L 429
             L
Sbjct:   438 L 438
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2075631 AT3G47090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079157 AT3G47580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40640 Xa21 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2075661 AT3G47110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149922 EFR "EF-TU receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131518 AT4G26540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query669
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-64
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-61
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-52
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-26
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-26
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 3e-23
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 2e-21
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 4e-20
pfam00069260 pfam00069, Pkinase, Protein kinase domain 1e-18
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 5e-18
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 1e-17
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 1e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-14
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 1e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-12
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 1e-11
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 2e-11
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-11
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 3e-10
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 4e-10
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 5e-10
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 1e-09
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 3e-09
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 3e-09
cd05094291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 5e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-09
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-08
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 1e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-08
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 2e-08
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 2e-08
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 2e-08
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 2e-08
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 5e-08
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 6e-08
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 6e-08
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 6e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-08
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 2e-07
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 2e-07
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 3e-07
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 7e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-07
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 9e-07
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 1e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-06
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 2e-06
cd05063268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 3e-06
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 9e-06
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 9e-06
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 1e-05
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 1e-05
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 3e-05
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 3e-05
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 3e-05
cd05093288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 4e-05
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 4e-05
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 5e-05
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 9e-05
cd05046275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 1e-04
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 1e-04
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 1e-04
cd05090283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 1e-04
cd05051296 cd05051, PTKc_DDR, Catalytic domain of the Protein 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 2e-04
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 2e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-04
cd05098307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 2e-04
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 4e-04
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 4e-04
cd05089297 cd05089, PTKc_Tie1, Catalytic domain of the Protei 6e-04
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 6e-04
cd05035273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 8e-04
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 8e-04
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 0.001
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 0.001
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 0.001
cd05064266 cd05064, PTKc_EphR_A10, Catalytic domain of the Pr 0.001
cd05088303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 0.001
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 0.001
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 0.002
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 0.002
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  228 bits (582), Expect = 6e-64
 Identities = 148/405 (36%), Positives = 215/405 (53%), Gaps = 22/405 (5%)

Query: 56  LNLSDMGLGGTIPLHFGNLSFLVSLDISENNFHGHLPKELGQLRRLRVMSLAYNKLSGSF 115
           L+L    L G IP    NL+ L  L ++ N   G +P+ELGQ++ L+ + L YN LSG  
Sbjct: 169 LDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEI 228

Query: 116 PSWIGVLSKLRILRLDYNNFTGPIPNSLFNLSRLEMLRAEFNIIGGTIPSRIGNLRKLVN 175
           P  IG L+ L  L L YNN TGPIP+SL NL  L+ L    N + G IP  I +L+KL++
Sbjct: 229 PYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLIS 288

Query: 176 LGLWSCNLQGQIPTEIGSLQNLKNLDLADNKLSGLIPPTIFNISTMRILTLESNQLSGRL 235
           L L   +L G+IP  +  LQNL+ L L  N  +G IP  + ++  +++L L SN+ SG +
Sbjct: 289 LDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEI 348

Query: 236 PSTIGHSLRNIEYLALSTNNLIGKIPNSITNATKLIGLDLGFNSFSGHIPNTFGNLRHLS 295
           P  +G    N+  L LSTNNL G+IP  + ++  L  L L  NS  G IP + G  R L 
Sbjct: 349 PKNLGKH-NNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLR 407

Query: 296 VLNVMMNNLTTE----------------SSSADQWSFLSSLTNCRNLSNLALASNPLGGI 339
            + +  N+ + E                S++  Q    S   +  +L  L+LA N   G 
Sbjct: 408 RVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGG 467

Query: 340 LPQLIGNFSASLQNIYAFELGFNDLNGTIPTSIGTLQQLQGFYVPENNLQGYVPHDLCHL 399
           LP   G  S  L+N+   +L  N  +G +P  +G+L +L    + EN L G +P +L   
Sbjct: 468 LPDSFG--SKRLENL---DLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSC 522

Query: 400 ERLNILNLSGNKLSGHIPPCLASLTSLRELHLGSNKLSSSIPSSL 444
           ++L  L+LS N+LSG IP   + +  L +L L  N+LS  IP +L
Sbjct: 523 KKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNL 567

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 669
PLN00113968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG1187361 consensus Serine/threonine protein kinase [Signal 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0192362 consensus Tyrosine kinase specific for activated ( 100.0
KOG0581364 consensus Mitogen-activated protein kinase kinase 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0197468 consensus Tyrosine kinases [Signal transduction me 99.97
KOG4721 904 consensus Serine/threonine protein kinase, contain 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 99.96
KOG0578550 consensus p21-activated serine/threonine protein k 99.95
KOG0575 592 consensus Polo-like serine/threonine protein kinas 99.95
KOG1026774 consensus Nerve growth factor receptor TRKA and re 99.95
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.95
KOG0595 429 consensus Serine/threonine-protein kinase involved 99.95
KOG0582 516 consensus Ste20-like serine/threonine protein kina 99.94
PHA02988283 hypothetical protein; Provisional 99.94
KOG0201 467 consensus Serine/threonine protein kinase [Signal 99.94
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 99.94
KOG0198313 consensus MEKK and related serine/threonine protei 99.94
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 99.94
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 99.94
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 99.93
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 99.93
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.93
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 99.93
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.93
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.92
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 99.92
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 99.92
KOG0584 632 consensus Serine/threonine protein kinase [General 99.92
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.92
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.92
KOG0661 538 consensus MAPK related serine/threonine protein ki 99.92
KOG0598357 consensus Ribosomal protein S6 kinase and related 99.92
KOG0583370 consensus Serine/threonine protein kinase [Signal 99.92
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.92
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.92
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.92
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.92
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.92
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.92
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.91
KOG0599 411 consensus Phosphorylase kinase gamma subunit [Carb 99.91
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.91
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 99.91
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.91
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.91
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.91
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.91
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.91
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.91
KOG0577 948 consensus Serine/threonine protein kinase [Signal 99.91
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.91
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.91
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.91
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.91
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.91
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.9
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.9
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.9
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.9
PTZ00267 478 NIMA-related protein kinase; Provisional 99.9
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 99.9
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.9
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 99.9
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.9
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.9
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.9
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.9
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.9
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.9
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 99.9
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.9
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 99.9
KOG0610459 consensus Putative serine/threonine protein kinase 99.9
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.9
KOG0596677 consensus Dual specificity; serine/threonine and t 99.9
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 99.9
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.9
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.9
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.9
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.9
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.9
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.9
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.9
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.9
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.9
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.9
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.9
KOG0589 426 consensus Serine/threonine protein kinase [General 99.9
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.9
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.9
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.9
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.9
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.9
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.9
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.9
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.9
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.9
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.9
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.9
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 99.89
KOG1989 738 consensus ARK protein kinase family [Signal transd 99.89
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.89
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.89
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.89
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.89
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.89
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.89
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.89
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.89
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.89
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.89
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.89
PLN032101153 Resistant to P. syringae 6; Provisional 99.89
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.89
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.89
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.89
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.89
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.89
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.89
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.89
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.89
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.89
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.89
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.89
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.89
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.89
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.89
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.89
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.89
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.89
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.89
KOG4717 864 consensus Serine/threonine protein kinase [Signal 99.89
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.89
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.89
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.89
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.89
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.89
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.89
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.89
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.89
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.89
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.89
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.89
PLN032101153 Resistant to P. syringae 6; Provisional 99.89
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.89
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.89
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.89
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.89
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.88
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.88
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.88
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 99.88
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.88
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.88
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.88
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.88
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.88
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.88
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.88
PHA03212391 serine/threonine kinase US3; Provisional 99.88
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.88
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.88
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.88
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.88
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.88
KOG0616355 consensus cAMP-dependent protein kinase catalytic 99.88
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.88
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.88
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.88
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.88
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.88
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.88
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.88
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.88
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.88
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.88
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.88
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.88
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.88
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 99.88
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.88
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.88
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.88
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.88
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.88
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.88
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.87
KOG0200609 consensus Fibroblast/platelet-derived growth facto 99.87
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 99.87
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.87
PHA03207392 serine/threonine kinase US3; Provisional 99.87
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.87
KOG0605550 consensus NDR and related serine/threonine kinases 99.87
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.87
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.87
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.87
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.87
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.87
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 99.87
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.87
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.87
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.87
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 99.87
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.87
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.87
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.87
PHA03211461 serine/threonine kinase US3; Provisional 99.87
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.87
PTZ00036440 glycogen synthase kinase; Provisional 99.87
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.87
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.87
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.87
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.87
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.87
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.87
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.87
PHA03209357 serine/threonine kinase US3; Provisional 99.87
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.87
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.87
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.87
PTZ00283 496 serine/threonine protein kinase; Provisional 99.87
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.87
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.87
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.87
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.87
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.87
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.87
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.87
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.87
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.87
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.87
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.87
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.87
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.87
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.87
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.87
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.87
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.87
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.87
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.87
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.86
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.86
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 99.86
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.86
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.86
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.86
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.86
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.86
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.86
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.86
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.86
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.86
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.86
KOG0694694 consensus Serine/threonine protein kinase [Signal 99.86
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.86
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.86
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.86
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.86
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.86
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.86
KOG4237498 consensus Extracellular matrix protein slit, conta 99.86
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.86
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.86
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.86
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.86
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.86
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.86
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.86
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.86
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.86
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 99.86
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.85
KOG0611 668 consensus Predicted serine/threonine protein kinas 99.85
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.85
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.85
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.85
KOG3653534 consensus Transforming growth factor beta/activin 99.85
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.85
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.85
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.85
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.85
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.85
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.85
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.85
KOG0660359 consensus Mitogen-activated protein kinase [Signal 99.85
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.85
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.85
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.85
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.85
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.85
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.85
KOG2052513 consensus Activin A type IB receptor, serine/threo 99.85
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.85
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.85
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.85
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.85
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.85
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.85
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.85
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.85
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.85
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.85
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.84
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.84
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.84
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 99.84
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.84
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.84
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.84
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.84
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.84
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.84
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.84
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.84
KOG0607463 consensus MAP kinase-interacting kinase and relate 99.84
PTZ00284467 protein kinase; Provisional 99.84
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.84
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.84
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 99.84
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.84
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.84
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.84
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.84
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.84
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.84
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.84
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.84
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.84
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.84
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.84
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.83
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.83
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.83
KOG0663419 consensus Protein kinase PITSLRE and related kinas 99.83
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.83
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.83
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.83
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.83
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.83
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.83
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.83
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.83
PLN00009294 cyclin-dependent kinase A; Provisional 99.83
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.82
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.82
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.82
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.82
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.82
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.82
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.82
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.82
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.82
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.82
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.82
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.82
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.82
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.82
PHA03210501 serine/threonine kinase US3; Provisional 99.82
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.81
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.81
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.81
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.81
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.81
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.81
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.8
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.8
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.8
KOG0586 596 consensus Serine/threonine protein kinase [General 99.8
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 99.8
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.8
PHA02882294 putative serine/threonine kinase; Provisional 99.8
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.8
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.8
KOG4237498 consensus Extracellular matrix protein slit, conta 99.8
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.8
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
PLN00181 793 protein SPA1-RELATED; Provisional 99.79
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.79
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.79
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.79
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 99.79
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.78
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.78
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.78
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.78
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.77
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 99.77
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 99.76
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.76
KOG0690516 consensus Serine/threonine protein kinase [Signal 99.75
KOG0617264 consensus Ras suppressor protein (contains leucine 99.75
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.74
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.74
KOG1151775 consensus Tousled-like protein kinase [Signal tran 99.74
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.74
KOG0617264 consensus Ras suppressor protein (contains leucine 99.73
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.72
KOG0671415 consensus LAMMER dual specificity kinases [Signal 99.72
KOG0695593 consensus Serine/threonine protein kinase [Signal 99.71
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.7
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
KOG1027 903 consensus Serine/threonine protein kinase and endo 99.69
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.69
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 99.68
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 99.67
KOG06081034 consensus Warts/lats-like serine threonine kinases 99.67
KOG0666 438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.66
PLN03224507 probable serine/threonine protein kinase; Provisio 99.64
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 99.64
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.64
PLN03150623 hypothetical protein; Provisional 99.63
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 99.62
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.59
KOG1152772 consensus Signal transduction serine/threonine kin 99.54
KOG0664 449 consensus Nemo-like MAPK-related serine/threonine 99.54
KOG1167418 consensus Serine/threonine protein kinase of the C 99.53
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.51
KOG1345378 consensus Serine/threonine kinase [Signal transduc 99.48
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.48
KOG1290 590 consensus Serine/threonine protein kinase [Signal 99.43
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.42
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 99.38
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.37
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 99.3
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.29
PLN03150623 hypothetical protein; Provisional 99.25
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.21
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.19
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 99.18
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.02
KOG1266 458 consensus Protein kinase [Signal transduction mech 99.02
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.01
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.01
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.88
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.87
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.87
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.86
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.85
KOG0606 1205 consensus Microtubule-associated serine/threonine 98.84
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.83
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.82
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.81
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.8
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.79
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.73
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.72
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.66
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.65
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 98.63
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 98.54
KOG0590 601 consensus Checkpoint kinase and related serine/thr 98.54
KOG06061205 consensus Microtubule-associated serine/threonine 98.33
PRK09188365 serine/threonine protein kinase; Provisional 98.27
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.26
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.12
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.12
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 98.11
PRK12274218 serine/threonine protein kinase; Provisional 98.07
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.02
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.96
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.88
PRK10345210 hypothetical protein; Provisional 97.84
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.81
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.8
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.79
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.77
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.69
PRK15386426 type III secretion protein GogB; Provisional 97.67
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 97.65
PRK15386426 type III secretion protein GogB; Provisional 97.52
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.51
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.43
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.42
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 97.41
PRK09605535 bifunctional UGMP family protein/serine/threonine 97.41
PRK14879211 serine/threonine protein kinase; Provisional 97.38
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 97.34
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.33
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 97.32
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 97.29
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 97.23
KOG1243 690 consensus Protein kinase [General function predict 97.23
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.22
KOG0601 524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 97.21
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.16
KOG0576 829 consensus Mitogen-activated protein kinase kinase 96.68
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.66
COG4248 637 Uncharacterized protein with protein kinase and he 96.48
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.46
smart00090237 RIO RIO-like kinase. 96.44
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 96.44
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.43
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=8.6e-78  Score=709.13  Aligned_cols=643  Identities=31%  Similarity=0.520  Sum_probs=432.8

Q ss_pred             ChhhHHHHHHHHhhcCCCcccccCCCCCCCCCCCccceeeCCCCCCEEEEEcCCCCCcccccccccCCCCCCEEeCCCCc
Q 040540            7 LTTDQSSLLAFKAHAFDYRSALANNWSISYPICSWAGISCGSRHQRVTALNLSDMGLGGTIPLHFGNLSFLVSLDISENN   86 (669)
Q Consensus         7 ~~~~~~~l~~~~~~~~~~~~~l~~~w~~~~~~c~~~g~~c~~~~~~v~~L~ls~~~l~~~~~~~~~~l~~L~~L~Ls~N~   86 (669)
                      ...|+.||++||+++.++.+.+.+ |+...++|.|.|++|.. .++|+.|||++++++|.++..|..+++|++|+|++|.
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~-w~~~~~~c~w~gv~c~~-~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~  104 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSN-WNSSADVCLWQGITCNN-SSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQ  104 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCC-CCCCCCCCcCcceecCC-CCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCc
Confidence            457899999999999777766654 98777899999999975 3589999999999888888888888888888888888


Q ss_pred             CcccCCcccC-CCCCCCEEEccCCcCC----------------------ccCCccccCCcccccccccccCccccCCccc
Q 040540           87 FHGHLPKELG-QLRRLRVMSLAYNKLS----------------------GSFPSWIGVLSKLRILRLDYNNFTGPIPNSL  143 (669)
Q Consensus        87 l~~~~p~~l~-~l~~L~~L~L~~n~l~----------------------~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~  143 (669)
                      +.+.+|..+. .+++|++|+|++|.+.                      +.+|..++++++|++|+|++|.+++.+|..+
T Consensus       105 ~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~  184 (968)
T PLN00113        105 LSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSL  184 (968)
T ss_pred             cCCcCChHHhccCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhh
Confidence            8877776543 5556666655555544                      4455556666666666666666666666666


Q ss_pred             CCCCCCCeeecccccccccCCcccCCCCCCCEEEcccCCCcccCCccccCCCCCCEEEccCCCCCCCCCccccCCCCCcE
Q 040540          144 FNLSRLEMLRAEFNIIGGTIPSRIGNLRKLVNLGLWSCNLQGQIPTEIGSLQNLKNLDLADNKLSGLIPPTIFNISTMRI  223 (669)
Q Consensus       144 ~~l~~L~~L~l~~n~l~~~~p~~~~~L~~L~~L~l~~n~l~~~~p~~~~~l~~L~~L~l~~N~l~~~~p~~~~~l~~L~~  223 (669)
                      +++++|++|++++|.+.+.+|..++++++|++|++++|.+++.+|..++.+++|++|++++|.+++.+|..+.++++|+.
T Consensus       185 ~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~  264 (968)
T PLN00113        185 TNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQY  264 (968)
T ss_pred             hhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCE
Confidence            66666666666666666666666666666666666666666666666666666666666666666555666666666666


Q ss_pred             EEcccCCCccccchhhhccCCCCCeeecccCcccccCCccccCCCCCCEEeCCCCCccccCcccc---------------
Q 040540          224 LTLESNQLSGRLPSTIGHSLRNIEYLALSTNNLIGKIPNSITNATKLIGLDLGFNSFSGHIPNTF---------------  288 (669)
Q Consensus       224 L~l~~n~l~~~~p~~~~~~l~~L~~L~ls~n~l~~~~p~~~~~l~~L~~L~ls~n~l~~~~p~~~---------------  288 (669)
                      |++++|.+.+.+|..+. .+++|++|++++|++.+.+|..+.++++|+.|++++|.+.+.+|..+               
T Consensus       265 L~L~~n~l~~~~p~~l~-~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~  343 (968)
T PLN00113        265 LFLYQNKLSGPIPPSIF-SLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNK  343 (968)
T ss_pred             EECcCCeeeccCchhHh-hccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCC
Confidence            66666655555555544 35555555555555555555544444455555544444444444444               


Q ss_pred             ---------CCCCCCCEEEccCCccccCCCCC--------------cc--cccccccCCCCCCCEEECcCCCCccccchh
Q 040540          289 ---------GNLRHLSVLNVMMNNLTTESSSA--------------DQ--WSFLSSLTNCRNLSNLALASNPLGGILPQL  343 (669)
Q Consensus       289 ---------~~l~~L~~L~l~~N~l~~~~~~~--------------~~--~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~  343 (669)
                               ..+++|+.|+++.|++.+.....              +.  ......+..+++|+.|++++|.+.+..|..
T Consensus       344 l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~  423 (968)
T PLN00113        344 FSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSE  423 (968)
T ss_pred             CcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChh
Confidence                     44444444444444443211000              00  000011122233333333333332222211


Q ss_pred             Hhhh-------------------------------------------------------------------hccccccce
Q 040540          344 IGNF-------------------------------------------------------------------SASLQNIYA  356 (669)
Q Consensus       344 ~~~~-------------------------------------------------------------------~~~l~~l~~  356 (669)
                      +...                                                                   ...+..|..
T Consensus       424 ~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~  503 (968)
T PLN00113        424 FTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQ  503 (968)
T ss_pred             HhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccccccceEEECcCCccCCccChhhhhhhccCE
Confidence            1000                                                                   011334455


Q ss_pred             EeecCcccCCCCCccccccCCCcEEecCCCcccccCchhhcCCCCCCeeeCcCCccceeCcccccCCCCCCEEECCCCcc
Q 040540          357 FELGFNDLNGTIPTSIGTLQQLQGFYVPENNLQGYVPHDLCHLERLNILNLSGNKLSGHIPPCLASLTSLRELHLGSNKL  436 (669)
Q Consensus       357 l~l~~n~l~~~~~~~~~~l~~L~~l~l~~n~~~~~~p~~~~~l~~L~~L~ls~n~l~~~~p~~l~~l~~L~~L~l~~N~l  436 (669)
                      +++++|.+.+.+|..+..+++|+.|++++|.+++.+|..+..+++|+.|++++|++++.+|..+..+.+|+.+++++|++
T Consensus       504 L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l  583 (968)
T PLN00113        504 LKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHL  583 (968)
T ss_pred             EECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcc
Confidence            55666666666666667777777777777777777777777788888888888888888888888888888888888888


Q ss_pred             eecCCcccc-------------------------------------------------------------------cc--
Q 040540          437 SSSIPSSLA-------------------------------------------------------------------FR--  447 (669)
Q Consensus       437 ~~~~p~~~~-------------------------------------------------------------------~~--  447 (669)
                      .+.+|....                                                                   .+  
T Consensus       584 ~~~~p~~~~~~~~~~~~~~~n~~lc~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  663 (968)
T PLN00113        584 HGSLPSTGAFLAINASAVAGNIDLCGGDTTSGLPPCKRVRKTPSWWFYITCTLGAFLVLALVAFGFVFIRGRNNLELKRV  663 (968)
T ss_pred             eeeCCCcchhcccChhhhcCCccccCCccccCCCCCccccccceeeeehhHHHHHHHHHHHHHHHHHHHHhhhccccccc
Confidence            765542100                                                                   00  


Q ss_pred             -----------------------------------------------------------------cCchhhhhhcccccc
Q 040540          448 -----------------------------------------------------------------SFDSECEVLRNVRHR  462 (669)
Q Consensus       448 -----------------------------------------------------------------~~~~e~~~l~~l~h~  462 (669)
                                                                                       ....|+..+++++||
T Consensus       664 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ig~G~~g~Vy~~~~~~~~~~vavK~~~~~~~~~~~~~~~l~~l~Hp  743 (968)
T PLN00113        664 ENEDGTWELQFFDSKVSKSITINDILSSLKEENVISRGKKGASYKGKSIKNGMQFVVKEINDVNSIPSSEIADMGKLQHP  743 (968)
T ss_pred             ccccccccccccccccchhhhHHHHHhhCCcccEEccCCCeeEEEEEECCCCcEEEEEEccCCccccHHHHHHHhhCCCC
Confidence                                                                             001235556778899


Q ss_pred             ccceeccccccccccceeeccCCCCChHHhhhcCCCccCHHHHHHHHHhHHhhhhhhhcCCCCCCeeecCCCCcc-----
Q 040540          463 NLIKIISSCSNPDFKALVLEFMPNGSLEKWLYSHNYFLDILERLNIMIDVGSALEYLRHGHSSAPIIHCEGEDSV-----  537 (669)
Q Consensus       463 niv~l~~~~~~~~~~~lv~ey~~~g~L~~~l~~~~~~l~~~~~~~i~~~i~~~l~~lh~~~~~~~i~h~d~~~~~-----  537 (669)
                      |+++++++|......++|||||++|+|.++++.    ++|.++.+|+.|+++|++|+|+. +.++++|||+|+..     
T Consensus       744 nIv~~~~~~~~~~~~~lv~Ey~~~g~L~~~l~~----l~~~~~~~i~~~ia~~L~yLH~~-~~~~iiH~dlkp~Nil~~~  818 (968)
T PLN00113        744 NIVKLIGLCRSEKGAYLIHEYIEGKNLSEVLRN----LSWERRRKIAIGIAKALRFLHCR-CSPAVVVGNLSPEKIIIDG  818 (968)
T ss_pred             CcceEEEEEEcCCCCEEEEeCCCCCcHHHHHhc----CCHHHHHHHHHHHHHHHHHhccC-CCCCeecCCCCHHhEEECC
Confidence            999999999998899999999999999999963    79999999999999999999965 46799999999541     


Q ss_pred             ---------------cccccccccccCccccccCCCcCccccchhhHHHHHHHHhCCCCCCcCCCCCccHHHHHHHhCCC
Q 040540          538 ---------------TQTTTMATIGYMAPEYGSEGIVSAKCDVYSYGVLLMETFTRKRPTDEMFTGEMSLRRWVKESLPH  602 (669)
Q Consensus       538 ---------------~~~~~~gt~~y~aPE~~~~~~~~~~~Dv~s~Gvil~el~tg~~p~~~~~~~~~~l~~~~~~~~~~  602 (669)
                                     ......||++|||||+..+..++.|+|||||||++|||+||+.||+........+.+|++.....
T Consensus       819 ~~~~~~~~~~~~~~~~~~~~~~t~~y~aPE~~~~~~~~~~sDv~S~Gvvl~el~tg~~p~~~~~~~~~~~~~~~~~~~~~  898 (968)
T PLN00113        819 KDEPHLRLSLPGLLCTDTKCFISSAYVAPETRETKDITEKSDIYGFGLILIELLTGKSPADAEFGVHGSIVEWARYCYSD  898 (968)
T ss_pred             CCceEEEeccccccccCCCccccccccCcccccCCCCCcccchhhHHHHHHHHHhCCCCCCcccCCCCcHHHHHHHhcCc
Confidence                           01122467899999999988899999999999999999999999976555556788888765433


Q ss_pred             -CccccccccccchhhhhhhhHHHHHHHHHHHhhcccCCCCCCCCHHHHHHHHHHhHHH
Q 040540          603 -RLSEVVDTNLVREEQAFSAKMDCLLSIMDLALDCCMESPDKRMHMTDAAAKLKKIKVK  660 (669)
Q Consensus       603 -~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~c~~~~P~~Rps~~~v~~~l~~~~~~  660 (669)
                       .....+|+.+...   .+...++..++.+++.+||+.||++||+|+||+++|+++.+.
T Consensus       899 ~~~~~~~~~~~~~~---~~~~~~~~~~~~~l~~~Cl~~~P~~RPt~~evl~~L~~~~~~  954 (968)
T PLN00113        899 CHLDMWIDPSIRGD---VSVNQNEIVEVMNLALHCTATDPTARPCANDVLKTLESASRS  954 (968)
T ss_pred             cchhheeCccccCC---CCccHHHHHHHHHHHHhhCcCCchhCcCHHHHHHHHHHhhcc
Confidence             2334455554322   112345667889999999999999999999999999998664

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query669
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-37
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 3e-37
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-15
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-11
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-06
3tl8_A349 The Avrptob-Bak1 Complex Reveals Two Structurally S 1e-13
3uim_A326 Structural Basis For The Impact Of Phosphorylation 5e-13
3hgk_A327 Crystal Structure Of Effect Protein Avrptob Complex 5e-12
2qkw_B321 Structural Basis For Activation Of Plant Immunity B 5e-12
4e6d_A298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 6e-09
3io7_A313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 2e-08
3rvg_A303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 2e-08
4f1m_A287 Crystal Structure Of The G1179s Roco4 Kinase Domain 2e-08
4e4m_A302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 2e-08
3q32_A301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 2e-08
3lpb_A295 Crystal Structure Of Jak2 Complexed With A Potent 2 2e-08
2b7a_A293 The Structural Basis Of Janus Kinase 2 Inhibition B 2e-08
3jy9_A311 Janus Kinase 2 Inhibitors Length = 311 2e-08
3e62_A293 Fragment Based Discovery Of Jak-2 Inhibitors Length 2e-08
4hge_A300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 2e-08
3tjc_A298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 2e-08
2w1i_A326 Structure Determination Of Aurora Kinase In Complex 2e-08
4aqc_A301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 2e-08
3ugc_A295 Structural Basis Of Jak2 Inhibition By The Type Ii 2e-08
4bbe_A298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 3e-08
2xa4_A298 Inhibitors Of Jak2 Kinase Domain Length = 298 3e-08
4f0f_A287 Crystal Structure Of The Roco4 Kinase Domain Bound 5e-08
4f1o_A287 Crystal Structure Of The L1180t Mutant Roco4 Kinase 6e-08
3p86_A309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 1e-07
2nry_A307 Crystal Structure Of Irak-4 Length = 307 3e-07
4gs6_A315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 3e-07
2eva_A307 Structural Basis For The Interaction Of Tak1 Kinase 3e-07
3kmw_A271 Crystal Structure Of The IlkALPHA-Parvin Core Compl 3e-07
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 4e-07
2nru_A307 Crystal Structure Of Irak-4 Length = 307 4e-07
2oib_A301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 6e-07
3v5q_A297 Discovery Of A Selective Trk Inhibitor With Efficac 1e-06
3miy_A266 X-Ray Crystal Structure Of Itk Complexed With Sunit 2e-06
3qgw_A286 Crystal Structure Of Itk Kinase Bound To An Inhibit 2e-06
4hct_A269 Crystal Structure Of Itk In Complex With Compound 5 2e-06
3cd3_A377 Crystal Structure Of Phosphorylated Human Feline Sa 3e-06
3v5j_A266 Crystal Structure Of Interleukin-2 Inducible T-Cell 3e-06
1sm2_A264 Crystal Structure Of The Phosphorylated Interleukin 3e-06
4eqm_A294 Structural Analysis Of Staphylococcus Aureus Serine 3e-06
3bkb_A377 Crystal Structure Of Human Feline Sarcoma Viral Onc 3e-06
3dtc_A271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 5e-06
3t9t_A267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 5e-06
2qok_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 5e-06
3d7t_A269 Structural Basis For The Recognition Of C-Src By It 6e-06
2qol_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 1e-05
2qoo_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 1e-05
2qoi_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 1e-05
2qof_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 1e-05
2qod_A373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 1e-05
2gsf_A373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 1e-05
3fxx_A371 Human Epha3 Kinase And Juxtamembrane Region Bound T 1e-05
3dzq_A361 Human Epha3 Kinase Domain In Complex With Inhibitor 1e-05
3d7u_A263 Structural Basis For The Recognition Of C-Src By It 2e-05
3kul_B325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 2e-05
3kul_A325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 2e-05
1byg_A278 Kinase Domain Of Human C-Terminal Src Kinase (Csk) 2e-05
2qoc_A344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 2e-05
2yjr_A342 Structure Of F1174l Mutant Anaplastic Lymphoma Kina 2e-05
4fnw_A327 Crystal Structure Of The Apo F1174l Anaplastic Lymp 2e-05
2xb7_A315 Structure Of Human Anaplastic Lymphoma Kinase In Co 3e-05
3eyg_A290 Crystal Structures Of Jak1 And Jak2 Inhibitor Compl 3e-05
2o8y_A298 Apo Irak4 Kinase Domain Length = 298 3e-05
4e4l_A302 Jak1 Kinase (Jh1 Domain) In Complex With Compound 3 3e-05
2xp2_A327 Structure Of The Human Anaplastic Lymphoma Kinase I 3e-05
1k9a_A450 Crystal Structure Analysis Of Full-Length Carboxyl- 3e-05
4dce_A333 Crystal Structure Of Human Anaplastic Lymphoma Kina 3e-05
4fnx_A327 Crystal Structure Of The Apo R1275q Anaplastic Lymp 3e-05
3aox_A344 X-Ray Crystal Structure Of Human Anaplastic Lymphom 3e-05
3lct_A344 Crystal Structure Of The Anaplastic Lymphoma Kinase 3e-05
4fnz_A327 Crystal Structure Of Human Anaplastic Lymphoma Kina 3e-05
3l9p_A367 Crystal Structure Of The Anaplastic Lymphoma Kinase 3e-05
4fob_A353 Crystal Structure Of Human Anaplastic Lymphoma Kina 4e-05
2yjs_A342 Structure Of C1156y Mutant Anaplastic Lymphoma Kina 4e-05
2qon_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 5e-05
1mqb_A333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 5e-05
3gvu_A292 The Crystal Structure Of Human Abl2 In Complex With 5e-05
2qo7_A373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 5e-05
2yfx_A327 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 5e-05
2yhv_A342 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 5e-05
3k54_A283 Structures Of Human Bruton's Tyrosine Kinase In Act 6e-05
1yvj_A290 Crystal Structure Of The Jak3 Kinase Domain In Comp 6e-05
2qob_A344 Human Epha3 Kinase Domain, Base Structure Length = 6e-05
3gen_A283 The 1.6 A Crystal Structure Of Human Bruton's Tyros 7e-05
4hvd_A314 Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h 8e-05
3lxk_A327 Structural And Thermodynamic Characterization Of Th 9e-05
3ocs_A271 Crystal Structure Of Bruton's Tyrosine Kinase In Co 1e-04
3pjc_A315 Crystal Structure Of Jak3 Complexed With A Potent A 1e-04
3pix_A274 Crystal Structure Of Btk Kinase Domain Complexed Wi 1e-04
3kmu_A271 Crystal Structure Of The IlkALPHA-Parvin Core Compl 1e-04
1k2p_A263 Crystal Structure Of Bruton's Tyrosine Kinase Domai 1e-04
3p08_A267 Crystal Structure Of The Human Btk Kinase Domain Le 1e-04
3oct_A265 Crystal Structure Of Bruton's Tyrosine Kinase Mutan 2e-04
3sxr_A268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 2e-04
2v7a_A286 Crystal Structure Of The T315i Abl Mutant In Comple 2e-04
1jpa_A312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 2e-04
2hen_A286 Crystal Structure Of The Ephb2 Receptor Kinase Doma 2e-04
3qrj_A277 The Crystal Structure Of Human Abl1 Kinase Domain T 2e-04
2rei_A318 Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep 3e-04
3dqw_A286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 3e-04
3dk7_A277 Crystal Structure Of Mutant Abl Kinase Domain In Co 3e-04
3g6h_A286 Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma 3e-04
1opl_A537 Structural Basis For The Auto-Inhibition Of C-Abl T 4e-04
2fo0_A495 Organization Of The Sh3-Sh2 Unit In Active And Inac 4e-04
2gqg_A278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 4e-04
2hel_A306 Crystal Structure Of A Mutant Epha4 Kinase Domain ( 4e-04
2y6m_A291 Crystal Structure Of Epha4 Kinase Domain Length = 2 4e-04
2z60_A288 Crystal Structure Of The T315i Mutant Of Abl Kinase 4e-04
2xyu_A285 Crystal Structure Of Epha4 Kinase Domain In Complex 4e-04
3geq_A286 Structural Basis For The Chemical Rescue Of Src Kin 4e-04
3oy3_A284 Crystal Structure Of Abl T315i Mutant Kinase Domain 5e-04
3oez_A286 Crystal Structure Of The L317i Mutant Of The Chicke 5e-04
2h8h_A535 Src Kinase In Complex With A Quinazoline Inhibitor 5e-04
2hzi_A277 Abl Kinase Domain In Complex With Pd180970 Length = 5e-04
4aoj_A329 Human Trka In Complex With The Inhibitor Az-23 Leng 5e-04
3qri_A277 The Crystal Structure Of Human Abl1 Kinase Domain I 6e-04
1yi6_A276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 6e-04
2e2b_A293 Crystal Structure Of The C-Abl Kinase Domain In Com 6e-04
2hz0_A270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 6e-04
2f4j_A287 Structure Of The Kinase Domain Of An Imatinib-Resis 6e-04
2hyy_A273 Human Abl Kinase Domain In Complex With Imatinib (S 6e-04
1opk_A495 Structural Basis For The Auto-Inhibition Of C-Abl T 6e-04
2ptk_A453 Chicken Src Tyrosine Kinase Length = 453 6e-04
2vwu_A302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 6e-04
3pyy_A298 Discovery And Characterization Of A Cell-Permeable, 6e-04
2g2f_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 6e-04
3tt0_A382 Co-Structure Of Fibroblast Growth Factor Receptor 1 6e-04
3dk6_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 7e-04
2g1t_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 7e-04
3js2_A317 Crystal Structure Of Minimal Kinase Domain Of Fibro 7e-04
1fmk_A452 Crystal Structure Of Human Tyrosine-Protein Kinase 7e-04
1y57_A452 Structure Of Unphosphorylated C-Src In Complex With 7e-04
3rhx_B306 Crystal Structure Of The Catalytic Domain Of Fgfr1 7e-04
3kxx_A317 Structure Of The Mutant Fibroblast Growth Factor Re 7e-04
2hiw_A287 Crystal Structure Of Inactive Conformation Abl Kina 7e-04
1fgk_A310 Crystal Structure Of The Tyrosine Kinase Domain Of 7e-04
4f63_A309 Crystal Structure Of Human Fibroblast Growth Factor 7e-04
4f0i_A300 Crystal Structure Of Apo Trka Length = 300 8e-04
2oiq_A286 Crystal Structure Of Chicken C-Src Kinase Domain In 8e-04
3u4w_A275 Src In Complex With Dna-Templated Macrocyclic Inhib 8e-04
2r2p_A295 Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep 8e-04
2bdf_A279 Src Kinase In Complex With Inhibitor Ap23451 Length 8e-04
3orm_A311 Mycobacterium Tuberculosis Pknb Kinase Domain D76a 8e-04
1mru_A311 Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob 8e-04
4gt5_A306 Crystal Structure Of The Inactive Trka Kinase Domai 9e-04
1fpu_A293 Crystal Structure Of Abl Kinase Domain In Complex W 9e-04
3ori_A311 Mycobacterium Tuberculosis Pknb Kinase Domain L33d 9e-04
3svv_A286 Crystal Structure Of T338c C-Src Covalently Bound T 9e-04
3f61_A311 Crystal Structure Of M. Tuberculosis Pknb Leu33aspV 9e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 114/457 (24%), Positives = 184/457 (40%), Gaps = 89/457 (19%)
Query: 14  LLAFKAHAFDYRSALANNWSISYPICSWAGISCGSRHQRVTALNLSDMGLG--------- 64
           L++FK    D    L  +WS +   C++ G++C  R  +VT+++LS   L          
Sbjct: 14  LISFKDVLPDKN--LLPDWSSNKNPCTFDGVTC--RDDKVTSIDLSSKPLNVGFSAVSSS 69
Query: 65  ------------------GTIPLHFGNLSFLVSLDISENNFHGHLPK--ELGQLRRLRVM 104
                             G++   F   + L SLD+S N+  G +     LG    L+ +
Sbjct: 70  LLSLTGLESLFLSNSHINGSVS-GFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFL 128
Query: 105 SLAYNKLSGSFPSWIG---VLSKLRILRLDYNNFTGPIPNSLF---NLSRLEMLRAEFNI 158
           +++ N L   FP  +     L+ L +L L  N+ +G              L+ L    N 
Sbjct: 129 NVSSNTLD--FPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNK 186
Query: 159 IGGTIP-SRIGNLRKLVNLGLWSCNLQGQIPTEIGSXXXXXXXXXXXXXXSGLIPPTIFN 217
           I G +  SR  NL  L    + S N    IP  +G               SG     I  
Sbjct: 187 ISGDVDVSRCVNLEFL---DVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAIST 242
Query: 218 ISTMRILTLESNQLSGRLPSTIGHSLRNIEYLALSTNNLIGKIPNSITNATK-LIGLDLG 276
            + +++L + SNQ  G +P      L++++YL+L+ N   G+IP+ ++ A   L GLDL 
Sbjct: 243 CTELKLLNISSNQFVGPIPPL---PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLS 299
Query: 277 FNSFSGHIPNTFGNLRHLSVLNVMMNNLTTESSSADQWSFLSSLTNCRXXXXXXXXXXPL 336
            N F G +P  FG+   L  L +  NN + E                           P+
Sbjct: 300 GNHFYGAVPPFFGSCSLLESLALSSNNFSGE--------------------------LPM 333
Query: 337 GGILPQLIGNFSASLQNIYAFELGFNDLNGTIPTSIGTLQ-QLQGFYVPENNLQGYVPHD 395
             +L          ++ +   +L FN+ +G +P S+  L   L    +  NN  G +  +
Sbjct: 334 DTLL---------KMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPN 384
Query: 396 LCHLER--LNILNLSGNKLSGHIPPCLASLTSLRELH 430
           LC   +  L  L L  N  +G IPP L++ + L  LH
Sbjct: 385 LCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLH 421
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|4F1M|A Chain A, Crystal Structure Of The G1179s Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|3KMW|A Chain A, Crystal Structure Of The IlkALPHA-Parvin Core Complex (Mgatp) Length = 271 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|3D7U|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 263 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal Src Kinase (Csk) In Complex With Inhibitor Staurosporine Length = 278 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|2YJR|A Chain A, Structure Of F1174l Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|4FNW|A Chain A, Crystal Structure Of The Apo F1174l Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|2XB7|A Chain A, Structure Of Human Anaplastic Lymphoma Kinase In Complex With Nvp- Tae684 Length = 315 Back     alignment and structure
>pdb|3EYG|A Chain A, Crystal Structures Of Jak1 And Jak2 Inhibitor Complexes Length = 290 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|4E4L|A Chain A, Jak1 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|2XP2|A Chain A, Structure Of The Human Anaplastic Lymphoma Kinase In Complex With Crizotinib (Pf-02341066) Length = 327 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|4DCE|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With A Piperidine-Carboxamide Inhibitor Length = 333 Back     alignment and structure
>pdb|4FNX|A Chain A, Crystal Structure Of The Apo R1275q Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|3AOX|A Chain A, X-Ray Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Ch5424802 Length = 344 Back     alignment and structure
>pdb|3LCT|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 344 Back     alignment and structure
>pdb|4FNZ|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Piperidine-Carboxamide Inhibitor 2 Length = 327 Back     alignment and structure
>pdb|3L9P|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 367 Back     alignment and structure
>pdb|4FOB|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Acyliminobenzimidazole Inhibitor 1 Length = 353 Back     alignment and structure
>pdb|2YJS|A Chain A, Structure Of C1156y Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|2YFX|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase In Complex With Crizotinib Length = 327 Back     alignment and structure
>pdb|2YHV|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 Back     alignment and structure
>pdb|1YVJ|A Chain A, Crystal Structure Of The Jak3 Kinase Domain In Complex With A Staurosporine Analogue Length = 290 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 Back     alignment and structure
>pdb|4HVD|A Chain A, Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h-pyrrolo[2,3- B]pyrazine-7-carboxylic Acid ((s)-1,2,2-trimethyl-propyl)-amide Length = 314 Back     alignment and structure
>pdb|3LXK|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 327 Back     alignment and structure
>pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 Back     alignment and structure
>pdb|3PJC|A Chain A, Crystal Structure Of Jak3 Complexed With A Potent Atp Site Inhibitor Showing High Selectivity Within The Janus Kinase Family Length = 315 Back     alignment and structure
>pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 Back     alignment and structure
>pdb|3KMU|A Chain A, Crystal Structure Of The IlkALPHA-Parvin Core Complex (Apo) Length = 271 Back     alignment and structure
>pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 Back     alignment and structure
>pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 Back     alignment and structure
>pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 Back     alignment and structure
>pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 Back     alignment and structure
>pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 Back     alignment and structure
>pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 Back     alignment and structure
>pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 Back     alignment and structure
>pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 Back     alignment and structure
>pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 Back     alignment and structure
>pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 Back     alignment and structure
>pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 Back     alignment and structure
>pdb|1MRU|A Chain A, Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycobacterium Tuberculosis Pknb. Length = 311 Back     alignment and structure
>pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 Back     alignment and structure
>pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 Back     alignment and structure
>pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query669
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-103
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-102
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-86
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-13
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-74
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-64
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-33
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-68
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-61
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-51
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-28
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-62
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-49
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-47
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-41
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-61
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-60
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-60
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-33
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-58
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-58
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-57
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-46
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-37
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-47
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-45
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-36
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-34
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-44
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-43
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-40
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-39
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-29
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-26
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-43
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-41
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-40
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-41
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-40
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-39
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-40
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-40
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-36
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 5e-40
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 6e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-37
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-35
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-33
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-22
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 4e-35
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-34
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-34
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-32
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-29
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-34
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-31
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-26
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-33
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-32
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-30
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 4e-33
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-33
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-29
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-24
3soc_A322 Activin receptor type-2A; structural genomics cons 8e-32
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 2e-31
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 3e-31
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-31
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-30
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-22
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-17
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 5e-31
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-31
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-25
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-24
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 2e-30
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 2e-30
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 2e-29
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 2e-29
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 4e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-26
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-18
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 8e-25
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-23
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-21
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-18
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 2e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-24
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-23
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-19
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-18
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 2e-23
3q4u_A301 Activin receptor type-1; structural genomics conso 2e-22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-11
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 3e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-13
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 6e-20
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 8e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-05
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 3e-17
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 3e-17
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 6e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-06
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 9e-17
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 1e-16
3lzb_A327 Epidermal growth factor receptor; epidermal growth 3e-16
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 3e-16
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 3e-16
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 4e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 4e-16
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 5e-16
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 8e-16
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 8e-16
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 9e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-12
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 1e-15
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 1e-15
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 1e-15
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 1e-15
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 1e-15
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 2e-15
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 2e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-08
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 3e-15
3poz_A327 Epidermal growth factor receptor; kinase domain, a 3e-15
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 4e-15
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 4e-15
3pls_A298 Macrophage-stimulating protein receptor; protein k 4e-15
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 5e-15
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 5e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-08
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 7e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-05
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 1e-14
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 1e-14
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 1e-14
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 1e-14
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 1e-14
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 1e-14
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 2e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-06
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 4e-14
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 1e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-06
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 2e-12
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 2e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
4aoj_A329 High affinity nerve growth factor receptor; transf 7e-12
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 1e-11
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 2e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-07
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 3e-11
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 5e-11
2xir_A316 Vascular endothelial growth factor receptor 2; ang 5e-11
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 6e-11
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 6e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-04
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 6e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-04
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 1e-10
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 1e-10
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 2e-10
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 2e-10
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 2e-10
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 2e-10
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 2e-10
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 3e-10
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 5e-10
3ork_A311 Serine/threonine protein kinase; structural genomi 1e-09
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 1e-09
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 6e-09
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 6e-09
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 1e-08
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 1e-08
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 1e-08
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 1e-08
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 2e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-05
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 7e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-04
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 9e-08
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 1e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-05
2a19_B284 Interferon-induced, double-stranded RNA-activated 2e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-04
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 4e-07
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 5e-07
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 5e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-04
3eqc_A360 Dual specificity mitogen-activated protein kinase; 9e-07
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 1e-06
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 1e-06
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 1e-06
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 1e-06
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 1e-06
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 2e-06
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 2e-06
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 2e-06
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 2e-06
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 2e-06
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 2e-06
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 3e-06
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 3e-06
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 4e-06
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 4e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-05
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 6e-06
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 6e-06
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 6e-06
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 7e-06
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 7e-06
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 7e-06
3an0_A340 Dual specificity mitogen-activated protein kinase; 9e-06
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 9e-06
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 9e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 9e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 1e-05
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 1e-05
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 1e-05
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 1e-05
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 1e-05
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 2e-05
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 2e-05
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 3e-05
3aln_A327 Dual specificity mitogen-activated protein kinase; 3e-05
2y0a_A326 Death-associated protein kinase 1; transferase, ca 4e-05
3fme_A290 Dual specificity mitogen-activated protein kinase; 4e-05
3bhy_A283 Death-associated protein kinase 3; death associate 5e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 7e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 9e-05
2dyl_A318 Dual specificity mitogen-activated protein kinase 1e-04
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 1e-04
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 1e-04
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 2e-04
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 2e-04
3uqc_A286 Probable conserved transmembrane protein; structur 2e-04
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 2e-04
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 6e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 4e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-04
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 5e-04
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 6e-04
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 6e-04
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 6e-04
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 7e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  330 bits (849), Expect = e-103
 Identities = 123/458 (26%), Positives = 201/458 (43%), Gaps = 37/458 (8%)

Query: 2   TTLNDLTTDQSSLLAFKAHAFDYRSALANNWSISYPICSWAGISCGSRHQRVTALNLSDM 61
           +    L  +   L++FK      ++ L + WS +   C++ G++C  R  +VT+++LS  
Sbjct: 5   SPSQSLYREIHQLISFKDV-LPDKNLLPD-WSSNKNPCTFDGVTC--RDDKVTSIDLSSK 60

Query: 62  GL---GGTIPLHFGNLSFLVSLDISENNFHGHLPKELGQLRRLRVMSLAYNKLSGSFPS- 117
            L      +     +L+ L SL +S ++ +G +         L  + L+ N LSG   + 
Sbjct: 61  PLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVS-GFKCSASLTSLDLSRNSLSGPVTTL 119

Query: 118 -WIGVLSKLRILRLDYNNFTGPIPNSLF-NLSRLEMLRAEFNIIGGTIPSRI---GNLRK 172
             +G  S L+ L +  N    P   S    L+ LE+L    N I G             +
Sbjct: 120 TSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGE 179

Query: 173 LVNLGLWSCNLQGQIPTEIGSLQNLKNLDLADNKLSGLIPPTIFNISTMRILTLESNQLS 232
           L +L +    + G +   +    NL+ LD++ N  S  I P + + S ++ L +  N+LS
Sbjct: 180 LKHLAISGNKISGDVD--VSRCVNLEFLDVSSNNFSTGI-PFLGDCSALQHLDISGNKLS 236

Query: 233 GRLPSTIGHSLRNIEYLALSTNNLIGKIPNSITNATKLIGLDLGFNSFSGHIPNT-FGNL 291
           G     I  +   ++ L +S+N  +G IP        L  L L  N F+G IP+   G  
Sbjct: 237 GDFSRAIS-TCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGAC 293

Query: 292 RHLSVLNVMMNNLTTESSSADQWSFLSSLTNCRNLSNLALASNPLGGILP-QLIGNFSAS 350
             L+ L++  N+           +      +C  L +LAL+SN   G LP   +      
Sbjct: 294 DTLTGLDLSGNHFYG--------AVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMR-G 344

Query: 351 LQNIYAFELGFNDLNGTIPTSIGTL-QQLQGFYVPENNLQGYVPHDLCH--LERLNILNL 407
           L+ +    L FN+ +G +P S+  L   L    +  NN  G +  +LC      L  L L
Sbjct: 345 LKVLD---LSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYL 401

Query: 408 SGNKLSGHIPPCLASLTSLRELHLGSNKLSSSIPSSLA 445
             N  +G IPP L++ + L  LHL  N LS +IPSSL 
Sbjct: 402 QNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG 439
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query669
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.97
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 99.97
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.97
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.95
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 99.95
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 99.94
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.94
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.94
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.94
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.94
3soc_A322 Activin receptor type-2A; structural genomics cons 99.94
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.94
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.94
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.94
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.94
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.94
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.93
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.93
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.93
3q4u_A301 Activin receptor type-1; structural genomics conso 99.93
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.93
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.93
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.93
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.93
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.93
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.93
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.93
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.93
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.93
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.93
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.93
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.93
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.93
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.93
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.93
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.93
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.93
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.93
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.93
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.92
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.92
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.92
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.92
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 99.92
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.92
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.92
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.92
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.92
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.92
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 99.92
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.92
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.92
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.92
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 99.92
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.92
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 99.92
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.92
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.92
2y0a_A326 Death-associated protein kinase 1; transferase, ca 99.92
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.92
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 99.92
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.92
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.92
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.92
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.92
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.92
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.92
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.92
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.92
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.92
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.92
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.92
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.92
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.92
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 99.91
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.91
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.91
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.91
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.91
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.91
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.91
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.91
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.91
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.91
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
3niz_A311 Rhodanese family protein; structural genomics, str 99.91
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.91
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.91
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.91
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.91
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.91
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 99.91
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.91
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.91
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.91
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.91
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.91
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.91
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.91
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 99.91
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.91
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.91
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.91
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.91
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.91
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.91
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.91
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.91
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.91
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.91
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.91
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.91
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.91
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.91
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.91
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.91
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 99.91
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.9
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.9
3bhy_A283 Death-associated protein kinase 3; death associate 99.9
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.9
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.9
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.9
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 99.9
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.9
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.9
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.9
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.9
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.9
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.9
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.9
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.9
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 99.9
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 99.9
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.9
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.9
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.9
3ork_A311 Serine/threonine protein kinase; structural genomi 99.9
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.9
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.9
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.9
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.9
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.9
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 99.9
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 99.9
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.9
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.9
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 99.9
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 99.9
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 99.9
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.9
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.9
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.9
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.9
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.9
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.9
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.9
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 99.9
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.9
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.9
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.89
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.89
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.89
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.89
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.89
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.89
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.89
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.89
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.89
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.89
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 99.89
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.89
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.89
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.89
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.89
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.89
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.89
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.89
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 99.89
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.89
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.89
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.89
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.89
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.89
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 99.89
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.89
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.88
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.88
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.88
3uqc_A286 Probable conserved transmembrane protein; structur 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.88
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 99.88
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.88
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.88
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 99.88
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.88
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.88
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.88
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.88
2fst_X367 Mitogen-activated protein kinase 14; active mutant 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.88
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.88
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.88
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.88
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 99.87
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.87
3rp9_A458 Mitogen-activated protein kinase; structural genom 99.87
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 99.87
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.87
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.87
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.87
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 99.87
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.87
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.87
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.86
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.86
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.86
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.86
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.86
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.86
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.85
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.83
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.82
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.82
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.81
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.8
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.79
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.68
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.59
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.58
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.56
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.53
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.52
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.51
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.45
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.44
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.42
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.42
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.41
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.28
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.24
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.2
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.19
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.18
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.15
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.87
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.77
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.7
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.61
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.54
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.39
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.33
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 98.3
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.16
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.13
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.12
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.53
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.32
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 96.81
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.52
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.19
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.16
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 95.92
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.8
2yle_A229 Protein spire homolog 1; actin-binding protein, ac 94.03
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 87.39
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.9e-51  Score=471.90  Aligned_cols=295  Identities=27%  Similarity=0.432  Sum_probs=225.7

Q ss_pred             CCCChhhHHHHHHHHhhcCCCcccccCCCCCCCCCCCccceeeCCCCCCEEEEEcCCCCCccc---cc------------
Q 040540            4 LNDLTTDQSSLLAFKAHAFDYRSALANNWSISYPICSWAGISCGSRHQRVTALNLSDMGLGGT---IP------------   68 (669)
Q Consensus         4 ~~~~~~~~~~l~~~~~~~~~~~~~l~~~w~~~~~~c~~~g~~c~~~~~~v~~L~ls~~~l~~~---~~------------   68 (669)
                      -.+.++|++||++||+++.||. .+.+ |+.+.++|.|.||+|+  .++|+.|||+++++.|.   +|            
T Consensus         7 ~~~~~~~~~all~~k~~~~~~~-~l~~-W~~~~~~C~w~gv~C~--~~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~l   82 (768)
T 3rgz_A            7 SQSLYREIHQLISFKDVLPDKN-LLPD-WSSNKNPCTFDGVTCR--DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESL   82 (768)
T ss_dssp             -CCHHHHHHHHHHHHTTCSCTT-SSTT-CCTTSCGGGSTTEEEE--TTEEEEEECTTSCCCEEHHHHHHHTTTCTTCCEE
T ss_pred             ccCCHHHHHHHHHHHhhCCCcc-cccC-CCCCCCCcCCcceEEC--CCcEEEEECCCCCcCCccCccChhHhccCccccc
Confidence            3456789999999999998877 6765 9877899999999998  47999999999999886   43            


Q ss_pred             -----------ccccCCCCCCEEeCCCCcCcccCCc--ccCCCCCCCEEEccCCcCCccCCccc-cCCcccccccccccC
Q 040540           69 -----------LHFGNLSFLVSLDISENNFHGHLPK--ELGQLRRLRVMSLAYNKLSGSFPSWI-GVLSKLRILRLDYNN  134 (669)
Q Consensus        69 -----------~~~~~l~~L~~L~Ls~N~l~~~~p~--~l~~l~~L~~L~L~~n~l~~~~p~~~-~~l~~L~~L~L~~n~  134 (669)
                                 ..++.+++|++|||++|.+.|.+|.  .++++++|++|+|++|.+.+.+|..+ .++++|++|+|++|+
T Consensus        83 ~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~  162 (768)
T 3rgz_A           83 FLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANS  162 (768)
T ss_dssp             ECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSC
T ss_pred             CCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCc
Confidence                       4678889999999999999988888  88889999999999998887777655 667777777777777


Q ss_pred             ccccCCcc-------------------------cCCCCCCCeeecccccccccCCcccCCCCCCCEEEcccCCCcccCCc
Q 040540          135 FTGPIPNS-------------------------LFNLSRLEMLRAEFNIIGGTIPSRIGNLRKLVNLGLWSCNLQGQIPT  189 (669)
Q Consensus       135 l~~~~p~~-------------------------~~~l~~L~~L~l~~n~l~~~~p~~~~~L~~L~~L~l~~n~l~~~~p~  189 (669)
                      +++..|..                         +..+++|++|++++|.+.+.+|. ++++++|++|++++|.+++.+|.
T Consensus       163 l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~  241 (768)
T 3rgz_A          163 ISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSR  241 (768)
T ss_dssp             CEEETHHHHHHTTCCTTCCEEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHH
T ss_pred             cCCcCChhhhhhccCCCCCEEECCCCcccccCCcccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccH
Confidence            66554432                         25677788888888888877776 88888888888888888888888


Q ss_pred             cccCCCCCCEEEccCCCCCCCCCccccCCCCCcEEEcccCCCccccchhhhccCCCCCeeecccCcccccCCccccCCCC
Q 040540          190 EIGSLQNLKNLDLADNKLSGLIPPTIFNISTMRILTLESNQLSGRLPSTIGHSLRNIEYLALSTNNLIGKIPNSITNATK  269 (669)
Q Consensus       190 ~~~~l~~L~~L~l~~N~l~~~~p~~~~~l~~L~~L~l~~n~l~~~~p~~~~~~l~~L~~L~ls~n~l~~~~p~~~~~l~~  269 (669)
                      .++.+++|++|++++|.+++.+|..  .+++|++|++++|.++|.+|..++..+++|++|++++|++.+..|..+..+++
T Consensus       242 ~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~  319 (768)
T 3rgz_A          242 AISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSL  319 (768)
T ss_dssp             HTTTCSSCCEEECCSSCCEESCCCC--CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTT
T ss_pred             HHhcCCCCCEEECCCCcccCccCcc--ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCC
Confidence            8888888888888888877766654  66677777777777776677666543466777777777776666666666777


Q ss_pred             CCEEeCCCCCccccCccc-cCCCCCCCEEEccCCccc
Q 040540          270 LIGLDLGFNSFSGHIPNT-FGNLRHLSVLNVMMNNLT  305 (669)
Q Consensus       270 L~~L~ls~n~l~~~~p~~-~~~l~~L~~L~l~~N~l~  305 (669)
                      |+.|++++|.+.+.+|.. +..+++|++|++++|+++
T Consensus       320 L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~  356 (768)
T 3rgz_A          320 LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFS  356 (768)
T ss_dssp             CCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEE
T ss_pred             ccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccC
Confidence            777777777666656544 666666666666666554
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2yle_A Protein spire homolog 1; actin-binding protein, actin polymerization; 1.80A {Homo sapiens} PDB: 2ylf_A 3r7g_A 3rbw_A Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 669
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 4e-36
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 1e-30
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 9e-29
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 7e-28
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 1e-27
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-27
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 9e-27
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 1e-26
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-26
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-09
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 4e-26
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 6e-26
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 8e-26
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 8e-26
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 3e-25
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 4e-25
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 4e-25
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 8e-25
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 1e-24
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 4e-24
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 5e-24
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 8e-24
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 1e-23
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 5e-23
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 8e-23
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 1e-22
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 1e-22
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 2e-22
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 3e-22
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 3e-22
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 4e-22
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 8e-22
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 8e-22
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 8e-22
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 2e-20
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-20
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-10
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 3e-20
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 5e-20
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 6e-20
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-18
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-16
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 2e-16
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 2e-16
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 9e-16
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 1e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-08
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 3e-15
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 1e-14
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 1e-14
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 2e-14
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 2e-14
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 2e-14
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 3e-14
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 3e-14
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 4e-14
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 6e-13
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 1e-12
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 2e-11
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 3e-11
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 9e-11
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 4e-10
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 1e-09
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 1e-09
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 2e-09
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 1e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 7e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 4e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 5e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.004
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: B-Raf kinase
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  135 bits (340), Expect = 4e-36
 Identities = 47/254 (18%), Positives = 92/254 (36%), Gaps = 49/254 (19%)

Query: 435 KLSSSIPSSLAFRSFDSECEVLRNVRHRNLIKIISSCSNPDFKALVLEFMPNGSLEKWLY 494
            L+ + P+    ++F +E  VLR  RH N++  +   + P   A+V ++    SL   L+
Sbjct: 37  MLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTAPQL-AIVTQWCEGSSLYHHLH 95

Query: 495 SHNYFLDILERLNIMIDVGSALEYLRHGHSSAPIIHC----------------------- 531
                 ++++ ++I       ++YL        IIH                        
Sbjct: 96  IIETKFEMIKLIDIARQTAQGMDYLHA----KSIIHRDLKSNNIFLHEDLTVKIGDFGLA 151

Query: 532 ----EGEDSVTQTTTMATIGYMAPEY---GSEGIVSAKCDVYSYGVLLMETFTRKRPTDE 584
                   S        +I +MAPE      +   S + DVY++G++L E  T + P   
Sbjct: 152 TVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSN 211

Query: 585 MFTGEMSLRRWVKESLPHRLSEVVDTNLVREEQAFSAKMDCLLSIMDLALDCCMESPDKR 644
           +   +  +    +  L   LS+V                +C  ++  L  +C  +  D+R
Sbjct: 212 INNRDQIIFMVGRGYLSPDLSKVRS--------------NCPKAMKRLMAECLKKKRDER 257

Query: 645 MHMTDAAAKLKKIK 658
                  A ++ + 
Sbjct: 258 PLFPQILASIELLA 271
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query669
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.97
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.97
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.97
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.97
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 99.97
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.97
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.97
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.97
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.97
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.97
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.97
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.97
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.97
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.97
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.97
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.97
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.96
d1s9ja_322 Dual specificity mitogen-activated protein kinase 99.96
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.96
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.96
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.96
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 99.96
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.96
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.96
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.96
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.96
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 99.96
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 99.96
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.96
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.96
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.95
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.95
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.95
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.95
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.95
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.95
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 99.95
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 99.94
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.94
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.94
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.94
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.93
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.92
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.92
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.91
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.91
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.91
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.91
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.91
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.9
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.81
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.74
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.71
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.6
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.58
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.47
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.45
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.41
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.39
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.38
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.33
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.23
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.22
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.14
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.13
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.25
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.14
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 97.75
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.14
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.94
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.24
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.19
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=1.4e-40  Score=338.25  Aligned_cols=292  Identities=28%  Similarity=0.483  Sum_probs=264.3

Q ss_pred             CChhhHHHHHHHHhhcCCCcccccCCCCCCCCCC--CccceeeCCC--CCCEEEEEcCCCCCcc--cccccccCCCCCCE
Q 040540            6 DLTTDQSSLLAFKAHAFDYRSALANNWSISYPIC--SWAGISCGSR--HQRVTALNLSDMGLGG--TIPLHFGNLSFLVS   79 (669)
Q Consensus         6 ~~~~~~~~l~~~~~~~~~~~~~l~~~w~~~~~~c--~~~g~~c~~~--~~~v~~L~ls~~~l~~--~~~~~~~~l~~L~~   79 (669)
                      ++++|++||++||+++.+|. .+.+ |..+.|+|  .|.||+|+..  ..+|+.|||+++++.|  .+|+++++|++|++
T Consensus         3 c~~~e~~aLl~~k~~~~~~~-~l~s-W~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~   80 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDLGNPT-TLSS-WLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNF   80 (313)
T ss_dssp             SCHHHHHHHHHHHHHTTCCG-GGTT-CCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTCSE
T ss_pred             CCHHHHHHHHHHHHHCCCCC-cCCC-CCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCChHHhcCccccc
Confidence            57889999999999998775 5665 98888999  5999999864  3489999999999988  47899999999999


Q ss_pred             EeCCC-CcCcccCCcccCCCCCCCEEEccCCcCCccCCccccCCcccccccccccCccccCCcccCCCCCCCeeeccccc
Q 040540           80 LDISE-NNFHGHLPKELGQLRRLRVMSLAYNKLSGSFPSWIGVLSKLRILRLDYNNFTGPIPNSLFNLSRLEMLRAEFNI  158 (669)
Q Consensus        80 L~Ls~-N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~l~~n~  158 (669)
                      |+|++ |++.|.+|..|+++++|++|+|++|++.+..|..+..+.+|+++++++|.+.+.+|..+.++++|+.+++++|.
T Consensus        81 L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~  160 (313)
T d1ogqa_          81 LYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNR  160 (313)
T ss_dssp             EEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSC
T ss_pred             cccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccceeeccccc
Confidence            99997 89999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCcccCCCCCC-CEEEcccCCCcccCCccccCCCCCCEEEccCCCCCCCCCccccCCCCCcEEEcccCCCccccch
Q 040540          159 IGGTIPSRIGNLRKL-VNLGLWSCNLQGQIPTEIGSLQNLKNLDLADNKLSGLIPPTIFNISTMRILTLESNQLSGRLPS  237 (669)
Q Consensus       159 l~~~~p~~~~~L~~L-~~L~l~~n~l~~~~p~~~~~l~~L~~L~l~~N~l~~~~p~~~~~l~~L~~L~l~~n~l~~~~p~  237 (669)
                      +.+.+|..+..+.++ +.++++.|++++..|..+..+.. ..++++.|...+.+|..+..+++++.+++++|.+.+.+|.
T Consensus       161 l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~-~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~~  239 (313)
T d1ogqa_         161 ISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNL-AFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGK  239 (313)
T ss_dssp             CEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCC-SEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGGG
T ss_pred             ccccccccccccccccccccccccccccccccccccccc-cccccccccccccccccccccccccccccccccccccccc
Confidence            999999999998886 88999999999999998888764 4799999999999999999999999999999999876663


Q ss_pred             hhhccCCCCCeeecccCcccccCCccccCCCCCCEEeCCCCCccccCccccCCCCCCCEEEccCCc
Q 040540          238 TIGHSLRNIEYLALSTNNLIGKIPNSITNATKLIGLDLGFNSFSGHIPNTFGNLRHLSVLNVMMNN  303 (669)
Q Consensus       238 ~~~~~l~~L~~L~ls~n~l~~~~p~~~~~l~~L~~L~ls~n~l~~~~p~~~~~l~~L~~L~l~~N~  303 (669)
                       +. .+++|++|++++|+++|.+|..+.++++|+.|++++|+++|.+|. ++++++|+.+++.+|+
T Consensus       240 -~~-~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         240 -VG-LSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNK  302 (313)
T ss_dssp             -CC-CCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSS
T ss_pred             -cc-cccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCc
Confidence             44 578999999999999999999999999999999999999998884 5778888888888886
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure