Citrus Sinensis ID: 040620


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----
MDVIHGENGAREHFQAQAQVWSYTYNYMKSLSLKRAIQLRIPDIINNSGQPMTLTQIIVALNVHPNKTRCTQILVCLLAHSGFFVQQKDGKNEQEEESILLPPHLDFFSRISLQLQGSTILLLIADATFTTSFHFLSTWLQNDDQTLFGTADGIFYEAMITDFELIASVLIEDCNEVSKGLKPLVDVGGSTGTMARAIATAFPDTKCTVFACHL
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHccccccHHHHHHHcccccccccHHHHHHHHHHHHcccEEEcccccccccccccccccccHHHHccccccHHHHHHHHcccccHHccccccccccccccccccccccccHHHHHHHcHHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHccccEEEEccccc
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccccccHHHHHHHccccccccHHHHHHHHHHHHcccEEEEEccccccccEEEEEcHHHHHHccccccccHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHcHHccccEEEEccccHHHHHHHHHHHccccEEEEEEEEc
mdvihgengareHFQAQAQVWSYTYNYMKSLSLKRAIQLRipdiinnsgqpmTLTQIIVALnvhpnktrCTQILVCLLAHsgffvqqkdgkneqeeesillpphldffSRISLQLQGSTILLLIADATFTTSFHFLSTwlqnddqtlfgtADGIFYEAMITDFELIASVLIEDCnevskglkplvdvggstGTMARAIAtafpdtkctvfachl
mdvihgengarehfqAQAQVWSYTYNYMKSLSLKRAIQLRIPDIINNSGQPMTLTQIIVALNVHPNKTRCTQILVCLLAHSGFFVQQKDGKNEQEEESILLPPHLDFFSRISLQLQGSTILLLIADATFTTSFHFLSTWLQNDDQTLFGTADGIFYEAMITDFELIASVLIEDCNEVSKGLKPLVDVGGSTGTMARAIATAFPDTKCTVFACHL
MDVIHGENGAREHFQAQAQVWSYTYNYMKSLSLKRAIQLRIPDIINNSGQPMTLTQIIVALNVHPNKTRCTQILVCLLAHSGFFVQQKDGKNEQEEESILLPPHLDFFSRISLQLQGSTILLLIADATFTTSFHFLSTWLQNDDQTLFGTADGIFYEAMITDFELIASVLIEDCNEVSKGLKPLVDVGGSTGTMARAIATAFPDTKCTVFACHL
*************FQAQAQVWSYTYNYMKSLSLKRAIQLRIPDIINNSGQPMTLTQIIVALNVHPNKTRCTQILVCLLAHSGFFVQ************ILLPPHLDFFSRISLQLQGSTILLLIADATFTTSFHFLSTWLQNDDQTLFGTADGIFYEAMITDFELIASVLIEDCNEVSKGLKPLVDVGGSTGTMARAIATAFPDTKCTVFAC**
***************AQAQVWSYTYNYMKSLSLKRAIQLRIPDIINNSGQPMTLTQIIVALNVHPNKTRCTQILVCLLAHSGFFVQQKDGKNEQEEESILLPPHLDFFSRISLQLQGSTILLLIADATFTTSFHFLSTWLQNDDQTLFGTADGIFYEAMITDFELIASVLIEDCNEVSKGLKPLVDVGGSTGTMARAIATAFPDTKCTVFACHL
MDVIHGENGAREHFQAQAQVWSYTYNYMKSLSLKRAIQLRIPDIINNSGQPMTLTQIIVALNVHPNKTRCTQILVCLLAHSGFFVQQ**********SILLPPHLDFFSRISLQLQGSTILLLIADATFTTSFHFLSTWLQNDDQTLFGTADGIFYEAMITDFELIASVLIEDCNEVSKGLKPLVDVGGSTGTMARAIATAFPDTKCTVFACHL
********GAREHFQAQAQVWSYTYNYMKSLSLKRAIQLRIPDIINNSGQPMTLTQIIVALNVHPNKTRCTQILVCLLAHSGFFVQQKDGKNEQEEESILLPPHLDFFSRISLQLQGSTILLLIADATFTTSFHFLSTWLQNDDQTLFGTADGIFYEAMITDFELIASVLIEDCNEVSKGLKPLVDVGGSTGTMARAIATAFPDTKCTVFACHL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVIHGENGAREHFQAQAQVWSYTYNYMKSLSLKRAIQLRIPDIINNSGQPMTLTQIIVALNVHPNKTRCTQILVCLLAHSGFFVQQKDGKNEQEEESILLPPHLDFFSRISLQLQGSTILLLIADATFTTSFHFLSTWLQNDDQTLFGTADGIFYEAMITDFELIASVLIEDCNEVSKGLKPLVDVGGSTGTMARAIATAFPDTKCTVFACHL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query214 2.2.26 [Sep-21-2011]
B6VJS4 357 Trans-resveratrol di-O-me no no 0.967 0.579 0.413 1e-40
Q93WU2 357 Eugenol O-methyltransfera N/A no 0.901 0.540 0.377 7e-32
Q93WU3 356 Chavicol O-methyltransfer N/A no 0.887 0.533 0.379 2e-31
B0EXJ8 355 Tabersonine 16-O-methyltr N/A no 0.911 0.549 0.4 1e-29
O22308 352 Isoflavone-7-O-methyltran N/A no 0.915 0.556 0.354 5e-27
O24529 352 Isoflavone-7-O-methyltran N/A no 0.915 0.556 0.354 5e-27
Q84KK5 357 Isoflavone 7-O-methyltran N/A no 0.939 0.563 0.318 5e-27
O22309 352 Isoflavone-7-O-methyltran N/A no 0.915 0.556 0.354 1e-26
Q6VMW0 366 8-hydroxyquercetin 8-O-me N/A no 0.976 0.571 0.372 2e-26
O24305 360 6a-hydroxymaackiain methy N/A no 0.920 0.547 0.336 2e-25
>sp|B6VJS4|ROMT_VITVI Trans-resveratrol di-O-methyltransferase OS=Vitis vinifera GN=ROMT PE=1 SV=2 Back     alignment and function desciption
 Score =  166 bits (420), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 93/225 (41%), Positives = 131/225 (58%), Gaps = 18/225 (8%)

Query: 1   MDVIHGENGAREHFQAQAQVWSYTYNYMKSLSLKRAIQLRIPDIINNSGQPMTLTQIIVA 60
           MD+ +G   A E   AQA VW++ +N++KS+SLK AIQL IPDII+N G+PMTL +++  
Sbjct: 1   MDLANGVISA-ELLHAQAHVWNHIFNFIKSMSLKCAIQLGIPDIIHNHGKPMTLPELVAK 59

Query: 61  LNVHPNKTRCTQILVCLLAHSGFFVQQKDGKNEQEEESILLPPHLDFFSRISLQLQGSTI 120
           L VHP +++C   L+ +L HSGF   Q+  + ++EE  +L           SL ++   +
Sbjct: 60  LPVHPKRSQCVYRLMRILVHSGFLAAQRVQQGKEEEGYVLTDASRLLLMDDSLSIR--PL 117

Query: 121 LLLIADATFTTSFHFLSTWLQNDDQTLFGTA---------------DGIFYEAMITDFEL 165
           +L + D   T  +H+LS W QNDD T F TA               +  F EAM +D  L
Sbjct: 118 VLAMLDPILTKPWHYLSAWFQNDDPTPFHTAYERSFWDYAGHEPQLNNSFNEAMASDARL 177

Query: 166 IASVLIEDCNEVSKGLKPLVDVGGSTGTMARAIATAFPDTKCTVF 210
           + SVL+++   V  GL  LVDVGG TG +A+AIA AFP   CTV 
Sbjct: 178 LTSVLLKEGQGVFAGLNSLVDVGGGTGKVAKAIANAFPHLNCTVL 222




Catalyzes the biosynthesis of pterostilbene from resveratrol. Pterostilbene has both antifungal and pharmacological properties. Also has activity toward resveratrol monomethyl ether (RME).
Vitis vinifera (taxid: 29760)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 4EC: 0
>sp|Q93WU2|EOMT1_OCIBA Eugenol O-methyltransferase OS=Ocimum basilicum GN=EOMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q93WU3|CVMT1_OCIBA Chavicol O-methyltransferase OS=Ocimum basilicum GN=CVOMT1 PE=1 SV=1 Back     alignment and function description
>sp|B0EXJ8|HTOMT_CATRO Tabersonine 16-O-methyltransferase OS=Catharanthus roseus GN=16OMT PE=1 SV=1 Back     alignment and function description
>sp|O22308|7OMT6_MEDSA Isoflavone-7-O-methyltransferase 6 OS=Medicago sativa PE=2 SV=1 Back     alignment and function description
>sp|O24529|7OMT8_MEDSA Isoflavone-7-O-methyltransferase 8 OS=Medicago sativa PE=1 SV=1 Back     alignment and function description
>sp|Q84KK5|D7OMT_GLYEC Isoflavone 7-O-methyltransferase OS=Glycyrrhiza echinata GN=D7OMT PE=1 SV=1 Back     alignment and function description
>sp|O22309|7OMT9_MEDSA Isoflavone-7-O-methyltransferase 9 OS=Medicago sativa PE=2 SV=1 Back     alignment and function description
>sp|Q6VMW0|Q8OMT_MENPI 8-hydroxyquercetin 8-O-methyltransferase OS=Mentha piperita GN=OMT2 PE=1 SV=1 Back     alignment and function description
>sp|O24305|M3OM1_PEA 6a-hydroxymaackiain methyltransferase 1 OS=Pisum sativum GN=HMM1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
225446487 357 PREDICTED: tabersonine 16-O-methyltransf 0.953 0.571 0.451 9e-44
359485253 351 PREDICTED: tabersonine 16-O-methyltransf 0.953 0.581 0.451 1e-43
225446491 357 PREDICTED: 8-hydroxyquercetin 8-O-methyl 0.915 0.549 0.452 4e-43
147826879 357 hypothetical protein VITISV_021917 [Viti 0.953 0.571 0.447 1e-42
147816431 357 hypothetical protein VITISV_020020 [Viti 0.915 0.549 0.447 1e-42
255568369 356 o-methyltransferase, putative [Ricinus c 0.934 0.561 0.430 6e-42
359485251 357 PREDICTED: tabersonine 16-O-methyltransf 0.962 0.577 0.434 3e-41
225446485 356 PREDICTED: tabersonine 16-O-methyltransf 0.920 0.553 0.447 5e-41
225454044 358 PREDICTED: tabersonine 16-O-methyltransf 0.971 0.581 0.453 2e-40
359485261 357 PREDICTED: tabersonine 16-O-methyltransf 0.967 0.579 0.426 2e-40
>gi|225446487|ref|XP_002278149.1| PREDICTED: tabersonine 16-O-methyltransferase isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  182 bits (461), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 103/228 (45%), Positives = 139/228 (60%), Gaps = 24/228 (10%)

Query: 1   MDVIHGENGAREHFQAQAQVWSYTYNYMKSLSLKRAIQLRIPDIINNSGQPMTLTQIIVA 60
           MDV  G+  A    QAQA VW++T N++ S++LK A++L IPD INN GQP+TL++++ A
Sbjct: 1   MDVGSGKR-ASLLLQAQAHVWNHTMNFVNSMALKCAVRLGIPDAINNHGQPITLSELVTA 59

Query: 61  LNVHPNKTRCTQILVCLLAHSGFFVQQKDGKNEQEEESILLPPHLDFFSRISLQLQ---G 117
           L+++P K  C   L+ +L HSGFF QQ+   NEQE+        L + SR  L+ +   G
Sbjct: 60  LSINPIKAPCLHRLMRVLVHSGFFAQQQADHNEQEQLY-----SLTYASRFLLKDEPTSG 114

Query: 118 STILLLIADATFTTSFHFLSTWLQNDDQTLFGTADG---------------IFYEAMITD 162
           + +LL+  D   T   HFLS W +N D T F TA G                F EAM +D
Sbjct: 115 APLLLVQVDPHLTNPCHFLSDWFRNSDPTPFVTAYGKPFWDYAAHEPKFNNFFNEAMASD 174

Query: 163 FELIASVLIEDCNEVSKGLKPLVDVGGSTGTMARAIATAFPDTKCTVF 210
            +LIASV++ +C EV +GL  L+DVGG TGTMA+ IA AFP  KCTVF
Sbjct: 175 SQLIASVVVGECKEVFRGLSSLIDVGGGTGTMAKVIAKAFPHLKCTVF 222




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359485253|ref|XP_003633246.1| PREDICTED: tabersonine 16-O-methyltransferase isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225446491|ref|XP_002278211.1| PREDICTED: 8-hydroxyquercetin 8-O-methyltransferase [Vitis vinifera] Back     alignment and taxonomy information
>gi|147826879|emb|CAN73269.1| hypothetical protein VITISV_021917 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147816431|emb|CAN61955.1| hypothetical protein VITISV_020020 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255568369|ref|XP_002525159.1| o-methyltransferase, putative [Ricinus communis] gi|223535618|gb|EEF37286.1| o-methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359485251|ref|XP_003633245.1| PREDICTED: tabersonine 16-O-methyltransferase-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225446485|ref|XP_002278106.1| PREDICTED: tabersonine 16-O-methyltransferase-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225454044|ref|XP_002262833.1| PREDICTED: tabersonine 16-O-methyltransferase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485261|ref|XP_003633249.1| PREDICTED: tabersonine 16-O-methyltransferase-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
UNIPROTKB|Q84KK5 357 D7OMT "Isoflavone 7-O-methyltr 0.939 0.563 0.318 8.4e-26
UNIPROTKB|B0EXJ8 355 16OMT "Tabersonine 16-O-methyl 0.897 0.540 0.369 1.1e-23
UNIPROTKB|Q8GSN1 348 Q8GSN1 "Myricetin O-methyltran 0.873 0.537 0.334 1e-22
UNIPROTKB|Q6VMW0 366 OMT2 "8-hydroxyquercetin 8-O-m 0.827 0.483 0.363 3.4e-22
UNIPROTKB|Q84KK6 367 HI4'OMT "Isoflavone 4'-O-methy 0.710 0.414 0.304 2.3e-15
UNIPROTKB|A8QW53 374 OMT3 "5-pentadecatrienyl resor 0.415 0.237 0.337 2e-14
UNIPROTKB|Q84KK4 365 HI4'OMT "Isoflavone 4'-O-methy 0.738 0.432 0.302 4.8e-14
TAIR|locus:2132806 382 AT4G35160 [Arabidopsis thalian 0.355 0.198 0.325 8.4e-08
TAIR|locus:2132801 325 AT4G35150 [Arabidopsis thalian 0.355 0.233 0.337 1.2e-07
UNIPROTKB|Q84KK5 D7OMT "Isoflavone 7-O-methyltransferase" [Glycyrrhiza echinata (taxid:46348)] Back     alignment and assigned GO terms
 Score = 292 (107.8 bits), Expect = 8.4e-26, P = 8.4e-26
 Identities = 70/220 (31%), Positives = 123/220 (55%)

Query:     8 NGAR--EHFQAQAQVWSYTYNYMKSLSLKRAIQLRIPDIINNSGQPMTLTQIIVALNVHP 65
             NG +  E FQ QA ++ + Y ++ S+ LK  ++L IP+II+N G+P+T+++++  L V  
Sbjct:     6 NGRKPSEIFQGQALLYRHIYAFIDSMCLKWIVELDIPNIIHNHGKPITVSELVSILKVPQ 65

Query:    66 NKTRCTQILVCLLAHSGFFVQQKDGKNEQEEESILLPPHLDFFSRISLQLQGSTILLLIA 125
              K    Q ++  +AH+GFF + +  + ++E E+  L    +   + S +L  + ++  + 
Sbjct:    66 TKAGNVQRIMRYMAHNGFFERVRIQEEQEENEAYALTAASELLVKGS-ELCLAPMVECVL 124

Query:   126 DATFTTSFHFLSTWLQNDDQTLFGTADGI---------------FYEAMITDFELIASVL 170
             D T + S+H L  W+  +D TLFG + G                F +AM +D ++I ++ 
Sbjct:   125 DPTLSGSYHQLKKWIYEEDLTLFGVSLGSHFWEFLNENPEYNKSFNDAMASDSQMI-NLA 183

Query:   171 IEDCNEVSKGLKPLVDVGGSTGTMARAIATAFPDTKCTVF 210
             + DCN   +G++ +VDVGG  GT A+ I   FP+ KC VF
Sbjct:   184 LRDCNSGFEGVESIVDVGGGIGTTAKIICDTFPNLKCIVF 223




GO:0009717 "isoflavonoid biosynthetic process" evidence=IDA
GO:0033800 "isoflavone 7-O-methyltransferase activity" evidence=IDA
UNIPROTKB|B0EXJ8 16OMT "Tabersonine 16-O-methyltransferase" [Catharanthus roseus (taxid:4058)] Back     alignment and assigned GO terms
UNIPROTKB|Q8GSN1 Q8GSN1 "Myricetin O-methyltransferase" [Catharanthus roseus (taxid:4058)] Back     alignment and assigned GO terms
UNIPROTKB|Q6VMW0 OMT2 "8-hydroxyquercetin 8-O-methyltransferase" [Mentha x piperita (taxid:34256)] Back     alignment and assigned GO terms
UNIPROTKB|Q84KK6 HI4'OMT "Isoflavone 4'-O-methyltransferase" [Glycyrrhiza echinata (taxid:46348)] Back     alignment and assigned GO terms
UNIPROTKB|A8QW53 OMT3 "5-pentadecatrienyl resorcinol O-methyltransferase" [Sorghum bicolor (taxid:4558)] Back     alignment and assigned GO terms
UNIPROTKB|Q84KK4 HI4'OMT "Isoflavone 4'-O-methyltransferase" [Lotus japonicus (taxid:34305)] Back     alignment and assigned GO terms
TAIR|locus:2132806 AT4G35160 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132801 AT4G35150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
pfam00891 239 pfam00891, Methyltransf_2, O-methyltransferase 2e-10
pfam0810050 pfam08100, Dimerisation, Dimerisation domain 3e-07
>gnl|CDD|216177 pfam00891, Methyltransf_2, O-methyltransferase Back     alignment and domain information
 Score = 58.4 bits (142), Expect = 2e-10
 Identities = 33/104 (31%), Positives = 45/104 (43%), Gaps = 15/104 (14%)

Query: 121 LLLIADATFTTSFHFLSTWLQNDDQTLFGTADGI-FYEAMITDFEL-------------I 166
           LL+ AD T   S+  L   ++ +    F  A G+ F+E +  D E              +
Sbjct: 29  LLMYADPTLLESWAHLKDAVR-EGGPPFERAFGMPFFEYLGADPEFNRVFNRAMAAHSRL 87

Query: 167 ASVLIEDCNEVSKGLKPLVDVGGSTGTMARAIATAFPDTKCTVF 210
               I +      GL  LVDVGG TG +A AI  A+P  K  VF
Sbjct: 88  VMKKILETAFDFSGLSSLVDVGGGTGALAAAIVRAYPHIKGIVF 131


This family includes a range of O-methyltransferases. These enzymes utilise S-adenosyl methionine. Length = 239

>gnl|CDD|219719 pfam08100, Dimerisation, Dimerisation domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 214
TIGR02716 306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 99.91
KOG3178 342 consensus Hydroxyindole-O-methyltransferase and re 99.89
PF00891 241 Methyltransf_2: O-methyltransferase; InterPro: IPR 99.75
PF0810051 Dimerisation: Dimerisation domain; InterPro: IPR01 98.92
PF0933952 HTH_IclR: IclR helix-turn-helix domain; InterPro: 97.83
PRK14103 255 trans-aconitate 2-methyltransferase; Provisional 97.67
COG4106 257 Tam Trans-aconitate methyltransferase [General fun 97.54
PRK08287 187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 97.53
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 97.5
smart0034691 HTH_ICLR helix_turn_helix isocitrate lyase regulat 97.41
PRK01683 258 trans-aconitate 2-methyltransferase; Provisional 97.39
COG2813 300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 97.33
PRK15001 378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 97.27
COG1414246 IclR Transcriptional regulator [Transcription] 97.25
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 97.17
PRK06922 677 hypothetical protein; Provisional 97.16
PRK11569274 transcriptional repressor IclR; Provisional 97.16
PRK00107 187 gidB 16S rRNA methyltransferase GidB; Reviewed 97.13
PRK10163271 DNA-binding transcriptional repressor AllR; Provis 97.12
PF05175 170 MTS: Methyltransferase small domain; InterPro: IPR 97.07
PRK15090257 DNA-binding transcriptional regulator KdgR; Provis 97.05
TIGR02752 231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 97.04
TIGR02431248 pcaR_pcaU beta-ketoadipate pathway transcriptional 97.03
TIGR00138 181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 97.03
COG2230 283 Cfa Cyclopropane fatty acid synthase and related m 97.02
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 96.97
PRK07402 196 precorrin-6B methylase; Provisional 96.96
TIGR03587 204 Pse_Me-ase pseudaminic acid biosynthesis-associate 96.92
PRK00121 202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 96.9
PRK09834263 DNA-binding transcriptional activator MhpR; Provis 96.89
PRK09489 342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 96.88
TIGR02072 240 BioC biotin biosynthesis protein BioC. This enzyme 96.87
TIGR00740 239 methyltransferase, putative. A simple BLAST search 96.85
PF1284061 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ 96.75
PRK15451 247 tRNA cmo(5)U34 methyltransferase; Provisional 96.72
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 96.72
PRK11207 197 tellurite resistance protein TehB; Provisional 96.71
cd0009267 HTH_CRP helix_turn_helix, cAMP Regulatory protein 96.66
PRK15068 322 tRNA mo(5)U34 methyltransferase; Provisional 96.64
PF02353 273 CMAS: Mycolic acid cyclopropane synthetase; InterP 96.63
PRK00274 272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 96.61
TIGR03533 284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 96.6
PRK04457 262 spermidine synthase; Provisional 96.56
PF0197868 TrmB: Sugar-specific transcriptional regulator Trm 96.56
COG2890 280 HemK Methylase of polypeptide chain release factor 96.55
PF13489 161 Methyltransf_23: Methyltransferase domain; PDB: 3J 96.54
TIGR03534 251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 96.54
PRK06202 232 hypothetical protein; Provisional 96.52
TIGR00477 195 tehB tellurite resistance protein TehB. Part of a 96.52
PRK00216 239 ubiE ubiquinone/menaquinone biosynthesis methyltra 96.52
PRK11805 307 N5-glutamine S-adenosyl-L-methionine-dependent met 96.51
PRK09328 275 N5-glutamine S-adenosyl-L-methionine-dependent met 96.51
PRK14966 423 unknown domain/N5-glutamine S-adenosyl-L-methionin 96.49
PF0102247 HTH_5: Bacterial regulatory protein, arsR family; 96.49
TIGR00536 284 hemK_fam HemK family putative methylases. The gene 96.48
COG2242 187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 96.44
TIGR03704 251 PrmC_rel_meth putative protein-(glutamine-N5) meth 96.43
PLN02244 340 tocopherol O-methyltransferase 96.42
PRK10258 251 biotin biosynthesis protein BioC; Provisional 96.42
PF1346368 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL 96.39
TIGR00452 314 methyltransferase, putative. Known examples to dat 96.35
TIGR02021 219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 96.33
PRK05785 226 hypothetical protein; Provisional 96.33
PF0208283 Rrf2: Transcriptional regulator; InterPro: IPR0009 96.31
smart0041948 HTH_CRP helix_turn_helix, cAMP Regulatory protein. 96.3
PTZ00098 263 phosphoethanolamine N-methyltransferase; Provision 96.3
COG2226 238 UbiE Methylase involved in ubiquinone/menaquinone 96.28
COG4123 248 Predicted O-methyltransferase [General function pr 96.28
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 96.22
TIGR00438 188 rrmJ cell division protein FtsJ. 96.21
PF13679141 Methyltransf_32: Methyltransferase domain 96.19
TIGR01934 223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 96.18
PRK10857164 DNA-binding transcriptional regulator IscR; Provis 96.18
PRK10141117 DNA-binding transcriptional repressor ArsR; Provis 96.13
PRK11705 383 cyclopropane fatty acyl phospholipid synthase; Pro 96.12
PRK07580 230 Mg-protoporphyrin IX methyl transferase; Validated 96.09
PF0901269 FeoC: FeoC like transcriptional regulator; InterPr 96.09
PLN02336 475 phosphoethanolamine N-methyltransferase 96.07
PRK11188 209 rrmJ 23S rRNA methyltransferase J; Provisional 96.02
COG0220 227 Predicted S-adenosylmethionine-dependent methyltra 95.99
PRK11088 272 rrmA 23S rRNA methyltransferase A; Provisional 95.98
TIGR00755 253 ksgA dimethyladenosine transferase. Alternate name 95.97
PLN02233 261 ubiquinone biosynthesis methyltransferase 95.97
TIGR02337118 HpaR homoprotocatechuate degradation operon regula 95.92
TIGR00080 215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 95.91
PRK14896 258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 95.89
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 95.88
KOG2899 288 consensus Predicted methyltransferase [General fun 95.87
PF0470362 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. 95.87
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resi 95.87
PRK11036 255 putative S-adenosyl-L-methionine-dependent methylt 95.82
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 95.8
PRK04266 226 fibrillarin; Provisional 95.79
PRK12335 287 tellurite resistance protein TehB; Provisional 95.76
TIGR03438 301 probable methyltransferase. This model represents 95.72
PLN03075 296 nicotianamine synthase; Provisional 95.71
TIGR02010135 IscR iron-sulfur cluster assembly transcription fa 95.68
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 95.66
PRK00377 198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 95.65
PF08003 315 Methyltransf_9: Protein of unknown function (DUF16 95.6
PRK13942 212 protein-L-isoaspartate O-methyltransferase; Provis 95.59
PLN02490 340 MPBQ/MSBQ methyltransferase 95.55
PF1280262 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP 95.53
COG2345218 Predicted transcriptional regulator [Transcription 95.51
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repr 95.47
PRK03902142 manganese transport transcriptional regulator; Pro 95.46
COG3355126 Predicted transcriptional regulator [Transcription 95.44
PF01209 233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 95.41
PHA03411 279 putative methyltransferase; Provisional 95.4
TIGR00738132 rrf2_super rrf2 family protein (putative transcrip 95.33
COG2227 243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 95.32
TIGR0012269 birA_repr_reg BirA biotin operon repressor domain. 95.28
PLN02396 322 hexaprenyldihydroxybenzoate methyltransferase 95.26
smart00138 264 MeTrc Methyltransferase, chemotaxis proteins. Meth 95.22
PF0104759 MarR: MarR family; InterPro: IPR000835 The MarR-ty 95.2
PLN02672 1082 methionine S-methyltransferase 95.17
TIGR02702203 SufR_cyano iron-sulfur cluster biosynthesis transc 95.09
COG1321154 TroR Mn-dependent transcriptional regulator [Trans 95.08
PRK06266178 transcription initiation factor E subunit alpha; V 95.07
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 95.06
PF06325 295 PrmA: Ribosomal protein L11 methyltransferase (Prm 95.05
PLN02336 475 phosphoethanolamine N-methyltransferase 95.04
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 95.0
PLN02366 308 spermidine synthase 94.99
PF03848 192 TehB: Tellurite resistance protein TehB; InterPro: 94.98
PF1494777 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_ 94.93
PRK00811 283 spermidine synthase; Provisional 94.92
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 94.89
PF07757112 AdoMet_MTase: Predicted AdoMet-dependent methyltra 94.88
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto 94.85
PRK03573144 transcriptional regulator SlyA; Provisional 94.85
PRK11727 321 23S rRNA mA1618 methyltransferase; Provisional 94.84
PRK14967 223 putative methyltransferase; Provisional 94.83
TIGR01884203 cas_HTH CRISPR locus-related DNA-binding protein. 94.82
PF0132560 Fe_dep_repress: Iron dependent repressor, N-termin 94.82
PRK11050152 manganese transport regulator MntR; Provisional 94.8
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Op 94.79
PLN02585 315 magnesium protoporphyrin IX methyltransferase 94.78
PRK10901 427 16S rRNA methyltransferase B; Provisional 94.76
KOG3115 249 consensus Methyltransferase-like protein [General 94.73
PRK11873 272 arsM arsenite S-adenosylmethyltransferase; Reviewe 94.66
COG2264 300 PrmA Ribosomal protein L11 methylase [Translation, 94.64
TIGR02944130 suf_reg_Xantho FeS assembly SUF system regulator, 94.63
PHA00738108 putative HTH transcription regulator 94.61
COG1959150 Predicted transcriptional regulator [Transcription 94.58
TIGR00478 228 tly hemolysin TlyA family protein. Hemolysins are 94.57
PF0846166 HTH_12: Ribonuclease R winged-helix domain; InterP 94.56
PF0172665 LexA_DNA_bind: LexA DNA binding domain; InterPro: 94.52
PHA03412 241 putative methyltransferase; Provisional 94.46
KOG1270 282 consensus Methyltransferases [Coenzyme transport a 94.4
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 94.39
TIGR03840 213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 94.35
KOG2904 328 consensus Predicted methyltransferase [General fun 94.28
PF1360180 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9 94.27
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 94.26
PRK14902 444 16S rRNA methyltransferase B; Provisional 94.26
PF05148 219 Methyltransf_8: Hypothetical methyltransferase; In 94.22
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 94.19
PRK11512144 DNA-binding transcriptional repressor MarR; Provis 94.14
PF06163127 DUF977: Bacterial protein of unknown function (DUF 94.07
cd0737766 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-bindi 94.04
PRK05134 233 bifunctional 3-demethylubiquinone-9 3-methyltransf 94.02
PRK13168 443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 94.02
COG4190144 Predicted transcriptional regulator [Transcription 93.95
PRK13943 322 protein-L-isoaspartate O-methyltransferase; Provis 93.93
PRK11014141 transcriptional repressor NsrR; Provisional 93.93
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and 93.9
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 93.81
smart0034560 HTH_GNTR helix_turn_helix gluconate operon transcr 93.81
PRK01581 374 speE spermidine synthase; Validated 93.76
PRK00312 212 pcm protein-L-isoaspartate O-methyltransferase; Re 93.7
COG4742260 Predicted transcriptional regulator [Transcription 93.65
PRK04148134 hypothetical protein; Provisional 93.58
PRK11920153 rirA iron-responsive transcriptional regulator; Re 93.55
TIGR00563 426 rsmB ribosomal RNA small subunit methyltransferase 93.46
KOG1540 296 consensus Ubiquinone biosynthesis methyltransferas 93.46
PRK13255 218 thiopurine S-methyltransferase; Reviewed 93.44
TIGR01889109 Staph_reg_Sar staphylococcal accessory regulator f 93.4
cd07153116 Fur_like Ferric uptake regulator(Fur) and related 93.36
PRK06474178 hypothetical protein; Provisional 93.34
TIGR00417 270 speE spermidine synthase. the SpeE subunit of sper 93.23
PF0032532 Crp: Bacterial regulatory proteins, crp family; In 93.19
TIGR01983 224 UbiG ubiquinone biosynthesis O-methyltransferase. 93.0
PRK1543178 ferrous iron transport protein FeoC; Provisional 92.98
PRK03522 315 rumB 23S rRNA methyluridine methyltransferase; Rev 92.89
smart0052996 HTH_DTXR Helix-turn-helix diphteria tox regulatory 92.54
PF02002105 TFIIE_alpha: TFIIE alpha subunit; InterPro: IPR024 92.52
PF0163890 HxlR: HxlR-like helix-turn-helix; InterPro: IPR002 92.31
COG4189 308 Predicted transcriptional regulator [Transcription 92.17
TIGR0161095 phage_O_Nterm phage replication protein O, N-termi 92.16
PF0738190 DUF1495: Winged helix DNA-binding domain (DUF1495) 92.03
TIGR02085 374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 92.02
PRK11169164 leucine-responsive transcriptional regulator; Prov 91.92
KOG1271 227 consensus Methyltransferases [General function pre 91.91
PF0231971 E2F_TDP: E2F/DP family winged-helix DNA-binding do 91.85
PF07789155 DUF1627: Protein of unknown function (DUF1627); In 91.85
PRK03612 521 spermidine synthase; Provisional 91.82
PRK10909 199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 91.76
PF02527 184 GidB: rRNA small subunit methyltransferase G; Inte 91.73
COG4565224 CitB Response regulator of citrate/malate metaboli 91.54
PRK10870176 transcriptional repressor MprA; Provisional 91.53
PRK11179153 DNA-binding transcriptional regulator AsnC; Provis 91.5
PF0822162 HTH_9: RNA polymerase III subunit RPC82 helix-turn 91.31
PF14394171 DUF4423: Domain of unknown function (DUF4423) 91.17
PRK04214412 rbn ribonuclease BN/unknown domain fusion protein; 91.14
COG1522154 Lrp Transcriptional regulators [Transcription] 91.1
COG0357 215 GidB Predicted S-adenosylmethionine-dependent meth 91.08
PLN02781 234 Probable caffeoyl-CoA O-methyltransferase 91.03
TIGR00479 431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 90.95
PF00398 262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 90.94
PF09243 274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 90.86
TIGR00095 189 RNA methyltransferase, RsmD family. This model rep 90.78
PF1354576 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 90.17
PF08784102 RPA_C: Replication protein A C terminal; InterPro: 90.04
PF08123 205 DOT1: Histone methylation protein DOT1 ; InterPro: 89.92
COG1378247 Predicted transcriptional regulators [Transcriptio 89.86
PF01135 209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 89.83
PTZ00146 293 fibrillarin; Provisional 89.79
TIGR01177 329 conserved hypothetical protein TIGR01177. This fam 89.74
PRK14903 431 16S rRNA methyltransferase B; Provisional 89.72
PRK13509251 transcriptional repressor UlaR; Provisional 89.72
KOG1499 346 consensus Protein arginine N-methyltransferase PRM 89.62
COG4976 287 Predicted methyltransferase (contains TPR repeat) 89.58
PRK04172 489 pheS phenylalanyl-tRNA synthetase subunit alpha; P 89.42
PRK14165217 winged helix-turn-helix domain-containing protein/ 89.29
PLN02823 336 spermine synthase 89.25
PRK00215205 LexA repressor; Validated 89.2
PF1373055 HTH_36: Helix-turn-helix domain 89.2
PF0418275 B-block_TFIIIC: B-block binding subunit of TFIIIC; 89.14
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 89.1
KOG1541 270 consensus Predicted protein carboxyl methylase [Ge 89.06
PRK14901 434 16S rRNA methyltransferase B; Provisional 89.04
PRK00536 262 speE spermidine synthase; Provisional 89.01
TIGR00498199 lexA SOS regulatory protein LexA. LexA acts as a h 88.96
PF0344478 HrcA_DNA-bdg: Winged helix-turn-helix transcriptio 88.91
TIGR02787251 codY_Gpos GTP-sensing transcriptional pleiotropic 88.87
TIGR02143 353 trmA_only tRNA (uracil-5-)-methyltransferase. This 88.79
PF0039264 GntR: Bacterial regulatory proteins, gntR family; 88.65
COG1497260 Predicted transcriptional regulator [Transcription 88.49
TIGR00446 264 nop2p NOL1/NOP2/sun family putative RNA methylase. 88.43
COG0030 259 KsgA Dimethyladenosine transferase (rRNA methylati 88.39
COG1846126 MarR Transcriptional regulators [Transcription] 88.38
COG0421 282 SpeE Spermidine synthase [Amino acid transport and 88.14
PRK10906252 DNA-binding transcriptional repressor GlpR; Provis 88.08
KOG3010 261 consensus Methyltransferase [General function pred 87.99
PHA02943165 hypothetical protein; Provisional 87.8
KOG3420 185 consensus Predicted RNA methylase [Translation, ri 87.74
PRK14904 445 16S rRNA methyltransferase B; Provisional 87.6
PRK09802269 DNA-binding transcriptional regulator AgaR; Provis 87.58
PRK11886 319 bifunctional biotin--[acetyl-CoA-carboxylase] synt 87.4
COG1349253 GlpR Transcriptional regulators of sugar metabolis 87.35
PF0279645 HTH_7: Helix-turn-helix domain of resolvase; Inter 87.29
PRK10046225 dpiA two-component response regulator DpiA; Provis 87.11
PF01596 205 Methyltransf_3: O-methyltransferase; InterPro: IPR 87.06
PF1000792 DUF2250: Uncharacterized protein conserved in arch 86.96
PF05732165 RepL: Firmicute plasmid replication protein (RepL) 86.8
PRK13777185 transcriptional regulator Hpr; Provisional 86.77
COG343295 Predicted transcriptional regulator [Transcription 86.71
PRK10434256 srlR DNA-bindng transcriptional repressor SrlR; Pr 86.65
COG2512258 Predicted membrane-associated trancriptional regul 86.59
PRK10411240 DNA-binding transcriptional activator FucR; Provis 86.45
PRK05031 362 tRNA (uracil-5-)-methyltransferase; Validated 86.45
COG1510177 Predicted transcriptional regulators [Transcriptio 86.4
COG2518 209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 86.17
COG1733120 Predicted transcriptional regulators [Transcriptio 85.96
KOG3045 325 consensus Predicted RNA methylase involved in rRNA 85.91
PF12793115 SgrR_N: Sugar transport-related sRNA regulator N-t 85.74
PF05401 201 NodS: Nodulation protein S (NodS); InterPro: IPR00 85.56
PRK11639169 zinc uptake transcriptional repressor; Provisional 85.21
PF1351852 HTH_28: Helix-turn-helix domain 85.2
smart00531147 TFIIE Transcription initiation factor IIE. 84.9
COG2263 198 Predicted RNA methylase [Translation, ribosomal st 84.88
TIGR02147271 Fsuc_second hypothetical protein, TIGR02147. This 84.63
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 84.57
PRK12423202 LexA repressor; Provisional 83.69
PF1338450 HTH_23: Homeodomain-like domain; PDB: 2X48_C. 83.14
PF01564 246 Spermine_synth: Spermine/spermidine synthase; Inte 83.12
COG3413215 Predicted DNA binding protein [General function pr 83.08
PF0016542 HTH_AraC: Bacterial regulatory helix-turn-helix pr 82.91
PLN02853 492 Probable phenylalanyl-tRNA synthetase alpha chain 82.47
PF0558472 Sulfolobus_pRN: Sulfolobus plasmid regulatory prot 82.27
COG1675176 TFA1 Transcription initiation factor IIE, alpha su 82.24
PLN02476 278 O-methyltransferase 81.8
KOG2361 264 consensus Predicted methyltransferase [General fun 81.72
PRK05638442 threonine synthase; Validated 81.65
TIGR0387973 near_KaiC_dom probable regulatory domain. This mod 81.37
PF03428177 RP-C: Replication protein C N-terminal domain; Int 81.29
COG165479 BirA Biotin operon repressor [Transcription] 81.06
PRK10736374 hypothetical protein; Provisional 80.99
PRK15128 396 23S rRNA m(5)C1962 methyltransferase; Provisional 80.91
PTZ00326 494 phenylalanyl-tRNA synthetase alpha chain; Provisio 80.85
PRK11760 357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 80.76
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 80.68
COG4122 219 Predicted O-methyltransferase [General function pr 80.51
TIGR0132194 TrpR trp operon repressor, proteobacterial. This m 80.45
PRK09954 362 putative kinase; Provisional 80.4
PRK04424185 fatty acid biosynthesis transcriptional regulator; 80.36
PF01475120 FUR: Ferric uptake regulator family; InterPro: IPR 80.29
PF0828059 HTH_Mga: M protein trans-acting positive regulator 80.04
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
Probab=99.91  E-value=2.5e-24  Score=185.74  Aligned_cols=165  Identities=18%  Similarity=0.286  Sum_probs=127.3

Q ss_pred             hHHHHHHHHHhcCcchhhhcCCCCCCHHHHHHHcCCCCCCcccHHHHHHHHHhCCceeeecCCCCCCccceeeCCCCCcc
Q 040620           28 MKSLSLKRAIQLRIPDIINNSGQPMTLTQIIVALNVHPNKTRCTQILVCLLAHSGFFVQQKDGKNEQEEESILLPPHLDF  107 (214)
Q Consensus        28 ~~~~~L~~a~~lglfd~L~~~~~p~t~~eLA~~~g~~~~~~~~l~rlLr~L~~~g~l~~~~~~~~~~~~~~y~~t~~~~~  107 (214)
                      +...+|++|+++||||+|++  +|.|++|||+++|+++   +.++||||+|+++|+++++        +++|++|+.   
T Consensus         2 ~~~~~l~aa~~Lglfd~L~~--gp~t~~eLA~~~~~~~---~~~~~lL~~L~~lgll~~~--------~~~y~~t~~---   65 (306)
T TIGR02716         2 IEFSCMKAAIELDLFSHMAE--GPKDLATLAADTGSVP---PRLEMLLETLRQMRVINLE--------DGKWSLTEF---   65 (306)
T ss_pred             chHHHHHHHHHcCcHHHHhc--CCCCHHHHHHHcCCCh---HHHHHHHHHHHhCCCeEec--------CCcEecchh---
Confidence            46789999999999999987  8999999999999999   9999999999999999987        489999999   


Q ss_pred             cccccc-c--cc----hHHHHHHhhccchhhhhHhHHHhhcCCCCChhhHH---------HHHHHHHhhhh-hhhhHHHH
Q 040620          108 FSRISL-Q--LQ----GSTILLLIADATFTTSFHFLSTWLQNDDQTLFGTA---------DGIFYEAMITD-FELIASVL  170 (214)
Q Consensus       108 ~s~~l~-~--~~----~~~~~~~~~~~~~~~~~~~l~~~lr~~~~~~f~~~---------~g~f~~am~~~-~~~~~~~~  170 (214)
                       ++.++ +  +.    +..+...+.. .....|.++.+++|++.  +|...         ...|...|... .....+.+
T Consensus        66 -~~~~l~~~~~~~~~~~~~~~~~~~~-~~~~~~~~l~~~~r~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  141 (306)
T TIGR02716        66 -ADYMFSPTPKEPNLHQTPVAKAMAF-LADDFYMGLSQAVRGQK--NFKGQVPYPPVTREDNLYFEEIHRSNAKFAIQLL  141 (306)
T ss_pred             -HHhhccCCccchhhhcCchHHHHHH-HHHHHHHhHHHHhcCCc--ccccccCCCCCCHHHHHhHHHHHHhcchhHHHHH
Confidence             88776 2  21    1123322211 23356899999998532  23211         11455555433 33445556


Q ss_pred             HhhcccccCCCCcEEeecCCchHHHHHHHHHCCCCeEEEecCCC
Q 040620          171 IEDCNEVSKGLKPLVDVGGSTGTMARAIATAFPDTKCTVFACHL  214 (214)
Q Consensus       171 l~~~~~~~~~~~~vvDVGGG~G~~~~~l~~~~P~l~~~v~Dlp~  214 (214)
                      ++..+  +++..+|||||||+|.+++.+++++|+++++++|+|+
T Consensus       142 ~~~~~--~~~~~~vlDiG~G~G~~~~~~~~~~p~~~~~~~D~~~  183 (306)
T TIGR02716       142 LEEAK--LDGVKKMIDVGGGIGDISAAMLKHFPELDSTILNLPG  183 (306)
T ss_pred             HHHcC--CCCCCEEEEeCCchhHHHHHHHHHCCCCEEEEEecHH
Confidence            77766  7788999999999999999999999999999999873



Members of this protein family are the S-adenosylmethionine-depenedent C-20 methyltransferase BchU, part of the pathway of bacteriochlorophyll c production in photosynthetic green sulfur bacteria. The position modified by this enzyme represents the difference between bacteriochlorophylls c and d; strains lacking this protein can only produced bacteriochlorophyll d.

>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF08100 Dimerisation: Dimerisation domain; InterPro: IPR012967 This domain is found at the N terminus of a variety of plant O-methyltransferases Back     alignment and domain information
>PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>COG1414 IclR Transcriptional regulator [Transcription] Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK11569 transcriptional repressor IclR; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK10163 DNA-binding transcriptional repressor AllR; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK15090 DNA-binding transcriptional regulator KdgR; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>TIGR02431 pcaR_pcaU beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK09834 DNA-binding transcriptional activator MhpR; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PF13463 HTH_27: Winged helix DNA-binding domain; PDB: 3GFL_A 2YR2_B 3GFM_A 3GFJ_A 3GF2_A 3GEZ_A 2GXG_A 3GFI_A 2EB7_A Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp Back     alignment and domain information
>smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK10857 DNA-binding transcriptional regulator IscR; Provisional Back     alignment and domain information
>PRK10141 DNA-binding transcriptional repressor ArsR; Provisional Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>TIGR02337 HpaR homoprotocatechuate degradation operon regulator, HpaR Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>TIGR02010 IscR iron-sulfur cluster assembly transcription factor IscR Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B Back     alignment and domain information
>COG2345 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>PRK03902 manganese transport transcriptional regulator; Provisional Back     alignment and domain information
>COG3355 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR00738 rrf2_super rrf2 family protein (putative transcriptional regulator) Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00122 birA_repr_reg BirA biotin operon repressor domain Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR Back     alignment and domain information
>COG1321 TroR Mn-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PF14947 HTH_45: Winged helix-turn-helix; PDB: 1XSX_B 1R7J_A Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information
>PRK03573 transcriptional regulator SlyA; Provisional Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein Back     alignment and domain information
>PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family Back     alignment and domain information
>PRK11050 manganese transport regulator MntR; Provisional Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02944 suf_reg_Xantho FeS assembly SUF system regulator, gammaproteobacterial Back     alignment and domain information
>PHA00738 putative HTH transcription regulator Back     alignment and domain information
>COG1959 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PF08461 HTH_12: Ribonuclease R winged-helix domain; InterPro: IPR013668 This domain is found at the amino terminus of Ribonuclease R and a number of presumed transcriptional regulatory proteins from archaea Back     alignment and domain information
>PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF13601 HTH_34: Winged helix DNA-binding domain; PDB: 1UB9_A Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PRK11512 DNA-binding transcriptional repressor MarR; Provisional Back     alignment and domain information
>PF06163 DUF977: Bacterial protein of unknown function (DUF977); InterPro: IPR010382 This entry consists of several hypothetical bacterial proteins of unknown function Back     alignment and domain information
>cd07377 WHTH_GntR Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>COG4190 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK11014 transcriptional repressor NsrR; Provisional Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>COG4742 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK11920 rirA iron-responsive transcriptional regulator; Reviewed Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>TIGR01889 Staph_reg_Sar staphylococcal accessory regulator family Back     alignment and domain information
>cd07153 Fur_like Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators Back     alignment and domain information
>PRK06474 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PRK15431 ferrous iron transport protein FeoC; Provisional Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>smart00529 HTH_DTXR Helix-turn-helix diphteria tox regulatory element Back     alignment and domain information
>PF02002 TFIIE_alpha: TFIIE alpha subunit; InterPro: IPR024550 The general transcription factor TFIIE has an essential role in eukaryotic transcription initiation, together with RNA polymerase II and other general factors Back     alignment and domain information
>PF01638 HxlR: HxlR-like helix-turn-helix; InterPro: IPR002577 The hxlR-type HTH domain is a domain of ~90-100 amino acids present in putative transcription regulators with a winged helix-turn-helix (wHTH) structure Back     alignment and domain information
>COG4189 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR01610 phage_O_Nterm phage replication protein O, N-terminal domain Back     alignment and domain information
>PF07381 DUF1495: Winged helix DNA-binding domain (DUF1495); InterPro: IPR010863 This family consists of several hypothetical archaeal proteins of around 110 residues in length Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PRK11169 leucine-responsive transcriptional regulator; Provisional Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>PF02319 E2F_TDP: E2F/DP family winged-helix DNA-binding domain; InterPro: IPR003316 The mammalian transcription factor E2F plays an important role in regulating the expression of genes that are required for passage through the cell cycle Back     alignment and domain information
>PF07789 DUF1627: Protein of unknown function (DUF1627); InterPro: IPR012432 This is a group of sequences found in hypothetical proteins predicted to be expressed in a number of bacterial species Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK10870 transcriptional repressor MprA; Provisional Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information
>PF08221 HTH_9: RNA polymerase III subunit RPC82 helix-turn-helix domain; InterPro: IPR013197 DNA-directed RNA polymerases 2 Back     alignment and domain information
>PF14394 DUF4423: Domain of unknown function (DUF4423) Back     alignment and domain information
>PRK04214 rbn ribonuclease BN/unknown domain fusion protein; Reviewed Back     alignment and domain information
>COG1522 Lrp Transcriptional regulators [Transcription] Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A Back     alignment and domain information
>PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>COG1378 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK13509 transcriptional repressor UlaR; Provisional Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>PRK14165 winged helix-turn-helix domain-containing protein/riboflavin kinase; Provisional Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>PRK00215 LexA repressor; Validated Back     alignment and domain information
>PF13730 HTH_36: Helix-turn-helix domain Back     alignment and domain information
>PF04182 B-block_TFIIIC: B-block binding subunit of TFIIIC; InterPro: IPR007309 Yeast transcription factor IIIC (TFIIIC) is a multisubunit protein complex that interacts with two control elements of class III promoters called the A and B blocks Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>TIGR00498 lexA SOS regulatory protein LexA Back     alignment and domain information
>PF03444 HrcA_DNA-bdg: Winged helix-turn-helix transcription repressor, HrcA DNA-binding; InterPro: IPR005104 Prokaryotic cells have a defence mechanism against a sudden heat-shock stress Back     alignment and domain information
>TIGR02787 codY_Gpos GTP-sensing transcriptional pleiotropic repressor CodY Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PF00392 GntR: Bacterial regulatory proteins, gntR family; InterPro: IPR000524 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>COG1497 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1846 MarR Transcriptional regulators [Transcription] Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10906 DNA-binding transcriptional repressor GlpR; Provisional Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PHA02943 hypothetical protein; Provisional Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK09802 DNA-binding transcriptional regulator AgaR; Provisional Back     alignment and domain information
>PRK11886 bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor; Provisional Back     alignment and domain information
>COG1349 GlpR Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PF10007 DUF2250: Uncharacterized protein conserved in archaea (DUF2250); InterPro: IPR019254 Members of this family of hypothetical archaeal proteins have no known function Back     alignment and domain information
>PF05732 RepL: Firmicute plasmid replication protein (RepL); InterPro: IPR008813 This entry consists of proteins thought to be involved in plasmid replication Back     alignment and domain information
>PRK13777 transcriptional regulator Hpr; Provisional Back     alignment and domain information
>COG3432 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PRK10434 srlR DNA-bindng transcriptional repressor SrlR; Provisional Back     alignment and domain information
>COG2512 Predicted membrane-associated trancriptional regulator [Transcription] Back     alignment and domain information
>PRK10411 DNA-binding transcriptional activator FucR; Provisional Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>COG1510 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1733 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>PF12793 SgrR_N: Sugar transport-related sRNA regulator N-term Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK11639 zinc uptake transcriptional repressor; Provisional Back     alignment and domain information
>PF13518 HTH_28: Helix-turn-helix domain Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02147 Fsuc_second hypothetical protein, TIGR02147 Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PRK12423 LexA repressor; Provisional Back     alignment and domain information
>PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>COG3413 Predicted DNA binding protein [General function prediction only] Back     alignment and domain information
>PF00165 HTH_AraC: Bacterial regulatory helix-turn-helix proteins, AraC family; PDB: 1WPK_A 1ZGW_A 1U8B_A Back     alignment and domain information
>PLN02853 Probable phenylalanyl-tRNA synthetase alpha chain Back     alignment and domain information
>PF05584 Sulfolobus_pRN: Sulfolobus plasmid regulatory protein; InterPro: IPR008848 This family consists of several plasmid regulatory proteins from the extreme thermophilic and acidophilic archaea Sulfolobus Back     alignment and domain information
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription] Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK05638 threonine synthase; Validated Back     alignment and domain information
>TIGR03879 near_KaiC_dom probable regulatory domain Back     alignment and domain information
>PF03428 RP-C: Replication protein C N-terminal domain; InterPro: IPR005090 Proteins in this group have homology with the RepC protein of Agrobacterium Ri and Ti plasmids [] Back     alignment and domain information
>COG1654 BirA Biotin operon repressor [Transcription] Back     alignment and domain information
>PRK10736 hypothetical protein; Provisional Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PTZ00326 phenylalanyl-tRNA synthetase alpha chain; Provisional Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01321 TrpR trp operon repressor, proteobacterial Back     alignment and domain information
>PRK09954 putative kinase; Provisional Back     alignment and domain information
>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional Back     alignment and domain information
>PF01475 FUR: Ferric uptake regulator family; InterPro: IPR002481 The Ferric uptake regulator (FUR) family includes metal ion uptake regulator proteins Back     alignment and domain information
>PF08280 HTH_Mga: M protein trans-acting positive regulator (MGA) HTH domain; InterPro: IPR013199 Mga is a DNA-binding protein that activates the expression of several important virulence genes in group A streptococcus in response to changing environmental conditions [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
2qyo_A 357 Crystal Structure Of Isoflavone O-Methyltransferase 4e-28
1fp2_A 352 Crystal Structure Analysis Of Isoflavone O-Methyltr 4e-28
1fpx_A 352 Crystal Structure Analysis Of Selenomethionine Subs 5e-26
1zgj_A 354 Crystal Structure Of Isoflavanone 4'-O-Methyltransf 1e-18
1zga_A 357 Crystal Structure Of Isoflavanone 4'-o-methyltransf 1e-18
1zg3_A 358 Crystal Structure Of The Isoflavanone 4'-O-Methyltr 1e-18
>pdb|2QYO|A Chain A, Crystal Structure Of Isoflavone O-Methyltransferase Homolog In Complex With Biochanin A And Sah Length = 357 Back     alignment and structure

Iteration: 1

Score = 120 bits (302), Expect = 4e-28, Method: Compositional matrix adjust. Identities = 71/214 (33%), Positives = 118/214 (55%), Gaps = 17/214 (7%) Query: 12 EHFQAQAQVWSYTYNYMKSLSLKRAIQLRIPDIINNSGQPMTLTQIIVALNVHPNKTRCT 71 E F+AQA ++ Y ++ S+SLK +I++ IP+II+N G+P+TL+ ++ L + K Sbjct: 12 EIFKAQALLYKNMYAFVDSMSLKWSIEMNIPNIIHNHGKPITLSNLVSILQIPSTKVDNV 71 Query: 72 QILVCLLAHSGFFVQQKDGKNEQEEESILLPPHLDFFSRISLQLQGSTILLLIADATFTT 131 Q L+ LAH+GFF + + E EEE+ L + + +L + ++ + D T +T Sbjct: 72 QRLMRYLAHNGFFEIITNQELENEEEAYALTVASELLVK-GTELCLAPMVECVLDPTLST 130 Query: 132 SFHFLSTWLQNDDQTLFGTADG---------------IFYEAMITDFELIASVLIEDCNE 176 SFH L W+ +D TLF G ++ +A+ +D ++I ++ ++DCN Sbjct: 131 SFHNLKKWVYEEDLTLFAVNLGCDLWEFLNKNPEYNTLYNDALASDSKMI-NLAMKDCNL 189 Query: 177 VSKGLKPLVDVGGSTGTMARAIATAFPDTKCTVF 210 V +GL+ +VDVGG GT + I FP C VF Sbjct: 190 VFEGLESIVDVGGGNGTTGKIICETFPKLTCVVF 223
>pdb|1FP2|A Chain A, Crystal Structure Analysis Of Isoflavone O-Methyltransferase Length = 352 Back     alignment and structure
>pdb|1FPX|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Isoflavone O-Methyltransferase Length = 352 Back     alignment and structure
>pdb|1ZGJ|A Chain A, Crystal Structure Of Isoflavanone 4'-O-Methyltransferase Complexed With (+)-Pisatin Length = 354 Back     alignment and structure
>pdb|1ZGA|A Chain A, Crystal Structure Of Isoflavanone 4'-o-methyltransferase Complexed With (+)-6a-hydroxymaackiain Length = 357 Back     alignment and structure
>pdb|1ZG3|A Chain A, Crystal Structure Of The Isoflavanone 4'-O-Methyltransferase Complexed With Sah And 2,7,4'-Trihydroxyisoflavanone Length = 358 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
1fp2_A 352 Isoflavone O-methyltransferase; protein-product co 6e-42
1zg3_A 358 Isoflavanone 4'-O-methyltransferase; rossman fold, 7e-41
1fp1_D 372 Isoliquiritigenin 2'-O-methyltransferase; protein- 4e-37
3lst_A 348 CALO1 methyltransferase; calicheamicin, enediyne, 8e-35
3reo_A 368 (ISO)eugenol O-methyltransferase; directed evoluti 4e-34
3p9c_A 364 Caffeic acid O-methyltransferase; S-adenosylmethio 2e-33
1qzz_A 374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 4e-33
3gwz_A 369 MMCR; methyltransferase, mitomycin, S-adenosyl met 2e-31
3i53_A 332 O-methyltransferase; CO-complex, rossmann-like fol 6e-31
2ip2_A 334 Probable phenazine-specific methyltransferase; pyo 2e-30
1tw3_A 360 COMT, carminomycin 4-O-methyltransferase; anthracy 9e-30
1x19_A 359 CRTF-related protein; methyltransferase, bacterioc 1e-27
2r3s_A 335 Uncharacterized protein; methyltransferase domain, 1e-26
3dp7_A 363 SAM-dependent methyltransferase; structural genomi 1e-24
3mcz_A 352 O-methyltransferase; adomet_mtases, S-adenosylmeth 2e-21
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Length = 352 Back     alignment and structure
 Score =  144 bits (364), Expect = 6e-42
 Identities = 74/227 (32%), Positives = 115/227 (50%), Gaps = 26/227 (11%)

Query: 1   MDVIHGENGAREHFQAQAQVWSYTYNYMKSLSLKRAIQLRIPDIINNSGQPMTLTQIIVA 60
           M          E F+AQA ++ + Y ++ S+SLK A+++ IP+II N G+P++L+ ++  
Sbjct: 1   MASSINGRKPSEIFKAQALLYKHIYAFIDSMSLKWAVEMNIPNIIQNHGKPISLSNLVSI 60

Query: 61  LNVHPNKTRCTQILVCLLAHSGFF--VQQKDGKNEQEEESILLPPHLDFFSRISLQLQGS 118
           L V  +K    + L+  LAH+GFF  + +++        S LL    D      L    +
Sbjct: 61  LQVPSSKIGNVRRLMRYLAHNGFFEIITKEEESYALTVASELLVRGSDL----CL----A 112

Query: 119 TILLLIADATFTTSFHFLSTWLQNDDQTLFGTADG---------------IFYEAMITDF 163
            ++  + D T + S+H L  W+  +D TLFG   G                F +AM +D 
Sbjct: 113 PMVECVLDPTLSGSYHELKKWIYEEDLTLFGVTLGSGFWDFLDKNPEYNTSFNDAMASDS 172

Query: 164 ELIASVLIEDCNEVSKGLKPLVDVGGSTGTMARAIATAFPDTKCTVF 210
           +LI   L + C+ V  GL+ +VDVGG TGT A+ I   FP  KC VF
Sbjct: 173 KLINLALRD-CDFVFDGLESIVDVGGGTGTTAKIICETFPKLKCIVF 218


>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Length = 358 Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Length = 372 Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Length = 348 Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 1kyz_A* 1kyw_A* Length = 368 Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Length = 364 Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Length = 374 Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Length = 369 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Length = 332 Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Length = 334 Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Length = 360 Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Length = 359 Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Length = 335 Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Length = 363 Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Length = 352 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
4a6d_A 353 Hydroxyindole O-methyltransferase; melatonin, circ 99.97
3p9c_A 364 Caffeic acid O-methyltransferase; S-adenosylmethio 99.97
3lst_A 348 CALO1 methyltransferase; calicheamicin, enediyne, 99.97
3reo_A 368 (ISO)eugenol O-methyltransferase; directed evoluti 99.96
1fp2_A 352 Isoflavone O-methyltransferase; protein-product co 99.96
1zg3_A 358 Isoflavanone 4'-O-methyltransferase; rossman fold, 99.96
3gwz_A 369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.96
2ip2_A 334 Probable phenazine-specific methyltransferase; pyo 99.96
3i53_A 332 O-methyltransferase; CO-complex, rossmann-like fol 99.95
1fp1_D 372 Isoliquiritigenin 2'-O-methyltransferase; protein- 99.95
3dp7_A 363 SAM-dependent methyltransferase; structural genomi 99.95
3mcz_A 352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.94
1x19_A 359 CRTF-related protein; methyltransferase, bacterioc 99.94
1qzz_A 374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.93
2r3s_A 335 Uncharacterized protein; methyltransferase domain, 99.93
1tw3_A 360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.93
2qm3_A 373 Predicted methyltransferase; putative methyltransf 98.62
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 97.59
3mq2_A 218 16S rRNA methyltransferase; methyltranferase, ribo 97.49
3e05_A 204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 97.44
2fca_A 213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 97.43
3g07_A 292 7SK snRNA methylphosphate capping enzyme; structur 97.4
4dzr_A 215 Protein-(glutamine-N5) methyltransferase, release 97.37
1y0u_A96 Arsenical resistance operon repressor, putative; s 97.37
3dxy_A 218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 97.37
1yzh_A 214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 97.37
3dtn_A 234 Putative methyltransferase MM_2633; structural gen 97.32
3jwh_A 217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 97.3
3mq0_A275 Transcriptional repressor of the blcabc operon; he 97.3
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 97.26
3jwg_A 219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 97.26
3ckk_A 235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 97.25
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 97.24
2vdv_E 246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 97.21
3hem_A 302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 97.17
3g89_A 249 Ribosomal RNA small subunit methyltransferase G; 1 97.13
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 97.12
1jsx_A 207 Glucose-inhibited division protein B; methyltransf 97.11
3dh0_A 219 SAM dependent methyltransferase; cystal structure, 97.1
4gek_A 261 TRNA (CMO5U34)-methyltransferase; structural genom 97.09
3bus_A 273 REBM, methyltransferase; rebeccamycin synthesis; H 97.08
1fbn_A 230 MJ fibrillarin homologue; MJ proteins, ribosomal R 97.04
3r4k_A260 Transcriptional regulator, ICLR family; DNA/RNA-bi 97.03
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 97.02
4dcm_A 375 Ribosomal RNA large subunit methyltransferase G; 2 97.02
3dlc_A 219 Putative S-adenosyl-L-methionine-dependent methylt 97.02
1nkv_A 256 Hypothetical protein YJHP; structural genomics, PS 97.02
2b3t_A 276 Protein methyltransferase HEMK; translation termin 97.0
3ujc_A 266 Phosphoethanolamine N-methyltransferase; parasite; 96.99
3mb5_A 255 SAM-dependent methyltransferase; RNA methyltransfe 96.99
3dli_A 240 Methyltransferase; PSI-II, NYSGXRC, structural gen 96.98
1xdz_A 240 Methyltransferase GIDB; MCSG, protein structure in 96.97
3f4k_A 257 Putative methyltransferase; structural genomics, P 96.94
3ou2_A 218 SAM-dependent methyltransferase; O-methyltransfera 96.93
1nt2_A 210 Fibrillarin-like PRE-rRNA processing protein; adeM 96.93
3ege_A 261 Putative methyltransferase from antibiotic biosyn 96.92
1nv8_A 284 HEMK protein; class I adoMet-dependent methyltrans 96.92
1kpg_A 287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 96.91
2xrn_A241 HTH-type transcriptional regulator TTGV; DNA-bindi 96.91
3tfw_A 248 Putative O-methyltransferase; PSI-biology, nysgrc, 96.9
2yxd_A 183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 96.89
2o57_A 297 Putative sarcosine dimethylglycine methyltransfera 96.88
1u2z_A 433 Histone-lysine N-methyltransferase, H3 lysine-79 s 96.88
1vl5_A 260 Unknown conserved protein BH2331; putative methylt 96.87
1yb2_A 275 Hypothetical protein TA0852; structural genomics, 96.87
3b73_A111 PHIH1 repressor-like protein; winged-helix-turn-he 96.86
2pjd_A 343 Ribosomal RNA small subunit methyltransferase C; g 96.85
1jg1_A 235 PIMT;, protein-L-isoaspartate O-methyltransferase; 96.85
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltra 96.84
3ech_A142 MEXR, multidrug resistance operon repressor; winge 96.84
1ve3_A 227 Hypothetical protein PH0226; dimer, riken structur 96.81
3vc1_A 312 Geranyl diphosphate 2-C-methyltransferase; rossman 96.79
2fk8_A 318 Methoxy mycolic acid synthase 4; S-adenosylmethion 96.77
3fzg_A 200 16S rRNA methylase; methyltransferase, plasmid, tr 96.77
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 96.76
1mkm_A249 ICLR transcriptional regulator; structural genomic 96.76
2pwy_A 258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 96.75
3g5l_A 253 Putative S-adenosylmethionine dependent methyltran 96.75
2yxe_A 215 Protein-L-isoaspartate O-methyltransferase; rossma 96.74
2ozv_A 260 Hypothetical protein ATU0636; structural genomics, 96.74
2ipx_A 233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 96.73
1qbj_A81 Protein (double-stranded RNA specific adenosine D 96.73
2h00_A 254 Methyltransferase 10 domain containing protein; st 96.73
2esr_A 177 Methyltransferase; structural genomics, hypothetic 96.71
2gpy_A 233 O-methyltransferase; structural genomics, PSI, pro 96.71
3ntv_A 232 MW1564 protein; rossmann fold, putative methyltran 96.7
3iv6_A 261 Putative Zn-dependent alcohol dehydrogenase; alpha 96.69
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 96.69
1o54_A 277 SAM-dependent O-methyltransferase; TM0748, structu 96.67
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 96.64
2g7u_A257 Transcriptional regulator; ICLR family, structural 96.64
3njr_A 204 Precorrin-6Y methylase; methyltransferase, decarbo 96.64
3duw_A 223 OMT, O-methyltransferase, putative; alternating of 96.64
1ws6_A171 Methyltransferase; structural genomics, riken stru 96.63
2qe6_A 274 Uncharacterized protein TFU_2867; putative methylt 96.63
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 96.62
2o0y_A260 Transcriptional regulator; ICLR-family, structural 96.62
3tr6_A 225 O-methyltransferase; cellular processes; HET: SAH; 96.62
3pqk_A102 Biofilm growth-associated repressor; helix-turn-he 96.62
3ggd_A 245 SAM-dependent methyltransferase; YP_325210.1, stru 96.62
2bm8_A 236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 96.61
1o9g_A 250 RRNA methyltransferase; antibiotic resistance, Se- 96.59
3gjy_A 317 Spermidine synthase; APC62791, structural genomics 96.58
1xmk_A79 Double-stranded RNA-specific adenosine deaminase; 96.58
3orh_A 236 Guanidinoacetate N-methyltransferase; structura ge 96.58
2xvm_A 199 Tellurite resistance protein TEHB; antibiotic resi 96.56
3opn_A 232 Putative hemolysin; structural genomics, PSI-2, pr 96.56
3grz_A 205 L11 mtase, ribosomal protein L11 methyltransferase 96.56
2jt1_A77 PEFI protein; solution structure, winged helix-tur 96.56
3hnr_A 220 Probable methyltransferase BT9727_4108; structural 96.55
3c3p_A 210 Methyltransferase; NP_951602.1, structural genomic 96.55
1dus_A 194 MJ0882; hypothetical protein, methanococcus jannas 96.54
1u2w_A122 CADC repressor, cadmium efflux system accessory pr 96.54
2nxc_A 254 L11 mtase, ribosomal protein L11 methyltransferase 96.53
2oqg_A114 Possible transcriptional regulator, ARSR family P; 96.53
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 96.52
3cc8_A 230 Putative methyltransferase; structural genomics, j 96.52
1qam_A 244 ERMC' methyltransferase; rRNA methyltransferase ER 96.52
2fhp_A 187 Methylase, putative; alpha-beta-alpha sandwich, st 96.5
2pxx_A 215 Uncharacterized protein MGC2408; structural genomi 96.5
3jth_A98 Transcription activator HLYU; transcription factor 96.48
1xtp_A 254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 96.48
3pfg_A 263 N-methyltransferase; N,N-dimethyltransferase, SAM 96.46
3bja_A139 Transcriptional regulator, MARR family, putative; 96.44
1i9g_A 280 Hypothetical protein RV2118C; mtase, adoMet, cryst 96.44
2ia2_A265 Putative transcriptional regulator; SAD, PSI-2, st 96.44
2p7i_A 250 Hypothetical protein; putative methyltransferase, 96.43
3adn_A 294 Spermidine synthase; aminopropyltransferase, polya 96.41
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 96.41
1p91_A 269 Ribosomal RNA large subunit methyltransferase A; R 96.41
3ftd_A 249 Dimethyladenosine transferase; KSGA, rossmann-like 96.41
2qww_A154 Transcriptional regulator, MARR family; YP_013417. 96.41
1g8a_A 227 Fibrillarin-like PRE-rRNA processing protein; rRNA 96.4
3lbf_A 210 Protein-L-isoaspartate O-methyltransferase; modifi 96.4
1sui_A 247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 96.39
3r3h_A 242 O-methyltransferase, SAM-dependent; structural gen 96.38
3e8s_A 227 Putative SAM dependent methyltransferase; NP_74470 96.37
3thr_A 293 Glycine N-methyltransferase; GNMT, folate, methylt 96.37
3tma_A 354 Methyltransferase; thump domain; 2.05A {Thermus th 96.36
1wzn_A 252 SAM-dependent methyltransferase; structural genomi 96.34
3bxo_A 239 N,N-dimethyltransferase; desosamine, sugar, carboh 96.34
3uzu_A 279 Ribosomal RNA small subunit methyltransferase A; s 96.33
2hnk_A 239 SAM-dependent O-methyltransferase; modified rossma 96.31
2pbf_A 227 Protein-L-isoaspartate O-methyltransferase beta-A 96.31
1i1n_A 226 Protein-L-isoaspartate O-methyltransferase; S-aden 96.29
3dr5_A 221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 96.29
3u81_A 221 Catechol O-methyltransferase; neurotransmitter deg 96.29
1l3i_A 192 Precorrin-6Y methyltransferase/putative decarboxyl 96.28
2avd_A 229 Catechol-O-methyltransferase; structural genomics, 96.28
3ocj_A 305 Putative exported protein; structural genomics, PS 96.26
2yqz_A 263 Hypothetical protein TTHA0223; RNA methyltransfera 96.26
2hzt_A107 Putative HTH-type transcriptional regulator YTCD; 96.25
1vbf_A 231 231AA long hypothetical protein-L-isoaspartate O- 96.25
3lpm_A 259 Putative methyltransferase; structural genomics, p 96.24
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 96.24
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 96.23
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 96.23
3fpf_A 298 Mtnas, putative uncharacterized protein; thermonic 96.21
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 96.2
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 96.2
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 96.2
4a5n_A131 Uncharacterized HTH-type transcriptional regulato; 96.19
3bwc_A 304 Spermidine synthase; SAM, SGPP, structura genomics 96.18
3k0l_A162 Repressor protein; helix-turn-helix, structural ge 96.17
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 96.17
3sm3_A 235 SAM-dependent methyltransferases; NESG, structural 96.16
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 96.15
2b25_A 336 Hypothetical protein; structural genomics, methyl 96.15
3e23_A 211 Uncharacterized protein RPA2492; alpha-beta protei 96.15
2y75_A129 HTH-type transcriptional regulator CYMR; DNA bindi 96.14
2kko_A108 Possible transcriptional regulatory protein (possi 96.13
3c3y_A 237 Pfomt, O-methyltransferase; plant secondary metabo 96.12
2gxg_A146 146AA long hypothetical transcriptional regulator; 96.11
3m70_A 286 Tellurite resistance protein TEHB homolog; structu 96.11
2fbh_A146 Transcriptional regulator PA3341; MARR, transcript 96.11
1iy9_A 275 Spermidine synthase; rossmann fold, structural gen 96.11
3a27_A 272 TYW2, uncharacterized protein MJ1557; wybutosine m 96.1
1xj5_A 334 Spermidine synthase 1; structural genomics, protei 96.08
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 96.07
3cbg_A 232 O-methyltransferase; cyanobacterium; HET: SAH FER 96.06
3l8d_A 242 Methyltransferase; structural genomics, PSI, nysgr 96.06
1zq9_A 285 Probable dimethyladenosine transferase; SGC, struc 96.05
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix moti 96.05
1s3j_A155 YUSO protein; structural genomics, MARR transcript 96.04
3bkw_A 243 MLL3908 protein, S-adenosylmethionine dependent me 96.01
3gru_A 295 Dimethyladenosine transferase; rossman fold, ribos 96.0
1ne2_A 200 Hypothetical protein TA1320; structural genomics, 96.0
3p9n_A 189 Possible methyltransferase (methylase); RV2966C, a 96.0
1inl_A 296 Spermidine synthase; beta-barrel, rossman fold, st 95.99
3h2b_A 203 SAM-dependent methyltransferase; alpha-beta protei 95.98
3f6o_A118 Probable transcriptional regulator, ARSR family pr 95.98
4htf_A 285 S-adenosylmethionine-dependent methyltransferase; 95.96
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 95.96
2pt6_A 321 Spermidine synthase; transferase, structural genom 95.96
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 95.95
3fut_A 271 Dimethyladenosine transferase; methyltransferase, 95.94
1yub_A 245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 95.94
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 95.93
1uir_A 314 Polyamine aminopropyltransferase; spermidien synth 95.93
3m33_A 226 Uncharacterized protein; structural genomics, PSI- 95.92
2o07_A 304 Spermidine synthase; structural genomics, structur 95.91
3oop_A143 LIN2960 protein; protein structure initiative, PSI 95.91
2yvl_A 248 TRMI protein, hypothetical protein; tRNA, methyltr 95.91
2i7c_A 283 Spermidine synthase; transferase, structural genom 95.91
2jsc_A118 Transcriptional regulator RV1994C/MT2050; cadmium, 95.91
3hp7_A 291 Hemolysin, putative; structural genomics, APC64019 95.9
4hg2_A 257 Methyltransferase type 11; structural genomics, PS 95.89
1mjf_A 281 Spermidine synthase; spermidine synthetase, struct 95.88
3evz_A 230 Methyltransferase; NYSGXRC, NEW YORK SGX research 95.87
1y8c_A 246 S-adenosylmethionine-dependent methyltransferase; 95.86
1jgs_A138 Multiple antibiotic resistance protein MARR; trans 95.85
1zx0_A 236 Guanidinoacetate N-methyltransferase; structural g 95.83
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 95.83
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, 95.82
1wy7_A 207 Hypothetical protein PH1948; seven-stranded beta s 95.81
3g2m_A 299 PCZA361.24; SAM-dependent methyltransferase, glyco 95.81
2b2c_A 314 Spermidine synthase; beta-alpha, transferase; 2.50 95.8
3tqs_A 255 Ribosomal RNA small subunit methyltransferase A; p 95.79
2ex4_A 241 Adrenal gland protein AD-003; methyltransferase, s 95.78
2fu4_A83 Ferric uptake regulation protein; DNA binding doma 95.78
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; 95.76
2nnn_A140 Probable transcriptional regulator; structural gen 95.74
3kp7_A151 Transcriptional regulator TCAR; multiple drug resi 95.74
2nyx_A168 Probable transcriptional regulatory protein, RV14; 95.72
3cgg_A 195 SAM-dependent methyltransferase; NP_600671.1, meth 95.71
3r0a_A123 Putative transcriptional regulator; structural gen 95.69
3lcc_A 235 Putative methyl chloride transferase; halide methy 95.69
3g3z_A145 NMB1585, transcriptional regulator, MARR family; t 95.68
2hr3_A147 Probable transcriptional regulator; MCSG, structur 95.68
2gb4_A 252 Thiopurine S-methyltransferase; 18204406, thiopuri 95.68
2wte_A244 CSA3; antiviral protein, viral resistance, winged 95.68
3deu_A166 Transcriptional regulator SLYA; MARR, WING-helix, 95.67
3bro_A141 Transcriptional regulator; helix_TURN_helix, multi 95.67
2frn_A 278 Hypothetical protein PH0793; structural genomics, 95.66
3e6m_A161 MARR family transcriptional regulator; APC88769, s 95.65
2ift_A 201 Putative methylase HI0767; NESG, Y767_haein, struc 95.65
1ixk_A 315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 95.64
3fm5_A150 Transcriptional regulator; MCSG, PF04017, PSI, MAR 95.62
3bzb_A 281 Uncharacterized protein; RED ALGA, protein structu 95.62
2eth_A154 Transcriptional regulator, putative, MAR family; M 95.61
3gdh_A 241 Trimethylguanosine synthase homolog; M7G, CAP, dim 95.6
2aot_A 292 HMT, histamine N-methyltransferase; classic methyl 95.6
3bj6_A152 Transcriptional regulator, MARR family; helix-turn 95.59
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 95.59
3f6v_A151 Possible transcriptional regulator, ARSR family pr 95.57
1r18_A 227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 95.56
3d2l_A 243 SAM-dependent methyltransferase; ZP_00538691.1, st 95.56
3cdh_A155 Transcriptional regulator, MARR family; helix-turn 95.55
2rdp_A150 Putative transcriptional regulator MARR; PFAM PF01 95.55
3ajd_A 274 Putative methyltransferase MJ0026; tRNA, M5C, ross 95.54
3eco_A139 MEPR; mutlidrug efflux pump regulator winged helix 95.54
2zfu_A 215 Nucleomethylin, cerebral protein 1; nucleolar prot 95.54
3tm4_A 373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 95.52
3ofk_A 216 Nodulation protein S; NODS, N-methyltransferase, S 95.52
3bpv_A138 Transcriptional regulator; MARR, DNA binding, tran 95.52
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptio 95.51
1lj9_A144 Transcriptional regulator SLYA; HTH DNA binding pr 95.51
3boq_A160 Transcriptional regulator, MARR family; MARR famil 95.49
2fpo_A 202 Methylase YHHF; structural genomics, putative meth 95.48
3id6_C 232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 95.48
2fa5_A162 Transcriptional regulator MARR/EMRR family; multip 95.45
3s2w_A159 Transcriptional regulator, MARR family; structural 95.44
1ri5_A 298 MRNA capping enzyme; methyltransferase, M7G, messe 95.44
1r7j_A95 Conserved hypothetical protein SSO10A; winged heli 95.44
3bdd_A142 Regulatory protein MARR; putative multiple antibio 95.41
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 95.38
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 95.37
3tgn_A146 ADC operon repressor ADCR; helix-turn-helix, trans 95.36
3cjn_A162 Transcriptional regulator, MARR family; silicibact 95.35
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 95.34
2avn_A 260 Ubiquinone/menaquinone biosynthesis methyltransfe 95.34
1yyv_A131 Putative transcriptional regulator; reductive meth 95.33
2kw5_A 202 SLR1183 protein; structural genomics, northeast st 95.31
2g72_A 289 Phenylethanolamine N-methyltransferase; HET: SAM F 95.3
4df3_A 233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 95.29
1sfx_A109 Conserved hypothetical protein AF2008; structural 95.28
2oxt_A 265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 95.26
2wa2_A 276 Non-structural protein 5; transferase, S-adenosyl- 95.25
3k69_A162 Putative transcription regulator; putative transcr 95.23
2bv6_A142 MGRA, HTH-type transcriptional regulator MGRA; mul 95.21
4aik_A151 Transcriptional regulator SLYA; transcription, tra 95.19
3lwf_A159 LIN1550 protein, putative transcriptional regulato 95.18
3jw4_A148 Transcriptional regulator, MARR/EMRR family; DNA-b 95.18
2cmg_A 262 Spermidine synthase; transferase, putrescine amino 95.17
3lcv_B 281 Sisomicin-gentamicin resistance methylase SGM; ant 95.14
1z7u_A112 Hypothetical protein EF0647; winged-helix-turn-hel 95.14
3hsr_A140 HTH-type transcriptional regulator SARZ; helix-tur 95.13
2lnb_A80 Z-DNA-binding protein 1; structural genomics, nort 95.11
1ylf_A149 RRF2 family protein; structural genomics, transcri 95.09
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 95.08
3frh_A 253 16S rRNA methylase; methyltransferase domain, heli 95.07
2fsw_A107 PG_0823 protein; alpha-beta structure, helix-turn- 95.05
2pg4_A95 Uncharacterized protein; structural genomics, join 95.03
2a61_A145 Transcriptional regulator TM0710; APC4350, MCSG, m 94.98
3dmg_A 381 Probable ribosomal RNA small subunit methyltransf; 94.97
3t8r_A143 Staphylococcus aureus CYMR; transcriptional regula 94.84
3df8_A111 Possible HXLR family transcriptional factor; APC89 94.82
1sqg_A 429 SUN protein, FMU protein; rossmann-fold, mixed bet 94.81
4hbl_A149 Transcriptional regulator, MARR family; HTH, trans 94.8
2yxl_A 450 PH0851 protein, 450AA long hypothetical FMU protei 94.74
1z91_A147 Organic hydroperoxide resistance transcriptional; 94.68
2p41_A 305 Type II methyltransferase; vizier, viral enzymes i 94.63
2f2e_A146 PA1607; transcription factor, helix-TRUN-helix, AP 94.6
2fbi_A142 Probable transcriptional regulator; MARR, APC5816, 94.57
2cfx_A144 HTH-type transcriptional regulator LRPC; transcrip 94.57
2w25_A150 Probable transcriptional regulatory protein; trans 94.56
2pex_A153 Transcriptional regulator OHRR; transcription regu 94.53
2pn6_A150 ST1022, 150AA long hypothetical transcriptional re 94.42
2lkp_A119 Transcriptional regulator, ARSR family; symmetric 94.4
2vdw_A 302 Vaccinia virus capping enzyme D1 subunit; nucleoti 94.38
1xd7_A145 YWNA; structural genomics, protein structure initi 94.35
2fbk_A181 Transcriptional regulator, MARR family; winged-hel 94.3
2p5v_A162 Transcriptional regulator, LRP/ASNC family; NMB057 94.28
2i62_A 265 Nicotinamide N-methyltransferase; structural genom 94.27
3nqo_A189 MARR-family transcriptional regulator; structural 94.24
3sso_A 419 Methyltransferase; macrolide, natural product, ros 94.18
1q1h_A110 TFE, transcription factor E, TFE; TFIIE, transcrip 94.13
3hrs_A214 Metalloregulator SCAR; DTXR/MNTR family member, tr 94.12
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A 94.11
2zkz_A99 Transcriptional repressor PAGR; protein-DNA, HTH m 94.11
2r6z_A 258 UPF0341 protein in RSP 3' region; alpha-beta prote 94.05
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 94.04
1uwv_A 433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 94.04
2qvo_A95 Uncharacterized protein AF_1382; PSI, structural g 94.03
3f3x_A144 Transcriptional regulator, MARR family, putative; 93.99
2dbb_A151 Putative HTH-type transcriptional regulator PH006; 93.97
3u2r_A168 Regulatory protein MARR; structural genomics, PSI- 93.93
2gs9_A 211 Hypothetical protein TT1324; methyl transferase, s 93.91
2h09_A155 Transcriptional regulator MNTR; transcription regu 93.88
3q87_B 170 N6 adenine specific DNA methylase; SAM-methyltrans 93.81
1tbx_A99 ORF F-93, hypothetical 11.0 kDa protein; sulfolobu 93.81
2cg4_A152 Regulatory protein ASNC; DNA binding, FFRP, LRP fa 93.8
1p6r_A82 Penicillinase repressor; transcription regulation, 93.79
3i4p_A162 Transcriptional regulator, ASNC family; PSI, struc 93.77
2cyy_A151 Putative HTH-type transcriptional regulator PH151; 93.74
2dk5_A91 DNA-directed RNA polymerase III 39 kDa polypeptide 93.7
2ia0_A171 Putative HTH-type transcriptional regulator PF086; 93.69
3ldu_A 385 Putative methylase; structural genomics, PSI-2, pr 93.61
1sfu_A75 34L protein; protein/Z-DNA complex, DNA binding pr 93.59
2igt_A 332 SAM dependent methyltransferase; alpha-beta sandwi 93.59
2vn2_A128 DNAD, chromosome replication initiation protein; D 93.54
3k0b_A 393 Predicted N6-adenine-specific DNA methylase; methy 93.52
2qfm_A 364 Spermine synthase; spermidine aminopropyltransfera 93.46
4g6q_A182 Putative uncharacterized protein; structural genom 93.44
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 93.42
2frh_A127 SARA, staphylococcal accessory regulator A; winged 93.39
2fe3_A145 Peroxide operon regulator; oxidative stress regula 93.38
3giw_A 277 Protein of unknown function DUF574; rossmann-fold 93.38
1i1g_A141 Transcriptional regulator LRPA; helix-turn-helix, 93.36
2f8l_A 344 Hypothetical protein LMO1582; structural genomics, 93.33
2e1c_A171 Putative HTH-type transcriptional regulator PH151; 93.32
1ku9_A152 Hypothetical protein MJ223; putative transcription 93.22
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 93.19
1bja_A95 Transcription regulatory protein MOTA; activation 93.18
2k4b_A99 Transcriptional regulator; DNA binding protein, wi 93.16
2o03_A131 Probable zinc uptake regulation protein FURB; DNA- 93.04
1af7_A 274 Chemotaxis receptor methyltransferase CHER; chemot 93.04
3k2z_A196 LEXA repressor; winged helix-turn-helix, SOS syste 92.96
2xvc_A59 ESCRT-III, SSO0910; cell cycle, cell division, cyt 92.95
1j5y_A187 Transcriptional regulator, biotin repressor famil; 92.88
1uly_A192 Hypothetical protein PH1932; helix-turn-helix, str 92.88
1vlm_A 219 SAM-dependent methyltransferase; possible histamin 92.82
3ldg_A 384 Putative uncharacterized protein SMU.472; YPSC, me 92.8
2a14_A 263 Indolethylamine N-methyltransferase; SGC,INMT, str 92.67
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 92.64
2oyr_A 258 UPF0341 protein YHIQ; alpha-beta protein, structur 92.48
3gcz_A 282 Polyprotein; flavivirus, RNA capping, methyltransf 92.44
2fxa_A207 Protease production regulatory protein HPR; protea 92.24
2qlz_A232 Transcription factor PF0095; 2.50A {Pyrococcus fur 92.14
2as0_A 396 Hypothetical protein PH1915; RNA methyltransferase 92.05
3mwm_A139 ZUR, putative metal uptake regulation protein; FUR 92.03
2okc_A 445 Type I restriction enzyme stysji M protein; NP_813 91.97
3k6r_A 278 Putative transferase PH0793; structural genomics, 91.82
1v4r_A102 Transcriptional repressor; helix-turn-helix, winge 91.74
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 91.7
2p4w_A202 Transcriptional regulatory protein ARSR family; ar 91.66
4dmg_A 393 Putative uncharacterized protein TTHA1493; rRNA, m 91.54
4b8x_A147 SCO5413, possible MARR-transcriptional regulator; 91.47
1cf7_A76 Protein (transcription factor E2F-4); E2F, winged- 91.46
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 91.45
2hoe_A 380 N-acetylglucosamine kinase; TM1224, structural gen 91.43
1mzb_A136 Ferric uptake regulation protein; ferric uptake re 91.41
2xig_A150 Ferric uptake regulation protein; hpfur, transcrip 91.38
2jjq_A 425 Uncharacterized RNA methyltransferase pyrab10780; 91.31
2v79_A135 DNA replication protein DNAD; primosome, DNA-bindi 91.21
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 91.06
3evf_A 277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 91.03
2yx1_A 336 Hypothetical protein MJ0883; methyl transferase, t 91.0
3c0k_A 396 UPF0064 protein YCCW; PUA domain, adoMet dependent 91.0
4fx0_A148 Probable transcriptional repressor protein; helix- 90.76
1bia_A 321 BIRA bifunctional protein; transcription regulatio 90.69
2b78_A 385 Hypothetical protein SMU.776; structure genomics, 90.59
1okr_A123 MECI, methicillin resistance regulatory protein ME 90.54
1wxx_A 382 TT1595, hypothetical protein TTHA1280; thermus the 90.35
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 90.33
2obp_A96 Putative DNA-binding protein; structural genomics, 90.32
3ll7_A 410 Putative methyltransferase; methytransferase, stru 90.29
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 90.28
2g9w_A138 Conserved hypothetical protein; DNA-binding domain 90.18
2b9e_A 309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 90.1
3i71_A68 Ethanolamine utilization protein EUTK; helix-turn- 90.09
1z6r_A 406 MLC protein; transcriptional repressor, ROK family 90.02
1sd4_A126 Penicillinase repressor; BLAI, MECI, methicillin, 89.62
3o4f_A 294 Spermidine synthase; aminopropyltransferase, polya 89.51
2pjp_A121 Selenocysteine-specific elongation factor; SELB, p 89.37
2w57_A150 Ferric uptake regulation protein; gene regulation, 89.16
1p4x_A250 Staphylococcal accessory regulator A homologue; wi 89.05
3bt7_A 369 TRNA (uracil-5-)-methyltransferase; methyluridine, 88.77
1z05_A 429 Transcriptional regulator, ROK family; structural 88.7
2xyq_A 290 Putative 2'-O-methyl transferase; transferase-vira 88.6
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 88.32
3maj_A382 DNA processing chain A; MCSG, PSI-2, structural ge 88.04
1jhg_A101 Trp operon repressor; complex (regulatory protein- 87.78
2zig_A297 TTHA0409, putative modification methylase; methylt 87.43
2o0m_A 345 Transcriptional regulator, SORC family; structural 87.27
3eld_A 300 Methyltransferase; flavivirus, RNA capping, guanyl 87.15
2b0l_A102 GTP-sensing transcriptional pleiotropic repressor; 87.1
3u1d_A151 Uncharacterized protein; GNTR-superfamily, structu 86.97
3rkx_A 323 Biotin-[acetyl-COA-carboxylase] ligase; biotin pro 86.74
1m6e_X 359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 85.95
3p8z_A 267 Mtase, non-structural protein 5; methyltransferase 85.78
2qlz_A232 Transcription factor PF0095; 2.50A {Pyrococcus fur 85.39
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 85.31
2yu3_A95 DNA-directed RNA polymerase III 39 kDa polypeptide 85.25
3cta_A230 Riboflavin kinase; structural genomics, transferas 85.23
3eyi_A72 Z-DNA-binding protein 1; alternative splicing, DNA 85.05
2py6_A 409 Methyltransferase FKBM; YP_546752.1, structural ge 84.65
2qq9_A226 Diphtheria toxin repressor; regulator, DTXR, helix 84.48
3tqn_A113 Transcriptional regulator, GNTR family; regulatory 84.42
1fx7_A230 Iron-dependent repressor IDER; DTXR, iron-dependen 84.38
3lkz_A 321 Non-structural protein 5; flavivirus, methyltransf 83.9
2p5k_A64 Arginine repressor; DNA-binding domain, winged hel 83.88
2w48_A 315 Sorbitol operon regulator; SORC, activator, repres 83.63
2ek5_A129 Predicted transcriptional regulators; helix-turn-h 83.53
1i4w_A 353 Mitochondrial replication protein MTF1; mitochondr 83.45
3eyy_A145 Putative iron uptake regulatory protein; NUR, nick 83.41
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 83.03
1hsj_A487 Fusion protein consisting of staphylococcus access 82.5
4ets_A162 Ferric uptake regulation protein; metal binding pr 81.96
1p4x_A250 Staphylococcal accessory regulator A homologue; wi 81.87
3by6_A126 Predicted transcriptional regulator; structural ge 81.82
3neu_A125 LIN1836 protein; structural genomics, PSI-2, prote 81.72
2p8t_A200 Hypothetical protein PH0730; pyrococcus horikoshii 81.72
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 81.05
3elk_A117 Putative transcriptional regulator TA0346; structu 80.78
4esf_A117 PADR-like transcriptional regulator; PADR family, 80.59
4auk_A 375 Ribosomal RNA large subunit methyltransferase M; Y 80.49
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 80.26
3tka_A 347 Ribosomal RNA small subunit methyltransferase H; H 80.21
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 80.1
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
Probab=99.97  E-value=6.9e-32  Score=235.64  Aligned_cols=186  Identities=16%  Similarity=0.219  Sum_probs=160.0

Q ss_pred             hhHHHHHHHHHHHHhHHHHHHHHHhcCcchhhhcCCCCCCHHHHHHHcCCCCCCcccHHHHHHHHHhCCceeeecCCCCC
Q 040620           14 FQAQAQVWSYTYNYMKSLSLKRAIQLRIPDIINNSGQPMTLTQIIVALNVHPNKTRCTQILVCLLAHSGFFVQQKDGKNE   93 (214)
Q Consensus        14 ~~~~~~l~~~~~g~~~~~~L~~a~~lglfd~L~~~~~p~t~~eLA~~~g~~~~~~~~l~rlLr~L~~~g~l~~~~~~~~~   93 (214)
                      .++...|++++.||+.+++|++|++|||||+|++.++|+|++|||+++|+++   +.++||||+|++.|+|.+...   +
T Consensus         6 ~~~~~~L~~l~~Gf~~s~~L~aa~eLglfd~L~~~~~p~t~~eLA~~~g~~~---~~l~rlLr~L~~~gll~~~~~---~   79 (353)
T 4a6d_A            6 DQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASA---HGTELLLDICVSLKLLKVETR---G   79 (353)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHSSSCBCHHHHHHHHTCCH---HHHHHHHHHHHHTTSEEEEEE---T
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHcCHHHHHhcCCCCCCHHHHHHhhCcCH---HHHHHHHHHHHHCCCEEEecc---C
Confidence            3788889999999999999999999999999997668999999999999999   999999999999999986542   1


Q ss_pred             CccceeeCCCCCcccccccc----ccchHHHHHHhhccchhhhhHhHHHhhcCCCCChhhHHHH----------------
Q 040620           94 QEEESILLPPHLDFFSRISL----QLQGSTILLLIADATFTTSFHFLSTWLQNDDQTLFGTADG----------------  153 (214)
Q Consensus        94 ~~~~~y~~t~~~~~~s~~l~----~~~~~~~~~~~~~~~~~~~~~~l~~~lr~~~~~~f~~~~g----------------  153 (214)
                      + .++|++|+.    ++.++    +.++..++.++. ...+..|.+|.+.+++++ .+|...+|                
T Consensus        80 ~-~~~y~~t~~----s~~~l~~~~~~~~~~~~~~~~-~~~~~~~~~L~~~vr~g~-~~~~~~~g~~~~~~~~~~~~~~~~  152 (353)
T 4a6d_A           80 G-KAFYRNTEL----SSDYLTTVSPTSQCSMLKYMG-RTSYRCWGHLADAVREGR-NQYLETFGVPAEELFTAIYRSEGE  152 (353)
T ss_dssp             T-EEEEEECHH----HHHHHSTTSTTCCHHHHHHHH-HTHHHHHTTHHHHHHHTS-CCHHHHHSCCCSSHHHHHTSSHHH
T ss_pred             c-cceeeCCHH----HHHHhhcCCchHHHHHHHHhC-HHHHHHHHHHHHHHhcCC-ChhHHhcCCChHHHHHHHhhCHHH
Confidence            1 468999999    87654    467788776654 357889999999999886 33433322                


Q ss_pred             --HHHHHhhhhhhhhHHHHHhhcccccCCCCcEEeecCCchHHHHHHHHHCCCCeEEEecCCC
Q 040620          154 --IFYEAMITDFELIASVLIEDCNEVSKGLKPLVDVGGSTGTMARAIATAFPDTKCTVFACHL  214 (214)
Q Consensus       154 --~f~~am~~~~~~~~~~~l~~~~~~~~~~~~vvDVGGG~G~~~~~l~~~~P~l~~~v~Dlp~  214 (214)
                        .|+++|...+....+.+++.++  +++.++|||||||+|.++++++++||+++++++|+|+
T Consensus       153 ~~~f~~aM~~~~~~~~~~~~~~~~--~~~~~~v~DvGgG~G~~~~~l~~~~p~~~~~~~dlp~  213 (353)
T 4a6d_A          153 RLQFMQALQEVWSVNGRSVLTAFD--LSVFPLMCDLGGGAGALAKECMSLYPGCKITVFDIPE  213 (353)
T ss_dssp             HHHHHHHHHTTHHHHHHHHHHSSC--GGGCSEEEEETCTTSHHHHHHHHHCSSCEEEEEECHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcC--cccCCeEEeeCCCCCHHHHHHHHhCCCceeEeccCHH
Confidence              7999999988888888999998  7888999999999999999999999999999999983



>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3mq0_A Transcriptional repressor of the blcabc operon; helix-turn-helix, GAF fold, transcription repressor; 1.79A {Agrobacterium tumefaciens} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3r4k_A Transcriptional regulator, ICLR family; DNA/RNA-binding 3-helical bundle, profilin-like, structural joint center for structural genomics, JCSG; 2.46A {Ruegeria SP} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>2xrn_A HTH-type transcriptional regulator TTGV; DNA-binding protein, tetramer gene regulator, cooperative DN binding, multidrug binding protein; 2.90A {Pseudomonas putida} PDB: 2xro_A Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>1mkm_A ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: a.4.5.33 d.110.2.2 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>2g7u_A Transcriptional regulator; ICLR family, structural genomics, PSI, protein structure initiative, midwest center for struc genomics; 2.30A {Rhodococcus SP} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2o0y_A Transcriptional regulator; ICLR-family, structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, MAR structural genomics; 2.38A {Bacillus cereus} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>2ia2_A Putative transcriptional regulator; SAD, PSI-2, structural genomics, structure initiative, midwest center for structural genomic transcription; 2.10A {Rhodococcus SP} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>2hzt_A Putative HTH-type transcriptional regulator YTCD; DNA-binding protein, HTH-type transcription regulators, structural genomics, PSI-2; HET: CSU MSE; 2.00A {Bacillus subtilis} SCOP: a.4.5.69 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>4a5n_A Uncharacterized HTH-type transcriptional regulato; activator, DNA binding, MARR-like; 1.81A {Bacillus subtilis} PDB: 4a5m_A Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2y75_A HTH-type transcriptional regulator CYMR; DNA binding protein; 2.00A {Bacillus subtilis} Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 Back     alignment and structure
>1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor, transcription; HET: SAL; 2.30A {Escherichia coli} SCOP: a.4.5.28 Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3kp7_A Transcriptional regulator TCAR; multiple drug resistance, biofilm, transcription regulation, binding, transcription regulator; 2.30A {Staphylococcus epidermidis RP62A} PDB: 3kp3_A* 3kp4_A* 3kp5_A* 3kp2_A* 3kp6_A Back     alignment and structure
>2nyx_A Probable transcriptional regulatory protein, RV14; alpha/beta, structural genomics, PSI-2; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>2wte_A CSA3; antiviral protein, viral resistance, winged helix-turn-helix prnai nucleotide-binding domain; HET: MSE; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 Back     alignment and structure
>3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>2eth_A Transcriptional regulator, putative, MAR family; MARR family, structural genomics, joint center for structura genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} SCOP: a.4.5.0 Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A Back     alignment and structure
>1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 Back     alignment and structure
>3boq_A Transcriptional regulator, MARR family; MARR famil structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} Back     alignment and structure
>3s2w_A Transcriptional regulator, MARR family; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 2.45A {Methanosarcina mazei} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>1r7j_A Conserved hypothetical protein SSO10A; winged helix-turn-helix, two-stranded antiparallel coiled CO structural genomics, PSI; 1.47A {Sulfolobus solfataricus} SCOP: a.4.5.49 PDB: 1xsx_A Back     alignment and structure
>3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>3cjn_A Transcriptional regulator, MARR family; silicibacter pomeroy structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1yyv_A Putative transcriptional regulator; reductive methylation, D lysine, structural genomics, PSI; HET: MLY; 2.35A {Salmonella typhimurium} SCOP: a.4.5.69 Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>3k69_A Putative transcription regulator; putative transcriptional regulator, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.95A {Lactobacillus plantarum} SCOP: a.4.5.0 Back     alignment and structure
>2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} SCOP: a.4.5.28 Back     alignment and structure
>4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* Back     alignment and structure
>3lwf_A LIN1550 protein, putative transcriptional regulator; structural genomics, JOI for structural genomics, JCSG; HET: SO4; 2.06A {Listeria innocua} Back     alignment and structure
>3jw4_A Transcriptional regulator, MARR/EMRR family; DNA-binding protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.10A {Clostridium acetobutylicum} SCOP: a.4.5.0 Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>1z7u_A Hypothetical protein EF0647; winged-helix-turn-helix, MARR, structural genomics, PSI, Pro structure initiative; 2.20A {Enterococcus faecalis} SCOP: a.4.5.69 Back     alignment and structure
>3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcript regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A 4gxo_A Back     alignment and structure
>2lnb_A Z-DNA-binding protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, immune system; NMR {Homo sapiens} Back     alignment and structure
>1ylf_A RRF2 family protein; structural genomics, transcription regulator, P protein structure initiative; 2.50A {Bacillus cereus atcc 14579} SCOP: a.4.5.55 Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>2fsw_A PG_0823 protein; alpha-beta structure, helix-turn-helix, winged-helix-turn-HE structural genomics, PSI, protein structure initiative; HET: MSE; 2.16A {Porphyromonas gingivalis} SCOP: a.4.5.69 Back     alignment and structure
>2pg4_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, DNA binding protein; HET: MSE CIT; 2.21A {Aeropyrum pernix} SCOP: a.4.5.48 Back     alignment and structure
>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3t8r_A Staphylococcus aureus CYMR; transcriptional regulator protein, dimer, sulfenic acid, UNK function; 1.70A {Staphylococcus aureus} PDB: 3t8t_A Back     alignment and structure
>3df8_A Possible HXLR family transcriptional factor; APC89000, structural genomics, midwest center for structural genomics, MCSG; 1.65A {Thermoplasma volcanium} SCOP: a.4.5.0 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1z91_A Organic hydroperoxide resistance transcriptional; OHRR, MARR family, bacterial transcription factor, DNA bindi protein; 2.50A {Bacillus subtilis} SCOP: a.4.5.28 PDB: 1z9c_A* Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>2f2e_A PA1607; transcription factor, helix-TRUN-helix, APC5613, structural genomics, PSI, protein structure initiative; HET: GLC; 1.85A {Pseudomonas aeruginosa} SCOP: a.4.5.69 Back     alignment and structure
>2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomic protein structure initiative; 2.10A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A Back     alignment and structure
>2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A Back     alignment and structure
>2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* Back     alignment and structure
>2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>1xd7_A YWNA; structural genomics, protein structure initiative, winged HE binding, hypothetical protein, PSI; 2.30A {Bacillus subtilis subsp} SCOP: a.4.5.55 Back     alignment and structure
>2fbk_A Transcriptional regulator, MARR family; winged-helix-turn-helix; 2.30A {Deinococcus radiodurans} SCOP: a.4.5.28 Back     alignment and structure
>2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3nqo_A MARR-family transcriptional regulator; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE PG4; 2.20A {Clostridium difficile} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 Back     alignment and structure
>3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A Back     alignment and structure
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>2qvo_A Uncharacterized protein AF_1382; PSI, structural genomics, southeast collaboratory for structural genomics; 1.85A {Archaeoglobus fulgidus dsm 4304} PDB: 3o3k_A 3ov8_A Back     alignment and structure
>3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3u2r_A Regulatory protein MARR; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, helix-turn-helix; 2.20A {Planctomyces limnophilus} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 Back     alignment and structure
>2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>1p6r_A Penicillinase repressor; transcription regulation, DNA-binding, winged helix protein, bacterial resistance to antibiotics; NMR {Bacillus licheniformis} SCOP: a.4.5.39 PDB: 2p7c_B Back     alignment and structure
>3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2dk5_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, winged helix domain, NPPSFA; NMR {Homo sapiens} SCOP: a.4.5.85 Back     alignment and structure
>2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2vn2_A DNAD, chromosome replication initiation protein; DNA replication, primosome; 2.3A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>4g6q_A Putative uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.08A {Kribbella flavida} Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} SCOP: a.4.5.28 PDB: 2fnp_A 1fzp_D Back     alignment and structure
>2fe3_A Peroxide operon regulator; oxidative stress regulator, DNA binding protein; 1.75A {Bacillus subtilis} PDB: 3f8n_A 2rgv_A* Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>1bja_A Transcription regulatory protein MOTA; activation domain, middle mode transcription, alpha helical structure, transcription regulation; 2.19A {Enterobacteria phage T4} SCOP: a.4.5.9 PDB: 1i1s_A Back     alignment and structure
>2k4b_A Transcriptional regulator; DNA binding protein, winged helix; NMR {Lactococcus lactis subsp} Back     alignment and structure
>2o03_A Probable zinc uptake regulation protein FURB; DNA-binding, helix-turn-helix, zinc binding, GE regulation; 2.70A {Mycobacterium tuberculosis} Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} Back     alignment and structure
>2xvc_A ESCRT-III, SSO0910; cell cycle, cell division, cytokinesis, winged-helix; 2.15A {Sulfolobus solfataricus} Back     alignment and structure
>1j5y_A Transcriptional regulator, biotin repressor famil; structural genomics, TM1602, BIOT repressor family, JCSG, conserved hypothetical protein; 2.30A {Thermotoga maritima} SCOP: a.4.5.1 d.94.2.1 Back     alignment and structure
>1uly_A Hypothetical protein PH1932; helix-turn-helix, structural genomics, DNA binding protein; 2.50A {Pyrococcus horikoshii} SCOP: a.4.5.58 PDB: 2cwe_A Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>2fxa_A Protease production regulatory protein HPR; protease porduction, regulation, STR genomics, PSI, protein structure initiative; HET: PGE P6G 1PE; 2.40A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>2qlz_A Transcription factor PF0095; 2.50A {Pyrococcus furiosus} PDB: 2quf_A Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>3mwm_A ZUR, putative metal uptake regulation protein; FUR, regulatory metal, graded transcription regulation, transcription; 2.40A {Streptomyces coelicolor} Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>1v4r_A Transcriptional repressor; helix-turn-helix, winged-helix, gene regulation; NMR {Streptomyces} SCOP: a.4.5.6 Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2p4w_A Transcriptional regulatory protein ARSR family; archaea, PHR, heat shock, transcriptional regulation, winged DNA binding; 2.60A {Pyrococcus furiosus} SCOP: a.4.5.64 Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>4b8x_A SCO5413, possible MARR-transcriptional regulator; winged helix motif; HET: CME; 1.25A {Streptomyces coelicolor} Back     alignment and structure
>1cf7_A Protein (transcription factor E2F-4); E2F, winged-helix, DNA-binding domain, cell cycle, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: a.4.5.17 Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>2hoe_A N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center structural genomics, JCSG; 2.46A {Thermotoga maritima} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>1mzb_A Ferric uptake regulation protein; ferric uptake regulator, iron, DTXR, gene regulation; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.42 Back     alignment and structure
>2xig_A Ferric uptake regulation protein; hpfur, transcription, homeostasis; HET: CIT; 1.85A {Helicobacter pylori} Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>2v79_A DNA replication protein DNAD; primosome, DNA-binding protein; HET: DNA; 2.00A {Bacillus subtilis} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>4fx0_A Probable transcriptional repressor protein; helix-turn-helix, DNA binding, transcription regulator; 2.70A {Mycobacterium tuberculosis} PDB: 4fx4_A* Back     alignment and structure
>1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>1okr_A MECI, methicillin resistance regulatory protein MECI; bacterial antibiotic resistance, MECI protein, transcriptional regulatory element; 2.4A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1sax_A 1sd7_A 2d45_A 1sd6_A Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>2obp_A Putative DNA-binding protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.70A {Ralstonia eutropha} SCOP: a.4.5.71 Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>2g9w_A Conserved hypothetical protein; DNA-binding domain, bacterial transcription repressor, DNA B protein; 1.80A {Mycobacterium tuberculosis} SCOP: a.4.5.39 Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3i71_A Ethanolamine utilization protein EUTK; helix-turn-helix, unknown function; HET: FLC; 2.10A {Escherichia coli} Back     alignment and structure
>1z6r_A MLC protein; transcriptional repressor, ROK family protein, DNA binding P helix-turn-helix, phosphotransferase system; 2.70A {Escherichia coli} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 PDB: 3bp8_A Back     alignment and structure
>1sd4_A Penicillinase repressor; BLAI, MECI, methicillin, B-lactam, DNA binding PR; 2.00A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1xsd_A Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>2pjp_A Selenocysteine-specific elongation factor; SELB, protein-RNA complex, elongation factor, winged- helix, bulge, translation/RNA complex; 2.30A {Escherichia coli} Back     alignment and structure
>2w57_A Ferric uptake regulation protein; gene regulation, transcription regulation, transport, iron, repressor, DNA-binding, transcription; 2.60A {Vibrio cholerae} Back     alignment and structure
>1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>1z05_A Transcriptional regulator, ROK family; structural genomics, protein structure initiative, midwest center for structural genomics; 2.00A {Vibrio cholerae o1 biovar eltor} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3maj_A DNA processing chain A; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: DNA; 2.05A {Rhodopseudomonas palustris} Back     alignment and structure
>1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>2o0m_A Transcriptional regulator, SORC family; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: c.124.1.8 Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>2b0l_A GTP-sensing transcriptional pleiotropic repressor; CODY, DNA-binding, nucleotide-binding, transcript regulation, winged HTH motif.; 2.90A {Bacillus subtilis} SCOP: a.4.5.66 Back     alignment and structure
>3u1d_A Uncharacterized protein; GNTR-superfamily, structural genomics, PSI-biology, midwest for structural genomics, MCSG; 1.80A {Halomicrobium mukohataei} Back     alignment and structure
>3rkx_A Biotin-[acetyl-COA-carboxylase] ligase; biotin protein ligase, 3 domains, enzyme DNA binding, biotin coupling domains; 2.10A {Staphylococcus aureus} PDB: 3rir_A* 3rkw_A 3rky_A* 3v7c_A* 3v7s_A* 3v8j_A 3v7r_A 3v8k_A* 3v8l_A* 4dq2_A* Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>2qlz_A Transcription factor PF0095; 2.50A {Pyrococcus furiosus} PDB: 2quf_A Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>2yu3_A DNA-directed RNA polymerase III 39 kDa polypeptide F variant; winged helix domain, RNA polymerase III C39 subunit, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3cta_A Riboflavin kinase; structural genomics, transferase, PSI-2, protein structure initiative; 2.20A {Thermoplasma acidophilum dsm 1728} SCOP: a.4.5.28 b.43.5.2 Back     alignment and structure
>3eyi_A Z-DNA-binding protein 1; alternative splicing, DNA-binding, polymorphism, DNA binding protein/Z-DNA complex, DNA binding protein/DNA complex; 1.45A {Homo sapiens} PDB: 2l4m_A Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>2qq9_A Diphtheria toxin repressor; regulator, DTXR, helix-turn-helix, metal ION, ACT DNA-binding, ferrous iron, transcription; 1.71A {Corynebacterium diphtheriae} PDB: 2tdx_A 1ddn_A 1g3t_A 1g3s_A 1g3w_A 2qqa_A 2qqb_A 2dtr_A 1bi0_A 1bi2_A 1bi3_A 1dpr_A 1bi1_A 1fwz_A 1g3y_A 1c0w_A* 3glx_A 1p92_A 1xcv_A 1f5t_A ... Back     alignment and structure
>3tqn_A Transcriptional regulator, GNTR family; regulatory functions; 2.80A {Coxiella burnetii} Back     alignment and structure
>1fx7_A Iron-dependent repressor IDER; DTXR, iron-dependent regulator, signaling protein; 2.00A {Mycobacterium tuberculosis} SCOP: a.4.5.24 a.76.1.1 b.34.1.2 PDB: 1u8r_A Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>2p5k_A Arginine repressor; DNA-binding domain, winged helix-turn-helix (WHTH), DNA binding protein; 1.00A {Bacillus subtilis} SCOP: a.4.5.3 PDB: 2p5l_C* Back     alignment and structure
>2w48_A Sorbitol operon regulator; SORC, activator, repressor, DNA-binding, transcription, transcription regulator, transcription regulation; 3.20A {Klebsiella pneumoniae} Back     alignment and structure
>2ek5_A Predicted transcriptional regulators; helix-turn-helix, interwined alpha helices; 2.20A {Corynebacterium glutamicum atcc 13032} PDB: 2du9_A Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>3eyy_A Putative iron uptake regulatory protein; NUR, nickel-uptake regulator, D-domain, dimerization domain, DB-domain, DNA-binding domain; 2.40A {Streptomyces coelicolor} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>1hsj_A Fusion protein consisting of staphylococcus accessary regulator protein R and maltose...; novel fold for DNA binding; HET: GLC; 2.30A {Escherichia coli} SCOP: a.4.5.28 c.94.1.1 Back     alignment and structure
>4ets_A Ferric uptake regulation protein; metal binding protein, transcription factor; 2.10A {Campylobacter jejuni subsp} Back     alignment and structure
>1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} SCOP: a.4.5.28 a.4.5.28 Back     alignment and structure
>3by6_A Predicted transcriptional regulator; structural genomics, PSI-2, MCSG, structure initiative, midwest center for structural genomic binding; 2.20A {Oenococcus oeni} Back     alignment and structure
>3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua} Back     alignment and structure
>2p8t_A Hypothetical protein PH0730; pyrococcus horikoshii OT3, STR genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.72 d.74.4.2 Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>3elk_A Putative transcriptional regulator TA0346; structural genomics, PSI-2, prote structure initiative; 1.70A {Thermoplasma acidophilum} Back     alignment and structure
>4esf_A PADR-like transcriptional regulator; PADR family, DNA binding protein, HTH fold; 2.20A {Bacillus cereus} Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 214
d1fp2a1101 a.4.5.29 (A:8-108) Isoflavone O-methyltransferase 5e-19
d1fp2a2 244 c.66.1.12 (A:109-352) Isoflavone O-methyltransfera 2e-16
d1fp1d2 244 c.66.1.12 (D:129-372) Chalcone O-methyltransferase 2e-14
d1fp1d1110 a.4.5.29 (D:19-128) Chalcone O-methyltransferase { 2e-12
d1kyza1107 a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic 1e-11
d1kyza2 243 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferuli 5e-10
d1qzza192 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase R 3e-09
d1qzza2 256 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase 0.002
d1mkma175 a.4.5.33 (A:1-75) Transcriptional regulator IclR, 0.004
>d1fp2a1 a.4.5.29 (A:8-108) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 101 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: Plant O-methyltransferase, N-terminal domain
domain: Isoflavone O-methyltransferase
species: Alfalfa (Medicago sativa) [TaxId: 3879]
 Score = 76.5 bits (188), Expect = 5e-19
 Identities = 29/76 (38%), Positives = 50/76 (65%)

Query: 9  GAREHFQAQAQVWSYTYNYMKSLSLKRAIQLRIPDIINNSGQPMTLTQIIVALNVHPNKT 68
             E F+AQA ++ + Y ++ S+SLK A+++ IP+II N G+P++L+ ++  L V  +K 
Sbjct: 2  KPSEIFKAQALLYKHIYAFIDSMSLKWAVEMNIPNIIQNHGKPISLSNLVSILQVPSSKI 61

Query: 69 RCTQILVCLLAHSGFF 84
             + L+  LAH+GFF
Sbjct: 62 GNVRRLMRYLAHNGFF 77


>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 Back     information, alignment and structure
>d1fp1d1 a.4.5.29 (D:19-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 110 Back     information, alignment and structure
>d1kyza1 a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 107 Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 243 Back     information, alignment and structure
>d1qzza1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Length = 92 Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Length = 256 Back     information, alignment and structure
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 75 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
d1fp2a1101 Isoflavone O-methyltransferase {Alfalfa (Medicago 99.79
d1kyza2 243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 99.75
d1fp1d2 244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 99.74
d1fp2a2 244 Isoflavone O-methyltransferase {Alfalfa (Medicago 99.67
d1tw3a185 Carminomycin 4-O-methyltransferase {Streptomyces p 99.65
d1qzza192 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.62
d1fp1d1110 Chalcone O-methyltransferase {Alfalfa (Medicago sa 99.59
d1kyza1107 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 99.54
d1qzza2 256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.53
d1tw3a2 253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.46
d1mkma175 Transcriptional regulator IclR, N-terminal domain 98.19
d2o57a1 282 Putative sarcosine dimethylglycine methyltransfera 97.69
d1nkva_ 245 Hypothetical Protein YjhP {Escherichia coli [TaxId 97.52
d2fcaa1 204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 97.48
d1yzha1 204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 97.46
d1im8a_ 225 Hypothetical protein HI0319 (YecO) {Haemophilus in 97.46
d1p91a_ 268 rRNA methyltransferase RlmA {Escherichia coli [Tax 97.28
d1g8sa_ 230 Fibrillarin homologue {Archaeon Methanococcus jann 97.15
d1u2za_ 406 Catalytic, N-terminal domain of histone methyltran 97.12
d2b3ta1 274 N5-glutamine methyltransferase, HemK {Escherichia 97.1
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 97.09
d1kpia_ 291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 97.05
d1wzna1 251 Hypothetical methyltransferase PH1305 {Archaeon Py 97.04
d1nt2a_ 209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 97.03
d1dusa_ 194 Hypothetical protein MJ0882 {Archaeon Methanococcu 97.02
d2fk8a1 280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 97.02
d1kpga_ 285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 96.95
d1nw3a_ 328 Catalytic, N-terminal domain of histone methyltran 96.95
d1l3ia_ 186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 96.92
d1ve3a1 226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 96.85
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 96.84
d1biaa163 Biotin repressor, N-terminal domain {Escherichia c 96.84
d1y8ca_ 246 Putative methyltransferase CAC2371 {Clostridium ac 96.83
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 96.78
d2i6ga1 198 Putative methyltransferase TehB {Salmonella typhim 96.78
d2nxca1 254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 96.7
d1zx0a1 229 Guanidinoacetate methyltransferase {Human (Homo sa 96.7
d2avna1 246 Hypothetical methyltransferase TM1389 {Thermotoga 96.67
d1xtpa_ 254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 96.61
d2h00a1 250 Methyltransferase 10 domain containing protein MET 96.6
d2hoea162 N-acetylglucosamine kinase {Thermotoga maritima [T 96.55
d1yb2a1 250 Hypothetical protein Ta0852 {Thermoplasma acidophi 96.52
d1xvaa_ 292 Glycine N-methyltransferase {Rat (Rattus norvegicu 96.51
d2ex4a1 222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 96.51
d1dl5a1 213 Protein-L-isoaspartyl O-methyltransferase {Thermot 96.49
d1lnwa_141 MexR repressor {Pseudomonas aeruginosa [TaxId: 287 96.48
d1z6ra170 Mlc protein N-terminal domain {Escherichia coli [T 96.41
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 96.39
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 96.35
d1lvaa364 C-terminal fragment of elongation factor SelB {Moo 96.34
d1i9ga_ 264 Probable methyltransferase Rv2118c {Mycobacterium 96.33
d1o54a_ 266 Hypothetical protein TM0748 {Thermotoga maritima [ 96.29
d1r1ua_94 Metal-sensing transcriptional repressor CzrA {Stap 96.2
d1r1ta_98 SmtB repressor {Cyanobacteria (Synechococcus), pcc 96.17
d2bzga1 229 Thiopurine S-methyltransferase {Human (Homo sapien 96.13
d1jqea_ 280 Histamine methyltransferase {Human (Homo sapiens) 96.12
d2etha1140 Putative transcriptional regulator TM0816 {Thermot 96.08
d1ne2a_ 197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 96.01
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 95.92
d1u2wa1108 Cadmium efflux system accessory protein CadC {Stap 95.87
d1ulya_190 Hypothetical protein PH1932 {Pyrococcus horikoshii 95.85
d1xd7a_127 Hypothetical protein ywnA {Bacillus subtilis [TaxI 95.84
d1s3ja_143 Putative transcriptional regulator YusO {Bacillus 95.82
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 95.75
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sul 95.74
d1wy7a1 201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 95.7
d2b25a1 324 Hypothetical protein FLJ20628 {Human (Homo sapiens 95.63
d1vlma_ 208 Possible histamine N-methyltransferase TM1293 {The 95.55
d1i1na_ 224 Protein-L-isoaspartyl O-methyltransferase {Human ( 95.51
d1ku9a_151 DNA-binding protein Mj223 {Archaeon Methanococcus 95.39
d3broa1135 Transcriptional regulator OEOE1854 {Oenococcus oen 95.37
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 95.37
d2fbha1137 Transcriptional regulator PA3341 {Pseudomonas aeru 95.37
d2bv6a1136 Transcriptional regulator MgrA {Staphylococcus aur 95.32
d1g8aa_ 227 Fibrillarin homologue {Archaeon Pyrococcus horikos 95.26
d2p4wa1194 Transcriptional regulatory protein PF1790 {Pyrococ 95.22
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 95.16
d2hr3a1145 Probable transcriptional regulator PA3067 {Pseudom 95.1
d2a14a1 257 Indolethylamine N-methyltransferase, INMT {Human ( 95.02
d2a61a1139 Transcriptional regulator TM0710 {Thermotoga marit 95.02
d1lj9a_144 Transcriptional regulator SlyA {Enterococcus faeca 94.87
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 94.86
d1ylfa1138 Hypothetical protein BC1842 {Bacillus cereus [TaxI 94.83
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.83
d2isya163 Iron-dependent regulator IdeR {Mycobacterium tuber 94.81
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 94.77
d1nv8a_ 271 N5-glutamine methyltransferase, HemK {Thermotoga m 94.7
d3deua1140 Transcriptional regulator SlyA {Salmonella typhimu 94.62
d1jgsa_138 Multiple antibiotic resistance repressor, MarR {Es 94.55
d2ev0a161 Manganese transport regulator MntR {Bacillus subti 94.53
d3ctaa185 Ta1064 (RFK), N-terminal domain {Thermoplasma acid 94.41
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 94.32
d2g72a1 263 Phenylethanolamine N-methyltransferase, PNMTase {H 94.25
d1j75a_57 Dlm-1 {Mouse (Mus musculus) [TaxId: 10090]} 94.13
d1r7ja_90 Sso10a (SSO10449) {Archaeon Sulfolobus solfataricu 94.02
d1jsxa_ 207 Glucose-inhibited division protein B (GidB) {Esche 94.02
d1vbfa_ 224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 93.99
d1jhfa171 LexA repressor, N-terminal DNA-binding domain {Esc 93.95
d1r18a_ 223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 93.77
d2hzta195 Putative transcriptional regulator YtcD {Bacillus 93.5
d1dpua_69 C-terminal domain of RPA32 {Human (Homo sapiens) [ 93.38
d2frna1 260 Hypothetical protein PH0793 {Pyrococcus horikoshii 93.32
d2fbia1136 Probable transcriptional regulator PA4135 {Pseudom 93.07
d1z91a1137 Organic hydroperoxide resistance transcriptional r 92.67
d1xdza_ 239 Glucose-inhibited division protein B (GidB) {Bacil 92.3
d1jg1a_ 215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 92.27
d2gxba159 Z-alpha domain of dsRNA-specific adenosine deamina 92.26
d1yuba_ 245 rRNA adenine dimethylase {Streptococcus pneumoniae 92.16
d1yyva1114 Putative transcriptional regulator YtfH {Salmonell 91.81
d1hsja1115 Staphylococcal accessory regulator A homolog, SarR 91.76
d2fpoa1 183 Methylase YhhF {Escherichia coli [TaxId: 562]} 91.67
d2frha1115 Pleiotropic regulator of virulence genes, SarA {St 91.54
d1uira_ 312 Spermidine synthase {Thermus thermophilus [TaxId: 91.37
d2cl5a1 214 Catechol O-methyltransferase, COMT {Rat (Rattus no 91.33
d1q1ha_88 Transcription factor E/IIe-alpha, N-terminal domai 91.22
d1bl0a154 MarA {Escherichia coli [TaxId: 562]} 91.11
d1p4xa2125 Staphylococcal accessory regulator A homolog, SarS 91.05
d1xmka173 Z-alpha domain of dsRNA-specific adenosine deamina 90.6
d2fxaa1162 Protease production regulatory protein Hpr {Bacill 90.44
d1p4xa1125 Staphylococcal accessory regulator A homolog, SarS 90.21
d2fbka1172 Transcriptional regulator DR1159 {Deinococcus radi 90.17
d2fswa1102 Hypothetical protein PG0823 {Porphyromonas gingiva 90.15
d2f2ea1142 Hypothetical protein PA1607 {Pseudomonas aeruginos 89.98
d1sfua_70 34L {Yaba-like disease virus, YLDV [TaxId: 132475] 89.72
d1zyba173 Probable transcription regulator BT4300, C-termina 89.29
d2hs5a169 Putative transcriptional regulator RHA1_ro03477 {R 89.25
d2avda1 219 COMT domain-containing protein 1, COMTD1 {Human (H 89.14
d2gaua181 Transcriptional regulator PG0396, C-terminal domai 89.14
d2zcwa182 Transcriptional regulator TTHA1359, C-terminal dom 88.99
d1i5za169 Catabolite gene activator protein (CAP), C-termina 88.83
d2p41a1 257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 88.61
d1mjfa_ 276 Putative spermidine synthetase PF0127 (SpeE) {Arch 88.53
d1z7ua1108 Hypothetical protein EF0647 {Enterococcus faecalis 88.32
d1cf7a_67 Cell cycle transcription factor E2F-4 {Human (Homo 88.27
d2as0a2 324 Hypothetical protein PH1915, middle and C-terminal 88.16
d1iy9a_ 274 Spermidine synthase {Bacillus subtilis [TaxId: 142 88.1
d2o07a1 285 Spermidine synthase {Human (Homo sapiens) [TaxId: 87.68
d3bwga178 Transcriptional regulator YydK {Bacillus subtilis 87.64
d1d5ya154 Rob transcription factor, N-terminal domain {Esche 87.54
d1inla_ 295 Spermidine synthase {Thermotoga maritima [TaxId: 2 87.42
d2b2ca1 312 Spermidine synthase {Caenorhabditis elegans [TaxId 87.31
d1hw1a174 Fatty acid responsive transcription factor FadR, N 87.29
d1ft9a180 CO-sensing protein CooA, C-terminal domain {Rhodos 87.09
d2fhpa1 182 Putative methylase EF2452 {Enterococcus faecalis [ 86.49
d1xj5a_ 290 Spermidine synthase {Thale cress (Arabidopsis thal 85.27
d3e5ua180 Chlorophenol reduction protein CprK {Desulfitobact 84.92
d1stza187 Heat-inducible transcription repressor HrcA, N-ter 84.69
d2f8la1 328 Hypothetical protein Lmo1582 {Listeria monocytogen 83.33
d1susa1 227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 82.41
d1okra_120 Methicillin resistance regulatory protein MecI {St 82.06
d2dk5a178 DNA-directed RNA polymerase III subunit RPC6, RPO3 81.54
d1wxxa2 318 Hypothetical protein TTHA1280, middle and C-termin 80.17
>d1fp2a1 a.4.5.29 (A:8-108) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: Plant O-methyltransferase, N-terminal domain
domain: Isoflavone O-methyltransferase
species: Alfalfa (Medicago sativa) [TaxId: 3879]
Probab=99.79  E-value=1.7e-20  Score=133.94  Aligned_cols=95  Identities=36%  Similarity=0.585  Sum_probs=85.2

Q ss_pred             chhhhhHHHHHHHHHHHHhHHHHHHHHHhcCcchhhhcCCCCCCHHHHHHHcCCCCCCcccHHHHHHHHHhCCceeeecC
Q 040620           10 AREHFQAQAQVWSYTYNYMKSLSLKRAIQLRIPDIINNSGQPMTLTQIIVALNVHPNKTRCTQILVCLLAHSGFFVQQKD   89 (214)
Q Consensus        10 ~~~~~~~~~~l~~~~~g~~~~~~L~~a~~lglfd~L~~~~~p~t~~eLA~~~g~~~~~~~~l~rlLr~L~~~g~l~~~~~   89 (214)
                      +.|..+++..+|++++||+.+++|++|+++||||+|+++++|+|++|||+++++++.+.+.|.|+||+|++.|+|.++.+
T Consensus         3 ~~e~~qaq~~l~~~~~gf~~s~aL~~aveLgi~d~l~~~~~p~t~~eLa~~~~~~~~~~~~L~RlLR~L~~~gi~~~~~~   82 (101)
T d1fp2a1           3 PSEIFKAQALLYKHIYAFIDSMSLKWAVEMNIPNIIQNHGKPISLSNLVSILQVPSSKIGNVRRLMRYLAHNGFFEIITK   82 (101)
T ss_dssp             STHHHHHHHHHHHHHTTHHHHHHHHHHHHTTHHHHHHHHTSCEEHHHHHHHHTCCGGGHHHHHHHHHHHHHTTSEEEEES
T ss_pred             hHHHHHHHHHHHHHHHhHHHHHHHHHHHHcCcHHHHHHcCCCCCHHHHHHHcCCCCccchHHHHHHHHHHhCCceeeecC
Confidence            56788999999999999999999999999999999987778999999999999987444679999999999999987653


Q ss_pred             CCCCCccceeeCCCCCcccccccc
Q 040620           90 GKNEQEEESILLPPHLDFFSRISL  113 (214)
Q Consensus        90 ~~~~~~~~~y~~t~~~~~~s~~l~  113 (214)
                      .     +++|++|+.    |+.|+
T Consensus        83 ~-----~~~Y~lt~~----s~~Lv   97 (101)
T d1fp2a1          83 E-----EESYALTVA----SELLV   97 (101)
T ss_dssp             S-----SEEEEECHH----HHTTS
T ss_pred             C-----CCeEecCHH----HHHhh
Confidence            1     579999999    99887



>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1tw3a1 a.4.5.29 (A:14-98) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1qzza1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1fp1d1 a.4.5.29 (D:19-128) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1kyza1 a.4.5.29 (A:13-119) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lnwa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvaa3 a.4.5.35 (A:511-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xd7a_ a.4.5.55 (A:) Hypothetical protein ywnA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3broa1 a.4.5.28 (A:3-137) Transcriptional regulator OEOE1854 {Oenococcus oeni [TaxId: 1247]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bv6a1 a.4.5.28 (A:5-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lj9a_ a.4.5.28 (A:) Transcriptional regulator SlyA {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ylfa1 a.4.5.55 (A:5-142) Hypothetical protein BC1842 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3deua1 a.4.5.28 (A:2-141) Transcriptional regulator SlyA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jgsa_ a.4.5.28 (A:) Multiple antibiotic resistance repressor, MarR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ev0a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j75a_ a.4.5.19 (A:) Dlm-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ja_ a.4.5.49 (A:) Sso10a (SSO10449) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2hzta1 a.4.5.69 (A:4-98) Putative transcriptional regulator YtcD {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z91a1 a.4.5.28 (A:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gxba1 a.4.5.19 (A:140-198) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1yyva1 a.4.5.69 (A:9-122) Putative transcriptional regulator YtfH {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2frha1 a.4.5.28 (A:102-216) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q1ha_ a.4.5.41 (A:) Transcription factor E/IIe-alpha, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xmka1 a.4.5.19 (A:294-366) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p4xa1 a.4.5.28 (A:1-125) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2fbka1 a.4.5.28 (A:8-179) Transcriptional regulator DR1159 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2fswa1 a.4.5.69 (A:3-104) Hypothetical protein PG0823 {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d2f2ea1 a.4.5.69 (A:5-146) Hypothetical protein PA1607 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sfua_ a.4.5.19 (A:) 34L {Yaba-like disease virus, YLDV [TaxId: 132475]} Back     information, alignment and structure
>d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1z7ua1 a.4.5.69 (A:1-108) Hypothetical protein EF0647 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1cf7a_ a.4.5.17 (A:) Cell cycle transcription factor E2F-4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1d5ya1 a.4.1.8 (A:3-56) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1hw1a1 a.4.5.6 (A:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1stza1 a.4.5.51 (A:14-100) Heat-inducible transcription repressor HrcA, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1okra_ a.4.5.39 (A:) Methicillin resistance regulatory protein MecI {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2dk5a1 a.4.5.85 (A:8-85) DNA-directed RNA polymerase III subunit RPC6, RPO3F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure