Citrus Sinensis ID: 040667


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
RSLARSAYNRGGYETSKILWEAAMALSSLYPDGWFALGAAALKARDVEKALDGFTRAVQLDPDNGEAWNNIACLHMIKKKSKEAFIAFKEALYWQLWENYSHVALDVGNIGQALEAVQMVLNMTNNKRIDTELLERIVLDLEGRTSIIESESCRTTHNLNRTNNTCAKDLPVESVHVSSPEESIMGRSRENEHLMEFLGKILQQFAH
ccHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHcHHHHHHHHHHHHHHHHHHc
ccHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHc
rslarsaynrggyeTSKILWEAAMALSSLYPDGWFALGAAALKARDVEKALDGFTRavqldpdngeawNNIACLHMIKKKSKEAFIAFKEALYWQLWENYSHVALDVGNIGQALEAVQMVLNMTNNKRIDTELLERIVLDLegrtsiiesescrtthnlnrtnntcakdlpvesvhvsspeesimgrSRENEHLMEFLGKILQQFAH
rslarsaynrggyETSKILWEAAMALSSLYPDGWFALGAAALKARDVEKALDGFTRavqldpdngeAWNNIACLHMIKKKSKEAFIAFKEALYWQLWENYSHVALDVGNIGQALEAVQMVLNMTNNKRIDTELLERIVLDLegrtsiiesescrtthnlnrtnntcakdlpvesvhvsspeesimgrSRENEHLMEFLGKILQQFAH
RSLARSAYNRGGYETSKILWEAAMALSSLYPDGWFALGAAALKARDVEKALDGFTRAVQLDPDNGEAWNNIACLHMIKKKSKEAFIAFKEALYWQLWENYSHVALDVGNIGQALEAVQMVLNMTNNKRIDTELLERIVLDLEGRTSIIESESCrtthnlnrtnntCAKDLpvesvhvsspeesIMGRSRENEHLMEFLGKILQQFAH
**********GGYETSKILWEAAMALSSLYPDGWFALGAAALKARDVEKALDGFTRAVQLDPDNGEAWNNIACLHMIKKKSKEAFIAFKEALYWQLWENYSHVALDVGNIGQALEAVQMVLNMTNNKRIDTELLERIVLDLEGRTSIIESESCR*****************************************************
RSLARSAYNRGGYETSKILWEAAMALSSLYPDGWFALGAAALKARDVEKALDGFTRAVQLDPDNGEAWNNIACLHMIKKKSKEAFIAFKEALYWQLWENYSHVALDVGNIGQALEAVQMVLNMTNNKRIDTELLERIVLDLEGRTSIIESESCRTTHNLNRTNNTCAKDLPVESVHVSSPE****GRSRENEHLMEFLGKILQQFA*
**********GGYETSKILWEAAMALSSLYPDGWFALGAAALKARDVEKALDGFTRAVQLDPDNGEAWNNIACLHMIKKKSKEAFIAFKEALYWQLWENYSHVALDVGNIGQALEAVQMVLNMTNNKRIDTELLERIVLDLEGRTSIIESESCRTTHNLNRTNNTCAKDLPVE**********IMGRSRENEHLMEFLGKILQQFAH
*SLARSAYNRGGYETSKILWEAAMALSSLYPDGWFALGAAALKARDVEKALDGFTRAVQLDPDNGEAWNNIACLHMIKKKSKEAFIAFKEALYWQLWENYSHVALDVGNIGQALEAVQMVLNMTNNKRIDTELLERIVLDLEGR*******************************************SRENEHLMEFLGKILQQFAH
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RSLARSAYNRGGYETSKILWEAAMALSSLYPDGWFALGAAALKARDVEKALDGFTRAVQLDPDNGEAWNNIACLHMIKKKSKEAFIAFKEALYWQLWENYSHVALDVGNIGQALEAVQMVLNMTNNKRIDTELLERIVLDLEGRTSIIESESCRTTHNLNRTNNTCAKDLPVESVHVSSPEESIMGRSRENEHLMEFLGKILQQFAH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query207 2.2.26 [Sep-21-2011]
Q54BW6853 Tetratricopeptide repeat yes no 0.657 0.159 0.330 8e-19
Q8CD92847 Tetratricopeptide repeat yes no 0.628 0.153 0.328 1e-15
Q6P3X3 843 Tetratricopeptide repeat yes no 0.570 0.139 0.338 2e-15
Q17QZ7 847 Tetratricopeptide repeat yes no 0.570 0.139 0.346 2e-15
Q5RBW9843 Tetratricopeptide repeat yes no 0.579 0.142 0.341 2e-15
Q5F3K0 844 Tetratricopeptide repeat yes no 0.570 0.139 0.338 8e-15
O36033817 TPR repeat-containing pro yes no 0.661 0.167 0.253 3e-12
P41842 771 TPR repeat-containing pro yes no 0.618 0.166 0.321 2e-11
P42842904 Essential for maintenance yes no 0.526 0.120 0.286 2e-09
P56558 1036 UDP-N-acetylglucosamine-- no no 0.429 0.085 0.263 0.0001
>sp|Q54BW6|TTC27_DICDI Tetratricopeptide repeat protein 27 homolog OS=Dictyostelium discoideum GN=ttc27 PE=3 SV=1 Back     alignment and function desciption
 Score = 93.6 bits (231), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 83/142 (58%), Gaps = 6/142 (4%)

Query: 1   RSLARSAYNRGGYETSKILWEAAMALSSLYPDGWFALGAAALKARDVEKALDGFTRAVQL 60
           RSLAR    R  Y+     ++ A+A++ L+P+ WF+LG AA+K    + AL+ F+R V L
Sbjct: 564 RSLARFYLEREQYQLCIDAFQIALAINPLFPNSWFSLGCAAMKIEKWDTALNAFSRVVSL 623

Query: 61  DPDNGEAWNNIACLHMIKKKSKEAFIAFKEALY-----WQLWENYSHVALDVGNIGQALE 115
           +P+ GE W N+A ++M + K  +A  A  E L      W++WEN+    + + +   A+ 
Sbjct: 624 EPEEGEGWANLASIYMYQNKMDKASSALMEGLKHKRENWKMWENFLFCCIAIKDYQNAVI 683

Query: 116 AVQMVLNMTNNKRIDTELLERI 137
           A+  + ++ N+K+++ +LL  I
Sbjct: 684 AINHIFDL-NDKKVNLKLLSII 704





Dictyostelium discoideum (taxid: 44689)
>sp|Q8CD92|TTC27_MOUSE Tetratricopeptide repeat protein 27 OS=Mus musculus GN=Ttc27 PE=2 SV=2 Back     alignment and function description
>sp|Q6P3X3|TTC27_HUMAN Tetratricopeptide repeat protein 27 OS=Homo sapiens GN=TTC27 PE=1 SV=1 Back     alignment and function description
>sp|Q17QZ7|TTC27_BOVIN Tetratricopeptide repeat protein 27 OS=Bos taurus GN=TTC27 PE=2 SV=1 Back     alignment and function description
>sp|Q5RBW9|TTC27_PONAB Tetratricopeptide repeat protein 27 OS=Pongo abelii GN=TTC27 PE=2 SV=1 Back     alignment and function description
>sp|Q5F3K0|TTC27_CHICK Tetratricopeptide repeat protein 27 OS=Gallus gallus GN=TTC27 PE=2 SV=1 Back     alignment and function description
>sp|O36033|YLM1_SCHPO TPR repeat-containing protein C19B12.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC19B12.01 PE=4 SV=2 Back     alignment and function description
>sp|P41842|YO91_CAEEL TPR repeat-containing protein T20B12.1 OS=Caenorhabditis elegans GN=T20B12.1 PE=4 SV=2 Back     alignment and function description
>sp|P42842|EMW1_YEAST Essential for maintenance of the cell wall protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMW1 PE=1 SV=1 Back     alignment and function description
>sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query207
255571269 891 conserved hypothetical protein [Ricinus 0.956 0.222 0.666 1e-71
356507408 910 PREDICTED: tetratricopeptide repeat prot 0.985 0.224 0.671 2e-71
359480921 909 PREDICTED: tetratricopeptide repeat prot 0.908 0.206 0.677 6e-71
296084812 904 unnamed protein product [Vitis vinifera] 0.903 0.206 0.663 8e-70
449468426 897 PREDICTED: tetratricopeptide repeat prot 0.879 0.202 0.639 2e-67
449516270 482 PREDICTED: LOW QUALITY PROTEIN: tetratri 0.884 0.379 0.636 5e-67
224077388 718 predicted protein [Populus trichocarpa] 0.985 0.284 0.612 2e-66
297807747 892 tetratricopeptide repeat-containing prot 0.917 0.213 0.609 3e-64
15237943 899 tetratricopeptide repeat-containing prot 0.922 0.212 0.609 3e-63
145358569 877 prenylyltransferase-like protein [Arabid 0.816 0.192 0.634 2e-55
>gi|255571269|ref|XP_002526584.1| conserved hypothetical protein [Ricinus communis] gi|223534078|gb|EEF35796.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  275 bits (702), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 140/210 (66%), Positives = 163/210 (77%), Gaps = 12/210 (5%)

Query: 1   RSLARSAYNRGGYETSKILWEAAMALSSLYPDGWFALGAAALKARDVEKALDGFTRAVQL 60
           RSLARSAY+RG YETSK+LWE+AMAL+SLY DGWFALGAAALKARDVEKALDGFTRAVQL
Sbjct: 556 RSLARSAYDRGDYETSKVLWESAMALNSLYRDGWFALGAAALKARDVEKALDGFTRAVQL 615

Query: 61  DPDNGEAWNNIACLHMIKKKSKEAFIAFKEAL-----YWQLWENYSHVALDVGNIGQALE 115
           DP+NGEAWNNIACLHMIKK++ EAFI+FKEAL      WQLWENYSHV +DVGN+ QALE
Sbjct: 616 DPENGEAWNNIACLHMIKKRNNEAFISFKEALKLKRDSWQLWENYSHVVMDVGNVRQALE 675

Query: 116 AVQMVLNMTNNKRIDTELLERIVLDLEGRTSIIESESCRTTHNLNRTNNTCAKDLPVESV 175
           A+QMVL++T+ K++D +LLERI+L++EGR S   S     T + N TN TC  D   +S 
Sbjct: 676 AIQMVLHITSCKQVDADLLERIMLEIEGRASSRHSIYLPATGDTNSTNQTCFDDSQNDS- 734

Query: 176 HVSSPEESIMGRSRENEHLMEFLGKILQQF 205
                 E   G SRE E L+E  GKILQQ 
Sbjct: 735 ------EVQAGWSRETEQLVELFGKILQQI 758




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356507408|ref|XP_003522459.1| PREDICTED: tetratricopeptide repeat protein 27 homolog [Glycine max] Back     alignment and taxonomy information
>gi|359480921|ref|XP_002268108.2| PREDICTED: tetratricopeptide repeat protein 27 homolog [Vitis vinifera] Back     alignment and taxonomy information
>gi|296084812|emb|CBI27694.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449468426|ref|XP_004151922.1| PREDICTED: tetratricopeptide repeat protein 27 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|449516270|ref|XP_004165170.1| PREDICTED: LOW QUALITY PROTEIN: tetratricopeptide repeat protein 27 homolog, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|224077388|ref|XP_002305241.1| predicted protein [Populus trichocarpa] gi|222848205|gb|EEE85752.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297807747|ref|XP_002871757.1| tetratricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297317594|gb|EFH48016.1| tetratricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15237943|ref|NP_197229.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] gi|10177072|dbj|BAB10514.1| unnamed protein product [Arabidopsis thaliana] gi|332005024|gb|AED92407.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|145358569|ref|NP_198529.3| prenylyltransferase-like protein [Arabidopsis thaliana] gi|332006762|gb|AED94145.1| prenylyltransferase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query207
TAIR|locus:2167165 899 AT5G17270 [Arabidopsis thalian 0.734 0.169 0.745 1e-58
TAIR|locus:2166153877 AT5G37130 [Arabidopsis thalian 0.734 0.173 0.687 2.5e-52
MGI|MGI:1921446847 Ttc27 "tetratricopeptide repea 0.632 0.154 0.330 1.5e-15
RGD|1305264 847 Ttc27 "tetratricopeptide repea 0.570 0.139 0.346 2.4e-15
UNIPROTKB|Q6P3X3 843 TTC27 "Tetratricopeptide repea 0.603 0.148 0.333 3e-15
POMBASE|SPAC19B12.01817 SPAC19B12.01 "TPR repeat prote 0.657 0.166 0.284 9.1e-14
WB|WBGene00020600 771 T20B12.1 [Caenorhabditis elega 0.565 0.151 0.341 3.4e-12
CGD|CAL0004331916 orf19.5356 [Candida albicans ( 0.555 0.125 0.293 1.2e-09
UNIPROTKB|Q5A5P4916 CaO19.12816 "Putative uncharac 0.555 0.125 0.293 1.2e-09
SGD|S000005257904 EMW1 "Essential conserved prot 0.526 0.120 0.286 2e-09
TAIR|locus:2167165 AT5G17270 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 606 (218.4 bits), Expect = 1.0e-58, P = 1.0e-58
 Identities = 117/157 (74%), Positives = 134/157 (85%)

Query:     1 RSLARSAYNRGGYETSKILWEAAMALSSLYPDGWFALGAAALKARDVEKALDGFTRAVQL 60
             R+LARSAYNRG +E SK+LWEAAMAL+SLYPDGWFALGAAALKARDV+KALD FT AVQL
Sbjct:   578 RALARSAYNRGDFEKSKMLWEAAMALNSLYPDGWFALGAAALKARDVQKALDAFTFAVQL 637

Query:    61 DPDNGEAWNNIACLHMIKKKSKEAFIAFKEALY-----WQLWENYSHVALDVGNIGQALE 115
             DPDNGEAWNNIACLHMIKKKSKE+FIAFKEAL      WQ+WEN+SHVA+DVGNI QA E
Sbjct:   638 DPDNGEAWNNIACLHMIKKKSKESFIAFKEALKFKRDSWQMWENFSHVAMDVGNIDQAFE 697

Query:   116 AVQMVLNMTNNKRIDTELLERIVLDLEGRTSIIESES 152
             A+Q +L M+ NKR+D  LL+RI+ +LE R S  +S S
Sbjct:   698 AIQQILKMSKNKRVDVVLLDRIMTELEKRNSACKSSS 734




GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0006406 "mRNA export from nucleus" evidence=RCA
GO:0006606 "protein import into nucleus" evidence=RCA
GO:0009560 "embryo sac egg cell differentiation" evidence=RCA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0010074 "maintenance of meristem identity" evidence=RCA
GO:0010388 "cullin deneddylation" evidence=RCA
GO:0016567 "protein ubiquitination" evidence=RCA
GO:0016571 "histone methylation" evidence=RCA
GO:0016579 "protein deubiquitination" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
TAIR|locus:2166153 AT5G37130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1921446 Ttc27 "tetratricopeptide repeat domain 27" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305264 Ttc27 "tetratricopeptide repeat domain 27" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P3X3 TTC27 "Tetratricopeptide repeat protein 27" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
POMBASE|SPAC19B12.01 SPAC19B12.01 "TPR repeat protein, TTC27 family" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
WB|WBGene00020600 T20B12.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
CGD|CAL0004331 orf19.5356 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5A5P4 CaO19.12816 "Putative uncharacterized protein" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
SGD|S000005257 EMW1 "Essential conserved protein with a role in cell wall integrity" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 7e-12
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-10
pfam1341469 pfam13414, TPR_11, TPR repeat 3e-09
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 2e-06
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 3e-06
TIGR02552135 TIGR02552, LcrH_SycD, type III secretion low calci 4e-06
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 1e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-05
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 2e-05
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 1e-04
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-04
COG4976287 COG4976, COG4976, Predicted methyltransferase (con 3e-04
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 3e-04
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 8e-04
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 0.003
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
 Score = 59.3 bits (144), Expect = 7e-12
 Identities = 27/94 (28%), Positives = 47/94 (50%), Gaps = 5/94 (5%)

Query: 34  WFALGAAALKARDVEKALDGFTRAVQLDPDNGEAWNNIACLHMIKKKSKEAFIAFKEAL- 92
              LG    K  D ++AL+ + +A++LDPDN +A+ N+A  +    K +EA   +++AL 
Sbjct: 3   LLNLGNLYYKLGDYDEALEYYEKALELDPDNADAYYNLAAAYYKLGKYEEALEDYEKALE 62

Query: 93  ----YWQLWENYSHVALDVGNIGQALEAVQMVLN 122
                 + + N       +G   +ALEA +  L 
Sbjct: 63  LDPDNAKAYYNLGLAYYKLGKYEEALEAYEKALE 96


Length = 100

>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|233924 TIGR02552, LcrH_SycD, type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|227310 COG4976, COG4976, Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 207
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.87
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.84
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.82
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.77
PRK15359144 type III secretion system chaperone protein SscB; 99.77
PRK11189296 lipoprotein NlpI; Provisional 99.76
KOG1126638 consensus DNA-binding cell division cycle control 99.76
PRK10370198 formate-dependent nitrite reductase complex subuni 99.75
KOG1126638 consensus DNA-binding cell division cycle control 99.75
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.75
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.75
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.74
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.74
PRK15359144 type III secretion system chaperone protein SscB; 99.73
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.72
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.69
PRK12370553 invasion protein regulator; Provisional 99.67
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.66
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.66
PRK12370553 invasion protein regulator; Provisional 99.66
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.66
KOG0553304 consensus TPR repeat-containing protein [General f 99.65
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.65
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.65
KOG0547606 consensus Translocase of outer mitochondrial membr 99.63
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.63
KOG1125579 consensus TPR repeat-containing protein [General f 99.61
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.6
PRK11189296 lipoprotein NlpI; Provisional 99.6
KOG0553304 consensus TPR repeat-containing protein [General f 99.6
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.59
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.59
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.57
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.57
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.56
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.56
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.56
PRK11788389 tetratricopeptide repeat protein; Provisional 99.56
PRK11788389 tetratricopeptide repeat protein; Provisional 99.56
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.55
KOG1128777 consensus Uncharacterized conserved protein, conta 99.55
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.55
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.54
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.54
PLN02789320 farnesyltranstransferase 99.54
KOG1125579 consensus TPR repeat-containing protein [General f 99.54
KOG2076 895 consensus RNA polymerase III transcription factor 99.53
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.53
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.53
KOG1129478 consensus TPR repeat-containing protein [General f 99.52
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.51
KOG0547606 consensus Translocase of outer mitochondrial membr 99.49
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.49
PRK10370198 formate-dependent nitrite reductase complex subuni 99.49
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.48
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.48
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.47
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.46
PLN02789320 farnesyltranstransferase 99.46
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.46
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.45
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.44
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.44
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.44
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.44
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.44
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.43
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.43
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.43
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.43
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.4
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.39
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.39
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.38
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.38
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.38
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.37
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.37
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.37
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.36
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.36
KOG2003 840 consensus TPR repeat-containing protein [General f 99.35
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.34
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.34
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.34
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.33
KOG1129478 consensus TPR repeat-containing protein [General f 99.33
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.32
PRK15331165 chaperone protein SicA; Provisional 99.32
KOG2003 840 consensus TPR repeat-containing protein [General f 99.3
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.3
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.28
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.28
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.28
PRK14574 822 hmsH outer membrane protein; Provisional 99.28
PRK15331165 chaperone protein SicA; Provisional 99.27
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.26
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.26
PRK14574 822 hmsH outer membrane protein; Provisional 99.25
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 99.25
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.24
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 99.23
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.23
PF1337173 TPR_9: Tetratricopeptide repeat 99.22
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.21
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.21
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.21
PRK10803263 tol-pal system protein YbgF; Provisional 99.21
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.17
PRK10803263 tol-pal system protein YbgF; Provisional 99.17
PRK11906458 transcriptional regulator; Provisional 99.16
PF12688120 TPR_5: Tetratrico peptide repeat 99.16
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.15
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.13
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.13
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.13
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.1
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.1
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.1
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.1
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.09
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.08
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 99.06
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.05
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.05
KOG4234271 consensus TPR repeat-containing protein [General f 99.05
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.02
KOG1128 777 consensus Uncharacterized conserved protein, conta 99.01
KOG2076 895 consensus RNA polymerase III transcription factor 99.01
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.01
PF12688120 TPR_5: Tetratrico peptide repeat 99.01
KOG0495913 consensus HAT repeat protein [RNA processing and m 98.98
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.97
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.97
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 98.96
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.96
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.96
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.94
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.94
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 98.94
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 98.93
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.93
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.93
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.93
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.91
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.91
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.9
PF13512142 TPR_18: Tetratricopeptide repeat 98.9
KOG4555175 consensus TPR repeat-containing protein [Function 98.89
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.88
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.88
COG4700251 Uncharacterized protein conserved in bacteria cont 98.87
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.87
PRK11906458 transcriptional regulator; Provisional 98.85
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.85
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.84
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.84
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.84
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.83
KOG4555175 consensus TPR repeat-containing protein [Function 98.81
KOG3785 557 consensus Uncharacterized conserved protein [Funct 98.8
PF1337173 TPR_9: Tetratricopeptide repeat 98.8
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.8
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.8
KOG4234271 consensus TPR repeat-containing protein [General f 98.77
PLN03218 1060 maturation of RBCL 1; Provisional 98.74
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.74
PLN03218 1060 maturation of RBCL 1; Provisional 98.74
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.71
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.71
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.71
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.7
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 98.7
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.7
PF1342844 TPR_14: Tetratricopeptide repeat 98.69
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 98.68
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.67
KOG3785 557 consensus Uncharacterized conserved protein [Funct 98.65
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.62
PF13512142 TPR_18: Tetratricopeptide repeat 98.6
PF1343134 TPR_17: Tetratricopeptide repeat 98.52
PF1343134 TPR_17: Tetratricopeptide repeat 98.52
COG4700251 Uncharacterized protein conserved in bacteria cont 98.49
PLN03077857 Protein ECB2; Provisional 98.49
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.46
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.46
PLN03077 857 Protein ECB2; Provisional 98.44
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.42
KOG1586288 consensus Protein required for fusion of vesicles 98.42
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.41
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 98.41
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.41
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 98.38
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.38
KOG1915677 consensus Cell cycle control protein (crooked neck 98.38
PRK04841 903 transcriptional regulator MalT; Provisional 98.36
PF1342844 TPR_14: Tetratricopeptide repeat 98.34
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 98.34
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.33
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.32
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.32
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 98.32
PRK04841 903 transcriptional regulator MalT; Provisional 98.31
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.29
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.25
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.25
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 98.24
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 98.23
KOG1915 677 consensus Cell cycle control protein (crooked neck 98.22
PF03704146 BTAD: Bacterial transcriptional activator domain; 98.22
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.21
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.17
COG2976207 Uncharacterized protein conserved in bacteria [Fun 98.15
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 98.1
KOG2610 491 consensus Uncharacterized conserved protein [Funct 98.08
PF13281374 DUF4071: Domain of unknown function (DUF4071) 98.06
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.06
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.04
KOG2471 696 consensus TPR repeat-containing protein [General f 98.03
KOG2471 696 consensus TPR repeat-containing protein [General f 98.01
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.99
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.99
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.99
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.95
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.93
KOG1585308 consensus Protein required for fusion of vesicles 97.9
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 97.83
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.82
KOG2610 491 consensus Uncharacterized conserved protein [Funct 97.81
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 97.78
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.78
KOG1586288 consensus Protein required for fusion of vesicles 97.76
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.74
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.69
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.68
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 97.68
KOG2047 835 consensus mRNA splicing factor [RNA processing and 97.67
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.66
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.65
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.65
PRK10941269 hypothetical protein; Provisional 97.64
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.64
KOG1585308 consensus Protein required for fusion of vesicles 97.57
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 97.56
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.54
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 97.53
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.51
KOG2047 835 consensus mRNA splicing factor [RNA processing and 97.5
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.46
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.46
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.41
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.37
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 97.35
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 97.34
KOG1550552 consensus Extracellular protein SEL-1 and related 97.33
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 97.31
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.27
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.25
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.25
COG4976287 Predicted methyltransferase (contains TPR repeat) 97.24
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 97.23
KOG2300629 consensus Uncharacterized conserved protein [Funct 97.16
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.16
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.15
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 97.12
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 97.05
KOG2300629 consensus Uncharacterized conserved protein [Funct 97.05
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.05
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.04
COG3898 531 Uncharacterized membrane-bound protein [Function u 97.0
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.98
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.95
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.87
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 96.84
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.82
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.81
KOG4507886 consensus Uncharacterized conserved protein, conta 96.81
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 96.81
PF09986214 DUF2225: Uncharacterized protein conserved in bact 96.74
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.7
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 96.68
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.66
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 96.65
COG3898531 Uncharacterized membrane-bound protein [Function u 96.63
PRK10941269 hypothetical protein; Provisional 96.59
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.58
KOG3364149 consensus Membrane protein involved in organellar 96.57
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.54
KOG4814 872 consensus Uncharacterized conserved protein [Funct 96.49
KOG4507886 consensus Uncharacterized conserved protein, conta 96.49
KOG1550 552 consensus Extracellular protein SEL-1 and related 96.41
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 96.28
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 96.28
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.25
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 96.25
KOG1310 758 consensus WD40 repeat protein [General function pr 96.06
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 96.03
COG2912269 Uncharacterized conserved protein [Function unknow 96.01
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 95.93
PF1286294 Apc5: Anaphase-promoting complex subunit 5 95.92
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 95.91
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 95.88
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 95.82
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 95.69
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 95.67
KOG3364149 consensus Membrane protein involved in organellar 95.64
PF1286294 Apc5: Anaphase-promoting complex subunit 5 95.64
COG3629280 DnrI DNA-binding transcriptional activator of the 95.61
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 95.56
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 95.46
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 95.42
KOG1310 758 consensus WD40 repeat protein [General function pr 95.4
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 95.27
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 95.26
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 95.24
COG4976 287 Predicted methyltransferase (contains TPR repeat) 95.12
KOG2581 493 consensus 26S proteasome regulatory complex, subun 95.09
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 95.09
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.08
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 95.06
KOG4814 872 consensus Uncharacterized conserved protein [Funct 95.06
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.02
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 94.92
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 94.91
COG3629280 DnrI DNA-binding transcriptional activator of the 94.84
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.83
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.79
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 94.72
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 94.72
KOG4014248 consensus Uncharacterized conserved protein (conta 94.65
KOG1258 577 consensus mRNA processing protein [RNA processing 94.55
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 94.52
KOG0530318 consensus Protein farnesyltransferase, alpha subun 94.43
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 94.4
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 94.37
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 94.36
COG5191 435 Uncharacterized conserved protein, contains HAT (H 94.36
KOG2041 1189 consensus WD40 repeat protein [General function pr 94.35
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 94.27
KOG1258577 consensus mRNA processing protein [RNA processing 93.99
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 93.98
KOG2041 1189 consensus WD40 repeat protein [General function pr 93.97
COG3947361 Response regulator containing CheY-like receiver a 93.93
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 93.93
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 93.92
COG4455273 ImpE Protein of avirulence locus involved in tempe 93.92
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 93.72
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 93.68
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 93.68
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 93.56
COG5191 435 Uncharacterized conserved protein, contains HAT (H 93.32
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 93.23
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 93.23
COG3947361 Response regulator containing CheY-like receiver a 93.04
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 92.91
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 92.83
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 92.77
COG2912269 Uncharacterized conserved protein [Function unknow 92.76
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 92.61
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 92.48
KOG2422 665 consensus Uncharacterized conserved protein [Funct 92.03
PF1285434 PPR_1: PPR repeat 91.92
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 91.86
KOG0529 421 consensus Protein geranylgeranyltransferase type I 91.85
COG5159 421 RPN6 26S proteasome regulatory complex component [ 91.83
PF1304150 PPR_2: PPR repeat family 91.65
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 91.52
PF1285434 PPR_1: PPR repeat 91.51
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 91.47
KOG3616 1636 consensus Selective LIM binding factor [Transcript 91.36
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 91.1
COG4649221 Uncharacterized protein conserved in bacteria [Fun 91.04
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 90.86
KOG3616 1636 consensus Selective LIM binding factor [Transcript 90.81
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 90.63
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 90.29
KOG2422 665 consensus Uncharacterized conserved protein [Funct 90.28
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 90.22
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 90.18
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 90.06
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 89.96
PHA02537230 M terminase endonuclease subunit; Provisional 89.95
COG1747 711 Uncharacterized N-terminal domain of the transcrip 89.87
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 89.49
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 89.13
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 89.05
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 88.92
smart00299140 CLH Clathrin heavy chain repeat homology. 88.81
KOG0686 466 consensus COP9 signalosome, subunit CSN1 [Posttran 88.5
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 88.23
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 88.15
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 87.79
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 87.73
KOG1497 399 consensus COP9 signalosome, subunit CSN4 [Posttran 87.68
KOG2581493 consensus 26S proteasome regulatory complex, subun 87.63
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 87.34
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 87.28
PF1304150 PPR_2: PPR repeat family 86.93
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 86.14
KOG0687393 consensus 26S proteasome regulatory complex, subun 84.76
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 84.51
KOG2561 568 consensus Adaptor protein NUB1, contains UBA domai 84.25
KOG3783 546 consensus Uncharacterized conserved protein [Funct 84.19
PF09797365 NatB_MDM20: N-acetyltransferase B complex (NatB) n 84.11
COG4649221 Uncharacterized protein conserved in bacteria [Fun 83.98
PF05053 618 Menin: Menin; InterPro: IPR007747 MEN1, the gene r 83.53
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 83.42
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 83.33
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 83.2
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 82.78
cd0268075 MIT_calpain7_2 MIT: domain contained within Microt 82.43
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 82.0
cd0268075 MIT_calpain7_2 MIT: domain contained within Microt 81.25
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 80.62
TIGR03362301 VI_chp_7 type VI secretion-associated protein, VC_ 80.27
KOG4014248 consensus Uncharacterized conserved protein (conta 80.17
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
Probab=99.87  E-value=1.6e-20  Score=130.83  Aligned_cols=129  Identities=24%  Similarity=0.285  Sum_probs=123.9

Q ss_pred             chHHHHHhcCCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHccCHHHHHHHHHHHHccCCCCHHHHHHHHHHHHHhcCH
Q 040667            2 SLARSAYNRGGYETSKILWEAAMALSSLYPDGWFALGAAALKARDVEKALDGFTRAVQLDPDNGEAWNNIACLHMIKKKS   81 (207)
Q Consensus         2 ~la~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~a~~~~p~~~~~~~~l~~~~~~~~~~   81 (207)
                      .||..|+..|++..|.+-++++++.+|++..+|..++.+|.+.|+.+.|.+.|++++.++|+++++++|.|..++.+|++
T Consensus        40 qLal~YL~~gd~~~A~~nlekAL~~DPs~~~a~~~~A~~Yq~~Ge~~~A~e~YrkAlsl~p~~GdVLNNYG~FLC~qg~~  119 (250)
T COG3063          40 QLALGYLQQGDYAQAKKNLEKALEHDPSYYLAHLVRAHYYQKLGENDLADESYRKALSLAPNNGDVLNNYGAFLCAQGRP  119 (250)
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHhCcccHHHHHHHHHHHHHcCChhhHHHHHHHHHhcCCCccchhhhhhHHHHhCCCh
Confidence            37889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHh-------cHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcccc
Q 040667           82 KEAFIAFKEAL-------YWQLWENYSHVALDVGNIGQALEAVQMVLNMTNNKRID  130 (207)
Q Consensus        82 ~~A~~~~~~~~-------~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~  130 (207)
                      ++|...|++++       ....|.++|.|..+.|+++.|..+|+++++++|+.+..
T Consensus       120 ~eA~q~F~~Al~~P~Y~~~s~t~eN~G~Cal~~gq~~~A~~~l~raL~~dp~~~~~  175 (250)
T COG3063         120 EEAMQQFERALADPAYGEPSDTLENLGLCALKAGQFDQAEEYLKRALELDPQFPPA  175 (250)
T ss_pred             HHHHHHHHHHHhCCCCCCcchhhhhhHHHHhhcCCchhHHHHHHHHHHhCcCCChH
Confidence            99999999999       77899999999999999999999999999999984433



>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02537 M terminase endonuclease subunit; Provisional Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09797 NatB_MDM20: N-acetyltransferase B complex (NatB) non catalytic subunit; InterPro: IPR019183 This is the non-catalytic subunit of the N-terminal acetyltransferase B complex (NatB) Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05053 Menin: Menin; InterPro: IPR007747 MEN1, the gene responsible for multiple endocrine neoplasia type 1, is a tumour suppressor gene that encodes a protein called Menin which may be an atypical GTPase stimulated by nm23 [] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>TIGR03362 VI_chp_7 type VI secretion-associated protein, VC_A0119 family Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 3e-08
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 6e-08
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 1e-07
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 2e-06
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 5e-06
3pe3_A 723 Structure Of Human O-Glcnac Transferase And Its Com 7e-06
2avp_A70 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 8e-05
2j9q_A328 A Novel Conformation For The Tpr Domain Of Pex5p Le 2e-04
2c0l_A305 Tpr Domain Of Human Pex5p In Complex With Human Msc 2e-04
2c0m_A319 Apo Form Of The Tpr Domain Of The Pex5p Receptor Le 2e-04
3r9a_B328 Human Alanine-Glyoxylate Aminotransferase In Comple 3e-04
1fch_A368 Crystal Structure Of The Pts1 Complexed To The Tpr 3e-04
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure

Iteration: 1

Score = 54.7 bits (130), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 31/111 (27%), Positives = 60/111 (54%), Gaps = 2/111 (1%) Query: 2 SLARSAYNRGGYETSKILWEAAMALSSLYPDGWFALGAAALKARDVEKALDGFTRAVQLD 61 +L + Y +G Y+ + ++ A+ L + W+ LG A K D ++A++ + +A++LD Sbjct: 14 NLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELD 73 Query: 62 PDNGEAWNNIACLHMIKKKSKEAFIAFKEALYWQLWENYSHVALDVGNIGQ 112 P+N EAW N+ + + EA +++AL +L N + ++GN Q Sbjct: 74 PNNAEAWYNLGNAYYKQGDYDEAIEYYQKAL--ELDPNNAEAKQNLGNAKQ 122
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|3PE3|A Chain A, Structure Of Human O-Glcnac Transferase And Its Complex With A Peptide Substrate Length = 723 Back     alignment and structure
>pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix Length = 70 Back     alignment and structure
>pdb|2J9Q|A Chain A, A Novel Conformation For The Tpr Domain Of Pex5p Length = 328 Back     alignment and structure
>pdb|2C0L|A Chain A, Tpr Domain Of Human Pex5p In Complex With Human Mscp2 Length = 305 Back     alignment and structure
>pdb|2C0M|A Chain A, Apo Form Of The Tpr Domain Of The Pex5p Receptor Length = 319 Back     alignment and structure
>pdb|3R9A|B Chain B, Human Alanine-Glyoxylate Aminotransferase In Complex With The Tpr Domain Of Human Pex5p Length = 328 Back     alignment and structure
>pdb|1FCH|A Chain A, Crystal Structure Of The Pts1 Complexed To The Tpr Region Of Human Pex5 Length = 368 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-15
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 5e-14
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-04
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-14
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-12
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 7e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 9e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-10
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-10
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-09
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-09
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-14
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-10
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-14
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-13
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-04
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-14
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-10
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-07
4eqf_A365 PEX5-related protein; accessory protein, tetratric 5e-13
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 7e-10
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-08
4eqf_A365 PEX5-related protein; accessory protein, tetratric 7e-05
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-04
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 1e-04
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 9e-13
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-09
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-08
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-12
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-11
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-12
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 6e-11
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-10
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-09
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-09
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-08
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-06
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-05
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-12
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-11
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-11
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-09
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 8e-09
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-07
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-07
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-06
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-12
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 6e-11
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 6e-09
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 8e-09
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 3e-07
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 6e-07
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-12
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-10
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 9e-10
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 1e-09
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-09
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-09
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-09
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 5e-09
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-08
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-08
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 7e-08
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 7e-12
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-08
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-06
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 8e-12
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-11
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-11
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-11
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-09
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-08
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-08
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-08
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-07
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-05
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-11
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 9e-10
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-08
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-11
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-11
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-10
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-09
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-08
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-07
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-07
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-11
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 4e-07
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-11
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-07
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-11
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-09
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-09
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-08
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-08
2gw1_A 514 Mitochondrial precursor proteins import receptor; 5e-08
2gw1_A 514 Mitochondrial precursor proteins import receptor; 6e-08
2gw1_A514 Mitochondrial precursor proteins import receptor; 9e-06
2gw1_A 514 Mitochondrial precursor proteins import receptor; 2e-05
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-11
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-10
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 8e-10
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 3e-08
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 4e-11
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 6e-07
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 5e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 7e-11
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-09
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 6e-09
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-08
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-08
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-05
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 8e-11
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-09
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 8e-09
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 8e-10
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-09
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 6e-09
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-06
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-06
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-04
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-09
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-08
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 6e-08
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 9e-07
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-09
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-09
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-09
3u4t_A272 TPR repeat-containing protein; structural genomics 7e-09
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-05
3u4t_A272 TPR repeat-containing protein; structural genomics 5e-05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 3e-09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 9e-08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-07
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-06
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 5e-09
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-07
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 5e-07
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-06
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-06
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 5e-05
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 6e-09
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 1e-06
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 6e-09
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-08
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-08
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-08
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-06
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-06
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 5e-08
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 7e-08
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 4e-04
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 8e-08
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 5e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 8e-08
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-07
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-07
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 9e-08
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 9e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-04
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-07
4g1t_A 472 Interferon-induced protein with tetratricopeptide 3e-06
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-05
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 5e-07
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 9e-05
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 4e-06
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 4e-06
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 4e-05
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 7e-04
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 7e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 8e-06
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 3e-05
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 3e-04
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 6e-05
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 9e-05
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 3e-04
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 1e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 1e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-04
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-04
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 3e-04
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 3e-04
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 8e-04
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 3e-04
3q49_B137 STIP1 homology and U box-containing protein 1; E3 4e-04
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
 Score = 69.8 bits (171), Expect = 1e-15
 Identities = 23/116 (19%), Positives = 39/116 (33%), Gaps = 2/116 (1%)

Query: 3   LARSAYNRGGYETSKILWEAAMALSSLYPDGWFALGAAALKARDVEKALDGFTRAVQLDP 62
           L  + Y  G ++ ++ +++A   L       +  LGA        E+AL  ++    +D 
Sbjct: 24  LGFNQYQAGKWDDAQKIFQALCMLDHYDARYFLGLGACRQSLGLYEQALQSYSYGALMDI 83

Query: 63  DNGEAWNNIACLHMIKKKSKEAFIAFKEALYWQLWENYSHVALDVGNIGQALEAVQ 118
           +      + A  H+       A   F  A    L              G  LEAV 
Sbjct: 84  NEPRFPFHAAECHLQLGDLDGAESGFYSAR--ALAAAQPAHEALAARAGAMLEAVT 137


>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Length = 1630 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query207
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.89
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.89
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.89
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.89
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.88
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.85
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.85
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.85
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.85
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.85
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.85
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.85
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.83
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.82
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.82
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.82
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.82
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.81
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.81
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.8
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.8
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.79
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.79
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.79
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.79
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.79
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.79
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.79
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.79
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.79
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.78
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.78
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.78
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.77
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.77
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.77
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.77
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.77
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.77
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.77
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.77
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.77
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.77
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.77
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.76
3u4t_A272 TPR repeat-containing protein; structural genomics 99.76
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.76
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.75
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.75
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.75
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.75
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.75
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.75
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.74
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.74
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.74
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.74
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.74
3u4t_A272 TPR repeat-containing protein; structural genomics 99.73
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.73
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.73
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.73
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.73
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.72
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.72
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.72
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.72
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.72
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.72
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.72
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.72
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.72
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.72
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.71
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.71
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.71
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.71
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.71
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.7
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.7
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.7
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.7
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.7
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.7
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.69
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.69
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.69
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.69
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.69
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.69
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.68
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.68
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.68
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.67
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.67
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.67
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.67
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.66
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.66
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.66
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.66
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.65
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.65
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.65
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.65
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.65
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.65
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.65
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.64
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.64
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.64
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.63
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.63
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.63
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.63
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.63
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.63
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.63
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.63
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.63
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.62
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.62
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.62
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.62
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.62
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.62
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.62
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.62
3k9i_A117 BH0479 protein; putative protein binding protein, 99.62
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.61
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.61
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.61
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.61
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.6
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.6
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.6
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.59
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.59
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.59
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.58
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.58
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.58
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.58
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.58
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.58
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.57
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.57
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 99.57
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.56
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.56
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.56
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.54
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.54
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.53
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.53
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.52
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.52
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.5
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.5
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.49
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.49
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.48
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.47
3k9i_A117 BH0479 protein; putative protein binding protein, 99.47
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.47
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.47
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.46
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.46
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.44
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.44
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.43
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 99.41
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.41
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.4
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.4
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.4
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.4
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.4
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.4
1klx_A138 Cysteine rich protein B; structural genomics, heli 99.4
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.39
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.39
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.37
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.36
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.36
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.36
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 99.34
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.31
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.26
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 99.26
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.26
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.25
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.23
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.19
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.18
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.13
1klx_A138 Cysteine rich protein B; structural genomics, heli 99.12
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.06
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 99.03
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.99
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.98
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.97
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.97
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.96
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.93
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.9
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.89
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.88
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.88
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.87
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.79
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.77
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.71
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.66
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.62
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 98.61
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.57
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.47
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.45
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.45
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.34
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.22
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.19
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.07
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.04
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.01
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 97.99
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.82
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.76
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.68
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.57
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 97.46
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 97.34
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 97.31
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 97.25
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.14
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 97.1
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 97.04
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 97.0
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.89
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.72
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.7
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 96.69
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 96.65
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 96.56
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 96.53
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.5
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 96.36
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 96.19
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 96.06
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 95.98
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 95.81
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 95.79
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 95.78
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 95.33
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 94.73
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 93.33
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 93.01
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 92.91
4gq2_M950 Nucleoporin NUP120; beta propeller alpha helical, 92.79
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 92.35
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 92.01
4gq2_M950 Nucleoporin NUP120; beta propeller alpha helical, 91.66
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 89.1
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 87.77
3re2_A472 Predicted protein; menin, multiple endocrine neopl 87.68
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 86.67
3u84_A 550 Menin; MLL, JUND, ledgf, TPR, transglutaminase-lik 86.64
3ax2_A73 Mitochondrial import receptor subunit TOM20 homol; 86.4
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 85.41
2v6y_A83 AAA family ATPase, P60 katanin; MIT, VPS4, archaea 82.1
2rpa_A78 Katanin P60 ATPase-containing subunit A1; AAA ATPa 81.87
4gq4_A489 Menin; tumor suppressor, nucleus, transcription-tr 80.74
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
Probab=99.89  E-value=2.3e-23  Score=141.25  Aligned_cols=127  Identities=8%  Similarity=0.033  Sum_probs=116.5

Q ss_pred             chHHHHHhcCCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHccCHHHHHHHHHHHHccCCCCHHHHHHHHHHHHHhcCH
Q 040667            2 SLARSAYNRGGYETSKILWEAAMALSSLYPDGWFALGAAALKARDVEKALDGFTRAVQLDPDNGEAWNNIACLHMIKKKS   81 (207)
Q Consensus         2 ~la~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~a~~~~p~~~~~~~~l~~~~~~~~~~   81 (207)
                      .||.++...|++++|+..+++++..+|+++..++.+|.+|+..|++++|+..|+++++++|+++.+|..+|.++...|++
T Consensus         2 ~LG~~~~~~~~~e~ai~~~~~a~~~~p~~~~~~~~la~~y~~~~~~~~A~~~~~~al~~~p~~~~a~~~lg~~~~~~~~~   81 (150)
T 4ga2_A            2 PLGSMRRSKADVERYIASVQGSTPSPRQKSIKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENT   81 (150)
T ss_dssp             -----CCCHHHHHHHHHHHHHHSCSHHHHHTTHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCH
T ss_pred             HhHHHHHHcChHHHHHHHHHHhcccCcccHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCch
Confidence            47889999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHh-----cHHHHHHHHHHHHHcCCHHHHHHH-HHHHHhcCCCcc
Q 040667           82 KEAFIAFKEAL-----YWQLWENYSHVALDVGNIGQALEA-VQMVLNMTNNKR  128 (207)
Q Consensus        82 ~~A~~~~~~~~-----~~~~~~~l~~~~~~~~~~~~A~~~-~~~al~~~p~~~  128 (207)
                      ++|+..|++++     +..+++.+|.++...|++++|... ++++++++|+++
T Consensus        82 ~~A~~~~~~al~~~p~~~~~~~~la~~~~~~~~~~~aa~~~~~~al~l~P~~~  134 (150)
T 4ga2_A           82 DKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSP  134 (150)
T ss_dssp             HHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHCSSSSHHHHHHHHHHHHSTTCH
T ss_pred             HHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHHHhCcCCH
Confidence            99999999999     889999999999999999887765 589999999743



>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>3re2_A Predicted protein; menin, multiple endocrine neoplasia 1, tumor suppressor, MIX lineage leukemia, unknown function; 1.95A {Nematostella vectensis} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3u84_A Menin; MLL, JUND, ledgf, TPR, transglutaminase-like, transcription, epigenetics, cancer; 2.50A {Homo sapiens} PDB: 3u85_A 3u86_A 3u88_A* Back     alignment and structure
>3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* Back     alignment and structure
>2rpa_A Katanin P60 ATPase-containing subunit A1; AAA ATPase, ATP-binding, cell cycle, cell division, cytoplas hydrolase, microtubule; NMR {Mus musculus} Back     alignment and structure
>4gq4_A Menin; tumor suppressor, nucleus, transcription-transcription inhib complex; HET: 0RT EPE PE4; 1.27A {Homo sapiens} PDB: 4gq3_A* 4gpq_A* 4gq6_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 207
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 9e-11
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-10
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-09
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-09
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-08
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 9e-06
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 6e-09
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 1e-07
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 9e-06
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 4e-05
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 8e-05
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 5e-04
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 1e-04
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 1e-04
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 1e-04
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 1e-04
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 3e-04
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 0.001
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 0.001
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 0.001
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 0.003
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 57.8 bits (138), Expect = 9e-11
 Identities = 25/126 (19%), Positives = 52/126 (41%), Gaps = 5/126 (3%)

Query: 3   LARSAYNRGGYETSKILWEAAMALSSLYPDGWFALGAAALKARDVEKALDGFTRAVQLDP 62
           L         ++ +   +  A++LS  +      L     +   ++ A+D + RA++L P
Sbjct: 209 LGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQP 268

Query: 63  DNGEAWNNIACLHMIKKKSKEAFIAFKEAL-----YWQLWENYSHVALDVGNIGQALEAV 117
              +A+ N+A     K    EA   +  AL     +     N +++  + GNI +A+   
Sbjct: 269 HFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLY 328

Query: 118 QMVLNM 123
           +  L +
Sbjct: 329 RKALEV 334


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query207
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.87
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.85
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.83
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.82
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.81
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.8
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.78
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.78
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.77
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.77
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.76
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.74
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.73
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.72
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.72
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.7
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.67
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.66
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.66
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.66
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.64
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.64
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.63
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.59
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.58
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.58
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.56
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.55
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.54
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.54
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.51
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.48
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.48
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.48
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.44
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.43
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.42
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 99.35
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.32
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.27
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.25
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.21
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.1
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.09
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.06
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.9
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.8
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.58
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.57
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.43
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.42
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.23
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.39
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 94.99
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 94.69
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 86.38
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 84.87
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 80.87
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 80.13
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Lipoprotein NlpI
species: Escherichia coli [TaxId: 562]
Probab=99.87  E-value=8.8e-21  Score=137.24  Aligned_cols=127  Identities=15%  Similarity=0.096  Sum_probs=120.6

Q ss_pred             chHHHHHhcCCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHccCHHHHHHHHHHHHccCCCCHHHHHHHHHHHHHhcCH
Q 040667            2 SLARSAYNRGGYETSKILWEAAMALSSLYPDGWFALGAAALKARDVEKALDGFTRAVQLDPDNGEAWNNIACLHMIKKKS   81 (207)
Q Consensus         2 ~la~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~a~~~~p~~~~~~~~l~~~~~~~~~~   81 (207)
                      .+|.+|...|++++|+..|++++.++|+++.+|..+|.++..+|++++|+..|++++.++|+++.++.++|.++..+|++
T Consensus        42 ~~G~~y~~~g~~~~A~~~~~~al~l~p~~~~a~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~lg~~~~~~g~~  121 (259)
T d1xnfa_          42 ERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTYNYAHLNRGIALYYGGRD  121 (259)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCTHHHHHHHHHHHHTTCH
T ss_pred             HHHHHHHHCCCHHHHHHHHHHhhccCCCCHHHHhhhchHHHHHHHHHHhhhhhhHHHHHHhhhhhhHHHHHHHHHHHhhH
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHh---------------------------------------------------------------------
Q 040667           82 KEAFIAFKEAL---------------------------------------------------------------------   92 (207)
Q Consensus        82 ~~A~~~~~~~~---------------------------------------------------------------------   92 (207)
                      ++|+..|++++                                                                     
T Consensus       122 ~~A~~~~~~al~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  201 (259)
T d1xnfa_         122 KLAQDDLLAFYQDDPNDPFRSLWLYLAEQKLDEKQAKEVLKQHFEKSDKEQWGWNIVEFYLGNISEQTLMERLKADATDN  201 (259)
T ss_dssp             HHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHSCCCSTHHHHHHHHTTSSCHHHHHHHHHHHCCSH
T ss_pred             HHHHHHHHHHHhhccccHHHHHHHHHHHHHhhhHHHHHHHHHHhhccchhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            99999999877                                                                     


Q ss_pred             ------cHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcc
Q 040667           93 ------YWQLWENYSHVALDVGNIGQALEAVQMVLNMTNNKR  128 (207)
Q Consensus        93 ------~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~  128 (207)
                            ...+++.+|.++...|++++|+.+|++++..+|++.
T Consensus       202 ~~~~~~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~  243 (259)
T d1xnfa_         202 TSLAEHLSETNFYLGKYYLSLGDLDSATALFKLAVANNVHNF  243 (259)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHTTCCTTC
T ss_pred             hhcCcccHHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCCCCH
Confidence                  445788899999999999999999999999999743



>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure