Citrus Sinensis ID: 040739

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590----

MDRTRLNIRARCSGSTPSEESALDFERNCCSHPNLPSLSPPTLQPFASAGQHCESNAAYFSWPTSSRLSDAAEERANYFANLQKGVLPETLGQLPKGQQATTLLELMTIRAFHSKILRCYSLGTAIGFRIKRGVLTDIPAILVFVSRKVHKQWLSPIQCLPTALEGPGGVWCDVDVVEFSYFGAPEPTPKEQLYTQIVDDLRGGDPSIGSGSQVASQETYGTLGAIVKSQTGSRQVGFLTNRHVAVDLDYPNQKMFHPLPPTLGPGVYLGAVERATSFHHRRPLTFVRADGAFIPFADDFDMSTVTTSVKGLGEIGDVKIVDLQSPISSLIGKQVVKVGRSSGLTTGTVLAYALEYNDEKGICFLTDFLVVGENQQTFDLEGDSGSLILMKGENGEKPRPIGIIWGGTANRGRLKLKIGQPPENWTSGVDLGRLLNLLELDLITTDEGLKVAVQEQRAASATAIGSTVGDSSPPDGMHLKDKAEDKFEPLGLQIQHIPVEVEHHSPETNPSLMETEFHLEDGVKAGPSVELQFIPSFTGHSPLHQNNPSDKASSENLASLWNGCDEDICFSLQLGDNEAKRRRSDASTSKEESK

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEcccccccccEEEEEEccccccccccccccccccccccccEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEcccccEEEEEEccEEEEcccccccccccccccccccccccccccEEcccccccEEEEEcccccEEEcccccccccEEcccccccccccEEEccccccccccccccEEEEEEccccEEEEEEEEEEEEEccccEEEEEEEEEEccccccccccccccEEEEEcccccccccEEEEEEEccccccccccccccccccccccccHHHHHHHcccEEEEccHHHHHHHHHHHHccEEcccccccccccccccccccHHHHcccccccccccccccccccccccccccccccEEEcccccccccccEEEccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccccc

cccccccHHHHccccccccccHHcHHcccccccccccccccccccccccccccccccEEEEcccccHcccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEccccccccEEEEEEEccccHHcccHHHcccHHHcccccEEEEEEEEEEcccccccccccccccHHHHccccccccccccccccccccccccEEEEEEEcccccEEEEEEccEEEEEccccccccccccccccccccccccccccccccccccccEEcccccEEEcccccccccccccEcccccccccEEEcccccHHHHHcccEEEEccccccccEEEEEEEEEEcccccEEEEEEEEEEccccccccccccccEEEEEEccccccccEEEEEEEccccccEEEEEcccccccccccccHHHHHHHccccEEcccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHccccccEEEEEcccccccccccccccccccEEEcccccccccEEEEEccccccccccccccccccccHHHHHHccccccccEEEEEEccccccccccccccccccccc

mdrtrlnirarcsgstpseesaLDFErnccshpnlpslspptlqpfasagqhcesnaayfswptssrlsDAAEERANYFANLqkgvlpetlgqlpkgqqATTLLELMTIRAFHSKILRCYSLGTAIGFRikrgvltdipAILVFVSRKVHkqwlspiqclptalegpggvwcdvdvvefsyfgapeptpkeqLYTQIVDdlrggdpsigsgsqvasqETYGTLGAIVksqtgsrqvgfltnrhvavdldypnqkmfhplpptlgpgvylGAVEratsfhhrrpltfvradgafipfaddfdmstvttsvkglgeigdvkivdlqspissligkQVVKvgrssglttGTVLAYALEyndekgicfLTDFLvvgenqqtfdlegdsgslilmkgengekprpigiiwggtanrgrlklkigqppenwtsgvdlGRLLNLLELDLITTDEGLKVAVQEQRAASATaigstvgdssppdgmhlkdkaedkfeplglqiqhipvevehhspetnpslmetefhledgvkagpsvelqfipsftghsplhqnnpsdkasseNLASlwngcdedicfslqlgdneakrrrsdastskeesk

mdrtrlnirarcsgstpseesALDFERNCCSHPNLPSLSPPTLQPFASAGQHCESNAAYFSWPTSSRLSDAAEERANYFANLQKGVLPETLGQLPKGQQATTLLELMTIRAFHSKILRCYSLGTAIGFRIKRGVLTDIPAILVFVSRKVHKQWLSPIQCLPTALEGPGGVWCDVDVVEFSYfgapeptpkEQLYTQIVDDLRGGDPSIGSGSQVASQETYGTLGAIVKSQTGSRQVGFLTNRHVAVDLDYPNQKMFHPLPPTLGPGVYLGAVERATSFHHRRPLTFVRADGAFIPFADDFDMSTVTTSVKGLGEIGDVKIVDLQSPISSLIGKQVVKVGRSSGLTTGTVLAYALEYNDEKGICFLTDFLVVGENQQTFDLEGDSGSLILMKGengekprpigIIWGGTANRGRLKLKIGQPPENWTSGVDLGRLLNLLELDLITTDEGLKVAVQEQRAASataigstvgdssppDGMHLKDKAEDKFEPLGLQIQHIPVEVEHHSPETNPSLMETEFHLEDGVKAGPSVELQFIPSFTGHSPLHQNNPSDKASSENLASLWNGCDEDICFSLqlgdneakrrrsdastskeesk

MDRTRLNIRARCSGSTPSEESALDFERNCCSHPNLPSLSPPTLQPFASAGQHCESNAAYFSWPTSSRLSDAAEERANYFANLQKGVLPETLGQLPKGQQATTLLELMTIRAFHSKILRCYSLGTAIGFRIKRGVLTDIPAILVFVSRKVHKQWLSPIQCLPTALEGPGGVWCDVDVVEFSYFGAPEPTPKEQLYTQIVDDLRGGDPSIGSGSQVASQETYGTLGAIVKSQTGSRQVGFLTNRHVAVDLDYPNQKMFHPLPPTLGPGVYLGAVERATSFHHRRPLTFVRADGAFIPFADDFDMSTVTTSVKGLGEIGDVKIVDLQSPISSLIGKQVVKVGRSSGLTTGTVLAYALEYNDEKGICFLTDFLVVGENQQTFDLEGDSGSLILMKGENGEKPRPIGIIWGGTANRGRLKLKIGQPPENWTSGVDlgrllnlleldlittdeglKVAVQEQRAASATAIGSTVGDSSPPDGMHLKDKAEDKFEPLGLQIQHIPVEVEHHSPETNPSLMETEFHLEDGVKAGPSVELQFIPSFTGHSPLHQNNPSDKASSENLASLWNGCDEDICFSLQLGDNEAKRRRSDASTSKEESK

********************************************************AAYFSW*************ANYFANLQKGVLPETLGQLPKGQQATTLLELMTIRAFHSKILRCYSLGTAIGFRIKRGVLTDIPAILVFVSRKVHKQWLSPIQCLPTALEGPGGVWCDVDVVEFSYFGAP******QLYTQIVD*******************TYGTLGAIVKSQTGSRQVGFLTNRHVAVDLDYPNQKMFHPLPPTLGPGVYLGAVERATSFHHRRPLTFVRADGAFIPFADDFDMSTVTTSVKGLGEIGDVKIVDLQSPISSLIGKQVVKVGRSSGLTTGTVLAYALEYNDEKGICFLTDFLVVGENQQTFDLEGDSGSLILMK*******RPIGIIWGGTANRGRLKLKIGQPPENWTSGVDLGRLLNLLELDLITTDEGLKVAV********************************************************************************************************ASLWNGCDEDICFSLQL********************

***********************************************SAGQHCESNAAYFSWPTSSRL**AAEERANYFANLQKGVL************ATTLLELMTIRAFHSKILRCYSLGTAIGFRIKRGVLTDIPAILVFVSRKVHKQWLSPIQCLPTALEGPGGVWCDVDVVEFSYFGAPEPTP***LYTQIVDDLRGGDPSIGSGSQVASQETYGTLGAIVKSQTGSRQVGFLTNRHVAVDLDYPNQKMFHPLPPTLGPGVYLGAVERATSFHHRRPLTFVRADGAFIPFADDFDMSTVTTSVKGLGEIGDVKIVDLQSPISSLIGKQVVKVGRSSGLTTGTVLAYALEYNDEKGICFLTDFLVVGENQQT***EGDSGSLILMKGENGEKPRPIGIIWGGTANRGRLKLKIGQPPENWTSGVDLGRLLNLLELDLITTDEGLKVAVQEQRAASATAIGS**GD**P*DGMHLKDKAEDKFEPLGLQIQ******************ETEFHLEDGVKAGPSVELQFIP****************************CDEDICFSLQ*********************

*************************ERNCCSHPNLPSLSPPTLQPFASAGQHCESNAAYFSWPTSSRLSDAAEERANYFANLQKGVLPETLGQLPKGQQATTLLELMTIRAFHSKILRCYSLGTAIGFRIKRGVLTDIPAILVFVSRKVHKQWLSPIQCLPTALEGPGGVWCDVDVVEFSYFGAPEPTPKEQLYTQIVDDLRGGDPS*********QETYGTLGAIVKSQTGSRQVGFLTNRHVAVDLDYPNQKMFHPLPPTLGPGVYLGAVERATSFHHRRPLTFVRADGAFIPFADDFDMSTVTTSVKGLGEIGDVKIVDLQSPISSLIGKQVVKVGRSSGLTTGTVLAYALEYNDEKGICFLTDFLVVGENQQTFDLEGDSGSLILMKGENGEKPRPIGIIWGGTANRGRLKLKIGQPPENWTSGVDLGRLLNLLELDLITTDEGLKVAVQEQRAASATAIGSTVGDSSPPDGMHLKDKAEDKFEPLGLQIQHIPVEVEHHSPETNPSLMETEFHLEDGVKAGPSVELQFIPSFTGHSPLHQ**********NLASLWNGCDEDICFSLQLGD******************

**********************LDFERNCCSHPNLPSLSPPTLQPFASAGQHCESNAAYFSWPTSSRLSDAAEERANYFANLQKGVLPETLGQLPKGQQATTLLELMTIRAFHSKILRCYSLGTAIGFRIKRGVLTDIPAILVFVSRKVHKQWLSPIQCLPTALEGPGGVWCDVDVVEFSYFGAPEPTPKEQLYTQIVDDLRGGDPSIGSGSQVASQETYGTLGAIVKSQTGSRQVGFLTNRHVAVDLDYPNQKMFHPLPPTLGPGVYLGAVERATSFHHRRPLTFVRADGAFIPFADDFDMSTVTTSVKGLGEIGDVKIVDLQSPISSLIGKQVVKVGRSSGLTTGTVLAYALEYNDEKGICFLTDFLVVGENQQTFDLEGDSGSLILMKGENGEKPRPIGIIWGGTANRGRLKLKIGQPPENWTSGVDLGRLLNLLELDLITTDEGLKVAVQEQRAASATAIGSTVGDSSPPDGMHLKDKAEDKFEPLGLQIQHIPVEVEHHS***NPSLMETEFHLEDGVKAGPSVELQFIPSFTGHSPL*******KASSENLASLWNGCDEDICFSLQLGD******************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		594
356556958		602	PREDICTED: uncharacterized protein LOC10	0.993	0.980	0.860	0.0
356525782		602	PREDICTED: uncharacterized protein LOC10	0.993	0.980	0.857	0.0
357451853		603	hypothetical protein MTR_2g069500 [Medic	0.993	0.978	0.850	0.0
255544706		600	conserved hypothetical protein [Ricinus	0.993	0.983	0.841	0.0
224117600		597	predicted protein [Populus trichocarpa]	0.988	0.983	0.826	0.0
449453788		601	PREDICTED: uncharacterized protein LOC10	0.994	0.983	0.801	0.0
225462187		603	PREDICTED: uncharacterized protein LOC10	0.991	0.976	0.748	0.0
225423710		596	PREDICTED: uncharacterized protein LOC10	0.979	0.976	0.759	0.0
297737962		684	unnamed protein product [Vitis vinifera]	0.979	0.850	0.759	0.0
255566289		593	conserved hypothetical protein [Ricinus	0.976	0.978	0.741	0.0

>gi\|356556958\|ref\|XP_003546786.1\| PREDICTED: uncharacterized protein LOC100783035 [Glycine max]	Back alignment and taxonomy information

 Score = 1032 bits (2668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/602 (86%), Positives = 550/602 (91%), Gaps = 12/602 (1%)

Query: 1   MDRTRLNIRARCSGSTPSEESALDFERNCCSHPNLPSLSPPTLQPFASAGQHCESNAAYF 60
           M+RTRLN+R RCSGSTPSEESALD ERNCCSH NLPSLSPPTLQPFASAGQHCES+AAYF
Sbjct: 1   MERTRLNMRGRCSGSTPSEESALDLERNCCSHSNLPSLSPPTLQPFASAGQHCESSAAYF 60

Query: 61  SWPTSSRLSDAAEERANYFANLQKGVLPETLGQLPKGQQATTLLELMTIRAFHSKILRCY 120
           SWP  SRL+DAAEERANYF NLQK VLPETLG+LPKG QATTLLELMTIRAFHSKILRCY
Sbjct: 61  SWP--SRLNDAAEERANYFLNLQKEVLPETLGRLPKGHQATTLLELMTIRAFHSKILRCY 118

Query: 121 SLGTAIGFRIKRGVLTDIPAILVFVSRKVHKQWLSPIQCLPTALEGPGGVWCDVDVVEFS 180
           SLGTAIGFRI+RGVLTDIPAILVFVSRKVHKQWLSPIQCLPTALEGPGGVWCDVDVVEFS
Sbjct: 119 SLGTAIGFRIRRGVLTDIPAILVFVSRKVHKQWLSPIQCLPTALEGPGGVWCDVDVVEFS 178

Query: 181 YFGAPEPTPKEQLYTQIVDDLRGGDPSIGSGSQVASQETYGTLGAIVKSQTGSRQVGFLT 240
           YFGAPEP  KEQLYT+IVDDLRGGDP IGSGSQVASQETYGTLGAIVKSQTGSRQVGFLT
Sbjct: 179 YFGAPEPVSKEQLYTEIVDDLRGGDPCIGSGSQVASQETYGTLGAIVKSQTGSRQVGFLT 238

Query: 241 NRHVAVDLDYPNQKMFHPLPPTLGPGVYLGAVERATSFHHRR----------PLTFVRAD 290
           NRHVAVDLDYPNQKMFHPLPPTLGPGVYLGAVERATSF              P TFVRAD
Sbjct: 239 NRHVAVDLDYPNQKMFHPLPPTLGPGVYLGAVERATSFITDELWYGIFAGINPETFVRAD 298

Query: 291 GAFIPFADDFDMSTVTTSVKGLGEIGDVKIVDLQSPISSLIGKQVVKVGRSSGLTTGTVL 350
           GAFIPFADDFDMSTVTTSV+G+G+IGDVKI+DLQ+PISSLIGKQVVKVGRSSGLTTG VL
Sbjct: 299 GAFIPFADDFDMSTVTTSVRGVGDIGDVKIIDLQAPISSLIGKQVVKVGRSSGLTTGVVL 358

Query: 351 AYALEYNDEKGICFLTDFLVVGENQQTFDLEGDSGSLILMKGENGEKPRPIGIIWGGTAN 410
           AYALEYNDEKGICFLTD LVVGENQQTFDLEGDSGSLI++KG+NGEKPRPIGIIWGGTAN
Sbjct: 359 AYALEYNDEKGICFLTDLLVVGENQQTFDLEGDSGSLIMLKGDNGEKPRPIGIIWGGTAN 418

Query: 411 RGRLKLKIGQPPENWTSGVDLGRLLNLLELDLITTDEGLKVAVQEQRAASATAIGSTVGD 470
           RGRLKLK+GQPPENWTSGVDLGRLLNLLELDLITTDEGL+VAVQEQRA SAT IGSTVGD
Sbjct: 419 RGRLKLKVGQPPENWTSGVDLGRLLNLLELDLITTDEGLQVAVQEQRAVSATVIGSTVGD 478

Query: 471 SSPPDGMHLKDKAEDKFEPLGLQIQHIPVEVEHHSPETNPSLMETEFHLEDGVKAGPSVE 530
           SSPPDG+  KDKAEDK+EPLGLQIQ IP+ V   S +  PS+METEF LEDG+K GPS+E
Sbjct: 479 SSPPDGVLPKDKAEDKYEPLGLQIQSIPLGVVPSSQDMKPSIMETEFKLEDGIKVGPSIE 538

Query: 531 LQFIPSFTGHSPLHQNNPSDKASSENLASLWNGCDEDICFSLQLGDNEAKRRRSDASTSK 590
            QFIPSF G SPLH+N+  D+ ++ENL+SL N CDED+C SLQLGDNEAKRRRS+ASTS 
Sbjct: 539 HQFIPSFIGRSPLHKNSIQDRTATENLSSLRNNCDEDLCVSLQLGDNEAKRRRSEASTST 598

Query: 591 EE 592
           EE
Sbjct: 599 EE 600

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356525782\|ref\|XP_003531502.1\| PREDICTED: uncharacterized protein LOC100806376 [Glycine max]	Back alignment and taxonomy information

>gi\|357451853\|ref\|XP_003596203.1\| hypothetical protein MTR_2g069500 [Medicago truncatula] gi\|355485251\|gb\|AES66454.1\| hypothetical protein MTR_2g069500 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|255544706\|ref\|XP_002513414.1\| conserved hypothetical protein [Ricinus communis] gi\|223547322\|gb\|EEF48817.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|224117600\|ref\|XP_002317619.1\| predicted protein [Populus trichocarpa] gi\|222860684\|gb\|EEE98231.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449453788\|ref\|XP_004144638.1\| PREDICTED: uncharacterized protein LOC101217211 [Cucumis sativus] gi\|449504216\|ref\|XP_004162286.1\| PREDICTED: uncharacterized protein LOC101225003 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|225462187\|ref\|XP_002267587.1\| PREDICTED: uncharacterized protein LOC100261226 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225423710\|ref\|XP_002277727.1\| PREDICTED: uncharacterized protein LOC100250825 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297737962\|emb\|CBI27163.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255566289\|ref\|XP_002524131.1\| conserved hypothetical protein [Ricinus communis] gi\|223536598\|gb\|EEF38242.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		594
TAIR\|locus:2155317		607	AT5G45030 [Arabidopsis thalian	0.984	0.963	0.629	4.1e-191
TAIR\|locus:505006292		579	AT2G35155 [Arabidopsis thalian	0.920	0.944	0.639	1.8e-190
TAIR\|locus:2089255		558	AT3G12950 [Arabidopsis thalian	0.882	0.939	0.656	1.8e-181

TAIR\|locus:2155317 AT5G45030 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1852 (657.0 bits), Expect = 4.1e-191, P = 4.1e-191
 Identities = 387/615 (62%), Positives = 464/615 (75%)

Query:     1 MDRTRLNIRARCSGSTPSEESA-LDFERNCCSHPNLPSLSPPTLQPFASAGQHCESNAA- 58
             M+  RL++R   S S+ S ESA LD ++N  +H  L S SP  LQPF S  QH E++AA 
Sbjct:     1 MEGKRLDLRFHHSTSSQSVESAALDLDKNVYNHIKLASSSP--LQPFPSGAQHPETSAAA 58

Query:    59 -YFSWPTSSRLSDAAEERANYFANLQKGVLPETLGQLPKGQQATTLLELMTIRAFHSKIL 117
              YFSWPTSSRL+D+AE+RANYFANLQKGVLPE+   LP G++ATTLLELM IRAFHSK L
Sbjct:    59 AYFSWPTSSRLNDSAEDRANYFANLQKGVLPESFDGLPTGKKATTLLELMMIRAFHSKNL 118

Query:   118 RCYSLGTAIGFRIKRGVLTDIPAILVFVSRKVHKQWLSPIQCLPTALEGPGGVWCDVDVV 177
             R +SLGTAIGFRI+RGVLT+I AILVFV+RKVHKQWL+P+QCLPTALEGPGGVWCDVDVV
Sbjct:   119 RRFSLGTAIGFRIRRGVLTNIAAILVFVARKVHKQWLNPLQCLPTALEGPGGVWCDVDVV 178

Query:   178 EFSYFGAPEPTPKEQLYTQIVDDLRGGDPSIGSGSQVASQETYGTLGAIVKSQTGSRQVG 237
             EF Y+GAP  TPKEQ+YT++VDDLRG   SIGSGSQVASQETYGTLGAIVKS+TG RQVG
Sbjct:   179 EFQYYGAPAQTPKEQVYTELVDDLRGSGSSIGSGSQVASQETYGTLGAIVKSKTGIRQVG 238

Query:   238 FLTNRHVAVDLDYPNQKMFHPLPPTLGPGVYLGAVERATSF----------HHRRPLTFV 287
             FLTNRHVAVDLDYP+QKMFHPLPP+LGPGVYLGAVERATSF              P TFV
Sbjct:   239 FLTNRHVAVDLDYPSQKMFHPLPPSLGPGVYLGAVERATSFITDDLWYGIFAGTNPETFV 298

Query:   288 RADGAFIPFADDFDMSTVTTSVKGLGEIGDVKIVDLQSPISSLIGKQVVKVGRSSGLTTG 347
             RADGAFIPFA+DF+ + VTT+VKG+GEIGD+   DLQSP++SLIG++VVKVGRSSGLTTG
Sbjct:   299 RADGAFIPFAEDFNTNNVTTTVKGIGEIGDIHATDLQSPVNSLIGRKVVKVGRSSGLTTG 358

Query:   348 TVLAYALEYNDEKGICFLTDFLVVGENQQTFDLEGDSGSLILMKG--ENGEKPRPIGIIW 405
             T++AYALEYNDEKGICFLTDFLVVGENQQTFDLEGDSGSLIL+    E  EKPRP+GIIW
Sbjct:   359 TIMAYALEYNDEKGICFLTDFLVVGENQQTFDLEGDSGSLILLAAGDEKNEKPRPVGIIW 418

Query:   406 GGTANRGRLKLKIGQPPENWTSGVDXXXXXXXXXXXXXXXXXXXKVAVQEQR-AASATAI 464
             GGTANRGRLKLK+G+ PENWTSGVD                   + AV EQR      A+
Sbjct:   419 GGTANRGRLKLKVGEQPENWTSGVDLGRVLNLLELDLITSNEGLQAAVLEQRNGIMCAAV 478

Query:   465 GSTVGDSSPPDGMHLKDKAEDKFEPLGLQIQHIPVEVEHHSPETNPSLMETEFHLEDGVK 524
              STV +SSP      + K  + FEP+ L +Q + +E ++       S +  EF +ED ++
Sbjct:   479 DSTVVESSPGVCNISRCKTGENFEPINLNVQQVLIEDDN-------SNIHPEFQIEDVLE 531

Query:   525 AGPSVEL-QFIPSFTGH-SPLHQN-NPSDKASSENLASL-WNGCDEDICFSLQLGDNEAK 580
             +   +E  QFIPS + + S LHQ  N  +   S+NL+SL  +   ++I FSLQLG+++ K
Sbjct:   532 SVAVIEEHQFIPSSSNNGSALHQKPNGPENLESKNLSSLKTSSSGDEIGFSLQLGESDTK 591

Query:   581 RR-RSDASTSKEESK 594
             +R R+D+    +E +
Sbjct:   592 KRKRTDSPDGSQEDE 606

GO:0003824 "catalytic activity" evidence=IEA

GO:0009507 "chloroplast" evidence=ISM

TAIR\|locus:505006292 AT2G35155 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2089255 AT3G12950 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	estExt_fgenesh4_pg.C_LG_XI1222	hypothetical protein (598 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		594
pfam08192		644	pfam08192, Peptidase_S64, Peptidase family S64	0.003

>gnl\|CDD\|219740 pfam08192, Peptidase_S64, Peptidase family S64	Back alignment and domain information

 Score = 40.1 bits (94), Expect = 0.003
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 332 GKQVVKVGRSSGLTTGTVLAYALEYNDEKGICFLTDFLVVGENQQTFDLEGDSGSLILMK 391
           G  V K G ++  T G +    L Y  +  I   ++F+V  E    F   GDSG+ IL K
Sbjct: 539 GLNVFKYGSTTKYTRGVLNGIKLVYWADGKI-QSSEFVVNSEPTPLFASGGDSGAWILTK 597

Query: 392 GENGEK 397
            E+   
Sbjct: 598 LEDNSL 603

This family of fungal proteins is involved in the processing of membrane bound transcription factor Stp1. The processing causes the signalling domain of Stp1 to be passed to the nucleus where several permease genes are induced. The permeases are important for uptake of amino acids, and processing of tp1 only occurs in an amino acid-rich environment. This family is predicted to be distantly related to the trypsin family (MEROPS:S1) and to have a typical trypsin-like catalytic triad. Length = 644

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		594
PF08192		695	Peptidase_S64: Peptidase family S64; InterPro: IPR	99.65
PRK10139		455	serine endoprotease; Provisional	98.35
TIGR02038		351	protease_degS periplasmic serine pepetdase DegS. T	98.27
PRK10942		473	serine endoprotease; Provisional	98.16
TIGR02037		428	degP_htrA_DO periplasmic serine protease, Do/DeqQ	98.15
PRK10898		353	serine endoprotease; Provisional	98.13
PF13365		120	Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8	97.44
COG0265		347	DegQ Trypsin-like serine proteases, typically peri	96.77
PF00089		220	Trypsin: Trypsin; InterPro: IPR001254 In the MEROP	96.7
KOG1421		955	consensus Predicted signaling-associated protein (	96.04
cd00190		232	Tryp_SPc Trypsin-like serine protease; Many of the	95.85
smart00020		229	Tryp_SPc Trypsin-like serine protease. Many of the	95.59
PF00944		158	Peptidase_S3: Alphavirus core protein ; InterPro:	95.5
COG3591		251	V8-like Glu-specific endopeptidase [Amino acid tra	94.31
PF00947		127	Pico_P2A: Picornavirus core protein 2A; InterPro:	91.44
PF00863		235	Peptidase_C4: Peptidase family C4 This family belo	89.6
PF05579		297	Peptidase_S32: Equine arteritis virus serine endop	87.34
PF10459		698	Peptidase_S46: Peptidase S46; InterPro: IPR019500	84.74
PF00949		132	Peptidase_S7: Peptidase S7, Flavivirus NS3 serine	80.82

>PF08192 Peptidase_S64: Peptidase family S64; InterPro: IPR012985 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

Probab=99.65  E-value=4.8e-16  Score=172.45  Aligned_cols=100  Identities=29%  Similarity=0.453  Sum_probs=84.0

Q ss_pred             cccCCCeEEEEeecccceEEEEEEEEEEEeCCCCeEEEEEEEEECCCCCCCCCCCCccceEEeeccC-CCCCceEEEEEe
Q 040739          328 SSLIGKQVVKVGRSSGLTTGTVLAYALEYNDEKGICFLTDFLVVGENQQTFDLEGDSGSLILMKGEN-GEKPRPIGIIWG  406 (594)
Q Consensus       328 ~p~lG~~V~KvGRTTGlT~G~Itai~V~y~~~~G~~~f~dqIVt~~~g~~FS~~GDSGSlVl~~~~~-d~~~~aVGLlfG  406 (594)
                      ....|+.|+|+|||||+|+|+|+++++.|+.+ |...+.+++|.+.+...|+.+|||||+|+...++ ...-.+|||+++
T Consensus       586 ~~~~G~~VfK~GrTTgyT~G~lNg~klvyw~d-G~i~s~efvV~s~~~~~Fa~~GDSGS~VLtk~~d~~~gLgvvGMlhs  664 (695)
T PF08192_consen  586 NLVPGMEVFKVGRTTGYTTGILNGIKLVYWAD-GKIQSSEFVVSSDNNPAFASGGDSGSWVLTKLEDNNKGLGVVGMLHS  664 (695)
T ss_pred             ccCCCCeEEEecccCCccceEecceEEEEecC-CCeEEEEEEEecCCCccccCCCCcccEEEecccccccCceeeEEeee
Confidence            45679999999999999999999999888876 5566789999986678899999999999964444 334569999999


Q ss_pred             cCCCCCccccccCCCCCcceEeechHHHHhhcC
Q 040739          407 GTANRGRLKLKIGQPPENWTSGVDLGRLLNLLE  439 (594)
Q Consensus       407 Gs~~~g~~~~~~~~~p~~~Tl~~pI~~VL~~L~  439 (594)
                      .++..           ..|.+|+||..+|+.|+
T Consensus       665 ydge~-----------kqfglftPi~~il~rl~  686 (695)
T PF08192_consen  665 YDGEQ-----------KQFGLFTPINEILDRLE  686 (695)
T ss_pred             cCCcc-----------ceeeccCcHHHHHHHHH
Confidence            87544           68999999999999874

Clans are groups of families for which there is evidence of common ancestry based on a common structural fold: Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases. In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding. Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This family of fungal proteins is involved in the processing of membrane bound transcription factor Stp1 [] and belongs to MEROPS petidase family S64 (clan PA). The processing causes the signalling domain of Stp1 to be passed to the nucleus where several permease genes are induced. The permeases are important for uptake of amino acids, and processing of tp1 only occurs in an amino acid-rich environment. This family is predicted to be distantly related to the trypsin family (MEROPS peptidase family S1) and to have a typical trypsin-like catalytic triad [].

>PRK10139 serine endoprotease; Provisional	Back alignment and domain information

>TIGR02038 protease_degS periplasmic serine pepetdase DegS	Back alignment and domain information

>PRK10942 serine endoprotease; Provisional	Back alignment and domain information

>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family	Back alignment and domain information

>PRK10898 serine endoprotease; Provisional	Back alignment and domain information

>PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A	Back alignment and domain information

>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only]	Back alignment and domain information

>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms	Back alignment and domain information

>smart00020 Tryp_SPc Trypsin-like serine protease	Back alignment and domain information

>PF00944 Peptidase_S3: Alphavirus core protein ; InterPro: IPR000930 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism]	Back alignment and domain information

>PF00947 Pico_P2A: Picornavirus core protein 2A; InterPro: IPR000081 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification	Back alignment and domain information

>PF05579 Peptidase_S32: Equine arteritis virus serine endopeptidase S32; InterPro: IPR008760 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PF00949 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine protease ; InterPro: IPR001850 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		594
2qa9_E		185	Streptogrisin-B; chymotrypsin-type serine peptidas	6e-10
1hpg_A		187	Glutamic acid specific protease; serine protease,	2e-09
2sga_A		181	Proteinase A; hydrolase (serine proteinase); 1.50A	6e-09
2oua_A		188	Serine protease, protein NAPA; kinetic stability,	1e-08
2h5c_A		198	Alpha-lytic protease; serine protease, acylation t	3e-08
2ea3_A		189	Chymotrypsin; celloulomonas, protease, hydrolase;	5e-08
2pfe_A		186	Protease A, alkaline serine protease, TFPA; beta-b	6e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-05

>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Length = 185	Back alignment and structure

 Score = 57.9 bits (140), Expect = 6e-10
 Identities = 38/213 (17%), Positives = 62/213 (29%), Gaps = 51/213 (23%)

Query: 201 LRGGDPSIGSGSQVASQETYGTLGAIVKSQTGSRQVGFLTNRHVAVDLDYPNQKMFHPLP 260
           + GGD    S           +LG  V          FLT  H                 
Sbjct: 1   ISGGDAIYSSTG-------RCSLGFNV---RSGSTYYFLTAGHCTDGATT--------WW 42

Query: 261 PTLGPGVYLGAVERATSFHHRRPLTFVRADGAFIPFADDFDMSTVTTSVKGLGEIGDVKI 320
                   LG    ++         F   D   + + +        T++   G +G   I
Sbjct: 43  ANSARTTVLGTTSGSS---------FPNNDYGIVRYTN--------TTIPKDGTVGGQDI 85

Query: 321 VDLQSPISSLIGKQVVKVGRSSGLTTGTVLAYALEYNDEKGICFLTDFLVVGENQQT-FD 379
               +     +G  V + G ++G  +G+V A          + +    +V G  +     
Sbjct: 86  TSAANAT---VGMAVTRRGSTTGTHSGSVTAL------NATVNYGGGDVVYGMIRTNVCA 136

Query: 380 LEGDSGSLILMKGENGEKPRPIGIIWGGTANRG 412
             GDSG  +          R IG+  GG+ N  
Sbjct: 137 EPGDSGGPLYSGT------RAIGLTSGGSGNCS 163

PyMOL of 2qa9

>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Length = 187	Back alignment and structure

>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Length = 181	Back alignment and structure

>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Length = 188	Back alignment and structure

>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Length = 198	Back alignment and structure

>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Length = 189	Back alignment and structure

>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Length = 186	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		594
2h5c_A		198	Alpha-lytic protease; serine protease, acylation t	99.88
2pfe_A		186	Protease A, alkaline serine protease, TFPA; beta-b	99.84
1hpg_A		187	Glutamic acid specific protease; serine protease,	99.83
2oua_A		188	Serine protease, protein NAPA; kinetic stability,	99.83
2sga_A		181	Proteinase A; hydrolase (serine proteinase); 1.50A	99.77
2ea3_A		189	Chymotrypsin; celloulomonas, protease, hydrolase;	99.72
2qa9_E		185	Streptogrisin-B; chymotrypsin-type serine peptidas	99.64
1l1j_A		239	Heat shock protease HTRA; hydrolase, serine protei	98.8
3k6y_A		237	Serine protease, possible membrane-associated seri	98.68
3tjo_A		231	Serine protease HTRA1; peptidase, hydrolase; HET:	98.56
3qo6_A		348	Protease DO-like 1, chloroplastic; protease, HTRA,	98.55
3sti_A		245	Protease DEGQ; serine protease, PDZ domain, chaper	98.55
3lgi_A		237	Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro	98.54
1y8t_A		324	Hypothetical protein RV0983; serine protease, stru	98.5
4fln_A		539	Protease DO-like 2, chloroplastic; protease, DEG,	98.5
4a8c_A		436	Periplasmic PH-dependent serine endoprotease DEGQ;	98.43
3stj_A		345	Protease DEGQ; serine protease, PDZ domain, protea	98.37
3num_A		332	Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom	98.35
1te0_A		318	Protease DEGS; two domains, serine protease, PDZ,	98.31
3pv2_A		451	DEGQ; trypsin fold, PDZ domain, chaperone protease	98.21
1lcy_A		325	HTRA2 serine protease; apoptosis, PDZ domain, casp	98.19
1ky9_A		448	Protease DO, DEGP, HTRA; protein quality control,	98.14
2as9_A		210	Serine protease; trypsin-like fold, hydrolase; 1.7	98.13
2w7s_A		200	Serine protease SPLA; hydrolase, family S1; 1.80A	97.95
2o8l_A		274	V8 protease, taphylococcal serine; serine protease	97.95
1wcz_A		268	Glutamyl endopeptidase; virulence factor, hydrolas	97.77
1agj_A		242	Epidermolytic toxin A; hydrolase, serine protease;	97.75
2vid_A		204	Serine protease SPLB; hydrolase; 1.80A {Staphyloco	97.7
2w5e_A		163	Putative serine protease; coiled coil, transmembra	97.67
1qtf_A		246	Exfoliative toxin B; serine protease, superantigen	97.49
1zyo_A		191	Serine protease; beta-barrel, glutamyl endopeptida	97.4
1mbm_A		198	NSP4 proteinase, chymotrypsin-like serine protease	97.06
3s9c_A		234	Vipera russelli proteinase RVV-V gamma; serine pro	96.45
1ao5_A		237	Glandular kallikrein-13; serine protease, protein	96.3
4e7n_A		238	Snake-venom thrombin-like enzyme; beta-barrel, hyd	96.18
3s69_A		234	Thrombin-like enzyme defibrase; beta-barrel, serin	96.16
1npm_A		225	Neuropsin; serine proteinase, glycoprotein; HET: N	96.12
2zch_P		237	Prostate-specific antigen; human PSA, kallikrein r	96.08
1gvz_A		237	Kallikrein-1E2; antigen, prostate specific antigen	96.06
2psx_A		227	Kallikrein-5; zinc inhibition, stratum corneum, gl	95.99
4ag1_A		226	Chymase; hydrolase-de novo protein complex, inhibi	95.93
2aiq_A		231	Protein C activator; snake venom serine proteinase	95.87
2bdg_A		223	Kallikrein-4; serine proteinase, S1 subsite, 70-80	95.77
1ton_A		235	Tonin; hydrolase(serine proteinase); 1.80A {Rattus	95.72
1fuj_A		221	PR3, myeloblastin; hydrolase, serine protease, gly	95.69
1a7s_A		225	Heparin binding protein; serine protease homolog,	95.67
4i8h_A		223	Cationic trypsin, beta-trypsin; serine protease, h	95.62
1sgf_A		240	7S NGF, nerve growth factor; growth factor (beta-N	95.58
3gov_B		251	MAsp-1; complement, serine protease, beta barrel,	95.51
1hj8_A		222	Trypsin I; hydrolase, radiation damage, disulphide	95.48
1spj_A		238	Kallikrein 1; serine protease, KLK1, HK1, hydrolas	95.48
3rp2_A		224	RAT MAST cell protease II; serine proteinase; 1.90	95.47
1eq9_A		222	Chymotrypsin; FIRE ANT, serine proteinase, hydrola	95.39
2any_A		241	Kininogenin, plasma kallikrein, light chain, fletc	95.36
3mfj_A		223	Cationic trypsin; serine proteinase, hydrolase; 0.	95.35
1lo6_A		223	Kallikrein 6, HK6; serine protease, human kallikre	95.25
3mmg_A		241	Nuclear inclusion protein A; 3C-type protease, TEV	95.23
3gyl_B		261	Prostasin; ENAC, zymogen, divalent cation, channel	95.21
2z7f_E		218	Leukocyte elastase; serine protease, serine protea	95.18
1fxy_A		228	Coagulation factor XA-trypsin chimera; protease, c	95.15
1mza_A		240	Pro-granzyme K; apoptosis, serine protease, S1 fam	95.08
4dgj_A		235	Enteropeptidase catalytic light chain; serine prot	95.02
2qxi_A		224	Kallikrein-7; S1 pocket, chloromethyl ketone, alte	94.98
3fzz_A		227	Granzyme C; hydrolase, cytolysis, protease, serine	94.94
3tvj_B		242	Mannan-binding lectin serine protease 2 B chain; i	94.79
1pq7_A		224	Trypsin; ultra-high resolution, catalysis, hydrola	94.67
3f1s_B		283	Vitamin K-dependent protein Z; PZ, ZPI, complex, s	94.59
3ncl_A		241	Suppressor of tumorigenicity 14 protein; proteinas	94.55
2xw9_A		228	Complement factor D; immune system, hydrolase, ser	94.5
2zgc_A		240	Granzyme M; serine protease, cytolysis, glycoprote	94.41
1euf_A		227	Duodenase; serine protease, dual specificity, hydr	94.4
3h7o_A		228	Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8	94.36
2f91_A		237	Hepatopancreas trypsin; trypsin, canonical inhibit	94.28
2r0l_A		248	Hepatocyte growth factor activator; serine proteas	94.21
1fiw_A		290	Beta-acrosin heavy chain; anti-parallel beta-barre	94.21
3mhw_U		247	Urokinase-type plasminogen activator; hydrolase, b	94.18
3h7t_A		235	Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0	94.16
2oq5_A		232	Transmembrane protease, serine 11E; type II trans-	94.11
1iau_A		227	Granzyme B; hydrolase-hydrolase inhibitor complex;	94.1
1cgh_A		224	Cathepsin G; inflammation, specificity, serine pro	93.93
3beu_A		224	Trypsin, SGT; beta sheets, serine protease, hydrol	93.92
1si5_H		240	Scatter factor, hepatocyte growth factor, SF, hepa	93.91
2asu_B		234	Hepatocyte growth factor-like protein; serine prot	93.9
1azz_A		226	Collagenase; complex (serine protease/inhibitor),	93.87
2jde_A		276	Urokinase-type plasminogen activator; plasminogen	93.81
1t8o_A		245	Chymotrypsin A; chymotrypsin, serine proteinase, B	93.76
3bg8_A		238	Coagulation factor XIA light chain; protease inhib	93.65
1bru_P		241	Elastase, PPE; serine protease, hydrolase; HET: 1N	93.49
1yc0_A		283	Hepatocyte growth factor activator; hydrolase/inhi	93.3
3h5c_B		317	Vitamin K-dependent protein Z; protein Z-protein Z	93.28
1ym0_A		238	Fibrinotic enzyme component B; two chains, glycosy	93.09
1aut_C		250	Activated protein C; serine proteinase, plasma cal	92.98
1elt_A		236	Elastase; serine proteinase; 1.61A {Salmo salar} S	92.85
1orf_A		234	Granzyme A; hydrolase-hydrolase inhibitor complex;	92.84
1ddj_A		247	Plasminogen; catalytic domain, blood clotting; 2.0	92.53
1fon_A		240	Procarboxypeptidase A-S6; truncated zymogen E, ser	92.41
1vcp_A		149	Semliki forest virus capsid protein; virus coat pr	92.37
1gvk_B		240	Elastase 1, peptide inhibitor; hydrolase, serine p	92.32
1svp_A		161	Sindbis virus capsid protein; chymotrypsin-like se	92.21
1md8_A		329	C1R complement serine protease; innate immunity, a	92.08
1ep5_B		157	Capsid protein C, coat protein C; beta barrel, hyd	91.99
2yew_A		253	Capsid protein, coat protein; alphavirus, molecula	91.95
2hlc_A		230	Collagenase; serine protease, hydrolase, collagen	91.89
2vnt_A		276	Urokinase-type plasminogen activator; UPA, inhibit	91.84
2f9n_A		245	Alpha I tryptase; serine proteinase, trypsin-like,	91.77
1lvm_A		229	Catalytic domain of the nuclear inclusion protein	91.69
1elv_A		333	Complement C1S component; trypsin-like serin prote	91.54
1pyt_D		251	TC, PCPA-TC, chymotrypsinogen C; ternary complex (	91.48
2jkh_A		241	Activated factor XA heavy chain; plasma, calcium,	91.47
1zjk_A		403	Mannan-binding lectin serine protease 2; beta barr	91.38
1kxf_A		264	Sindbis virus capsid protein; chymotrypsin-like se	91.18
1m9u_A		241	Earthworm fibrinolytic enzyme; hydrolase, serine p	90.48
1rtf_B		252	(TC)-T-PA, two chain tissue plasminogen activator;	90.34
1gpz_A		399	Complement C1R component; hydrolase, activation, i	90.24
4agk_A		158	Capsid protein, coat protein, C; hydrolase, viral	89.75
4dur_A		791	Plasminogen, serine protease; fibrinolysis, hydrol	89.69
2wph_S		235	Coagulation factor IXA heavy chain; serine proteas	89.65
2bz6_H		254	Blood coagulation factor VIIA; serine protease, en	89.32
3fan_A		213	Non-structural protein; chymotrypsin-like, N-termi	88.72
1z8g_A		372	Serine protease hepsin; serine protease hepsin, pr	88.2
2pka_B		152	Kallikrein A; serine proteinase; 2.05A {Sus scrofa	83.64
2b9l_A		394	Prophenoloxidase activating factor; CLIP domain, e	82.8
2xrc_A		565	Human complement factor I; immune system, hydrolas	82.68
2xxl_A		408	GRAM-positive specific serine protease, isoform B;	81.97

>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ...	Back alignment and structure

Probab=99.88  E-value=2.6e-22  Score=193.98  Aligned_cols=178  Identities=22%  Similarity=0.287  Sum_probs=128.3

Q ss_pred             ceeeeEEEEEeCCCCceeEEEecCceeccCCCCCCCCCCCCCCcccccccCCCccccccccccC-CCccccccccccccc
Q 040739          219 TYGTLGAIVKSQTGSRQVGFLTNRHVAVDLDYPNQKMFHPLPPTLGPGVYLGAVERATSFHHRR-PLTFVRADGAFIPFA  297 (594)
Q Consensus       219 taGTLGclVtD~~G~~~~yiLTNnHVla~~n~~~~~~~~pgdpILQPg~~DGG~~rd~~FIp~~-p~N~VDaD~AIi~va  297 (594)
                      ..||+||+|+++   +..|||||+||.....           ++.    .|+  ....+++... |.+    |+|++++.
T Consensus        15 ~~CT~Gf~v~~~---~~~~ilTa~Hc~~~~~-----------~v~----~~~--~~~g~vv~~~~~~~----D~Avi~i~   70 (198)
T 2h5c_A           15 SLCSVGFSVTRG---ATKGFVTAGHCGTVNA-----------TAR----IGG--AVVGTFAARVFPGN----DRAWVSLT   70 (198)
T ss_dssp             EEEECCEEEEET---TEEEEEECGGGCCTTC-----------EEE----ETT--EEEEEEEEEECSBS----CEEEEEEC
T ss_pred             CCCCcCEEEecC---CeeEEEECcccCCCCC-----------EEE----eCC--cEEEEEEecCCCCC----CEEEEEeC
Confidence            589999999986   4789999999987622           333    222  1113444433 555    66999986


Q ss_pred             cCCCCCccccccccccccCcceeecccCcccccCCCeEEEEeecccceEEEEEEEEEEEeCCCCeEEEEEEEEECCCCCC
Q 040739          298 DDFDMSTVTTSVKGLGEIGDVKIVDLQSPISSLIGKQVVKVGRSSGLTTGTVLAYALEYNDEKGICFLTDFLVVGENQQT  377 (594)
Q Consensus       298 ~~~d~s~vs~~I~~lG~IG~vk~vdl~g~~~p~lG~~V~KvGRTTGlT~G~Itai~V~y~~~~G~~~f~dqIVt~~~g~~  377 (594)
                      ...   ...+.|..   .|.  .+.+.+...+.+|+.|+|+|++||+|+|+|.+++....+..|  .|++++.+..    
T Consensus        71 ~~~---~~~~~v~~---~g~--~~~v~g~~~~~vG~~V~~~G~~tg~t~G~V~~~~~~~~~~~g--~~~~~i~t~~----  136 (198)
T 2h5c_A           71 SAQ---TLLPRVAN---GSS--FVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEG--AVRGLTQGNA----  136 (198)
T ss_dssp             TTS---EEEEEEEE---TTE--EEECCBCCCCCTTCEEEEEETTTEEEEEEEEEEEEEEEETTE--EEEEEEEECS----
T ss_pred             CCC---ccCceEec---CCc--eEEecCcccCCCCCeEEEeecCcceEEEEEEeeeeEEEeCCC--eEeeeEEecc----
Confidence            432   22344543   121  123456678999999999999999999999999854443334  3789999887    


Q ss_pred             CCCCCCccceEEeeccCCCCCceEEEEEecC-----CCCCccccccCCCCCcceEeechHHHHhhcCCeEEcC
Q 040739          378 FDLEGDSGSLILMKGENGEKPRPIGIIWGGT-----ANRGRLKLKIGQPPENWTSGVDLGRLLNLLELDLITT  445 (594)
Q Consensus       378 FS~~GDSGSlVl~~~~~d~~~~aVGLlfGGs-----~~~g~~~~~~~~~p~~~Tl~~pI~~VL~~L~V~Lvt~  445 (594)
                      ++.+||||++|+     +.++++|||++++.     .+|+      +...++.+||+||..+|++|+|+|+|.
T Consensus       137 ~~~~GDSGGPl~-----~~~g~~vGI~s~~~~~~~~~~c~------~~~~~g~~f~~Pi~~vl~~~gv~l~t~  198 (198)
T 2h5c_A          137 CMGRGDSGGSWI-----TSAGQAQGVMSGGNVQSNGNNCG------IPASQRSSLFERLQPILSQYGLSLVTG  198 (198)
T ss_dssp             CCBTTCTTCEEE-----CTTCBEEEEEEEECCCTTSBSTT------SCGGGCCEEEEEHHHHHHHHTCEECCC
T ss_pred             cCCCCcceeEEE-----eeCCEEEEEEEeecCccCCCccc------cccCCceEEEEEHHHHHHHCCcEEecC
Confidence            899999999999     77889999999986     3220      001145799999999999999999984

PyMOL of 2h5c

>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca}	Back alignment and structure

>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1	Back alignment and structure

>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba}	Back alignment and structure

>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A	Back alignment and structure

>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis}	Back alignment and structure

>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ...	Back alignment and structure

>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1	Back alignment and structure

>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A	Back alignment and structure

>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A	Back alignment and structure

>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana}	Back alignment and structure

>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli}	Back alignment and structure

>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A	Back alignment and structure

>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A	Back alignment and structure

>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana}	Back alignment and structure

>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A	Back alignment and structure

>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli}	Back alignment and structure

>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A	Back alignment and structure

>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A	Back alignment and structure

>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A	Back alignment and structure

>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1	Back alignment and structure

>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A	Back alignment and structure

>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus}	Back alignment and structure

>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A	Back alignment and structure

>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A	Back alignment and structure

>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1	Back alignment and structure

>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A	Back alignment and structure

>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus}	Back alignment and structure

>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1}	Back alignment and structure

>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A	Back alignment and structure

>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus}	Back alignment and structure

>1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3	Back alignment and structure

>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A*	Back alignment and structure

>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G*	Back alignment and structure

>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys}	Back alignment and structure

>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A*	Back alignment and structure

>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2	Back alignment and structure

>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P*	Back alignment and structure

>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2	Back alignment and structure

>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A*	Back alignment and structure

>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A	Back alignment and structure

>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A*	Back alignment and structure

>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A*	Back alignment and structure

>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2	Back alignment and structure

>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2	Back alignment and structure

>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A*	Back alignment and structure

>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ...	Back alignment and structure

>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2	Back alignment and structure

>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B	Back alignment and structure

>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A	Back alignment and structure

>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens}	Back alignment and structure

>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2	Back alignment and structure

>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2	Back alignment and structure

>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A*	Back alignment and structure

>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ...	Back alignment and structure

>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A*	Back alignment and structure

>3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0	Back alignment and structure

>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A*	Back alignment and structure

>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A*	Back alignment and structure

>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2	Back alignment and structure

>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A	Back alignment and structure

>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B	Back alignment and structure

>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A	Back alignment and structure

>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A	Back alignment and structure

>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H*	Back alignment and structure

>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A*	Back alignment and structure

>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens}	Back alignment and structure

>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A*	Back alignment and structure

>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A	Back alignment and structure

>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A	Back alignment and structure

>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2	Back alignment and structure

>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0	Back alignment and structure

>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2	Back alignment and structure

>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A*	Back alignment and structure

>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A*	Back alignment and structure

>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ...	Back alignment and structure

>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis}	Back alignment and structure

>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens}	Back alignment and structure

>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A	Back alignment and structure

>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A*	Back alignment and structure

>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A	Back alignment and structure

>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A	Back alignment and structure

>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens}	Back alignment and structure

>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2	Back alignment and structure

>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ...	Back alignment and structure

>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ...	Back alignment and structure

>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2	Back alignment and structure

>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A	Back alignment and structure

>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens}	Back alignment and structure

>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida}	Back alignment and structure

>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H*	Back alignment and structure

>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2	Back alignment and structure

>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A	Back alignment and structure

>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A	Back alignment and structure

>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C	Back alignment and structure

>1vcp_A Semliki forest virus capsid protein; virus coat protein, polyprotein, transmembrane, glycoprotein, nucleocapsid protein, viral protein; 3.00A {Semliki forest virus} SCOP: b.47.1.3 PDB: 1dyl_A 1vcq_A	Back alignment and structure

>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ...	Back alignment and structure

>1svp_A Sindbis virus capsid protein; chymotrypsin-like serine, mutant, coat protein, viral protein; 2.00A {Sindbis virus} SCOP: b.47.1.3 PDB: 1kxb_A 1kxa_A 2snw_A 1kxc_A 1kxd_A 1kxe_A 2snv_A 1z8y_Q 1wyk_A	Back alignment and structure

>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A*	Back alignment and structure

>1ep5_B Capsid protein C, coat protein C; beta barrel, hydrolase; 2.30A {Venezuelan equine encephalitis virus} SCOP: b.47.1.3 PDB: 1ep6_A 3j0c_C	Back alignment and structure

>2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus}	Back alignment and structure

>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A	Back alignment and structure

>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens}	Back alignment and structure

>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A*	Back alignment and structure

>1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A	Back alignment and structure

>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1	Back alignment and structure

>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2	Back alignment and structure

>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ...	Back alignment and structure

>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A	Back alignment and structure

>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A	Back alignment and structure

>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2	Back alignment and structure

>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A*	Back alignment and structure

>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1	Back alignment and structure

>4agk_A Capsid protein, coat protein, C; hydrolase, viral protein; 1.81A {Aura virus} PDB: 4agj_A 1kxa_A 2snw_A 1svp_A 1kxb_A 1kxc_A 1kxd_A 1kxe_A 2snv_A 1z8y_Q 1wyk_A	Back alignment and structure

>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A	Back alignment and structure

>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C*	Back alignment and structure

>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ...	Back alignment and structure

>3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A	Back alignment and structure

>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A*	Back alignment and structure

>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B	Back alignment and structure

>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia}	Back alignment and structure

>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens}	Back alignment and structure

>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		594
d2qaaa1		185	Protease B {Streptomyces griseus, strain k1 [TaxId	99.84
d2sgaa_		181	Protease A {Streptomyces griseus, strain k1 [TaxId	99.81
d2h5ca1		198	alpha-Lytic protease {Lysobacter enzymogenes, 495	99.71
d1hpga_		187	Glutamic acid-specific protease {Streptomyces gris	99.56
d1l1ja_		228	Protease Do (DegP, HtrA), catalytic domain {Thermo	98.56
d2z9ia2		221	Protease PepD {Mycobacterium tuberculosis [TaxId:	98.48
d1lcya2		205	Mitochondrial serine protease HtrA2, catalytic dom	98.43
d1agja_		242	Epidermolytic (exfoliative) toxin A {Staphylococcu	98.41
d2o8la1		216	V8 protease {Staphylococcus aureus [TaxId: 1280]}	98.3
d1ky9a2		249	Protease Do (DegP, HtrA), catalytic domain {Escher	98.26
d2qf3a1		210	Stress sensor protease DegS, catalytic domain {Esc	98.24
d1lvmb_		219	TEV protease (nucleat inclusion protein A, NIA) {T	98.02
d1qtfa_		246	Exfoliative toxin B {Staphylococcus aureus [TaxId:	97.9
d2bhga1		199	3C cysteine protease (picornain 3C) {Foot-and-mout	97.86
d1p3ca_		215	Glutamyl endopeptidase {Bacillus intermedius [TaxI	97.38
d1arba_		263	Achromobacter protease {Achromobacter lyticus, str	96.35
d1hj8a_		222	Trypsin(ogen) {North atlantic salmon (Salmo salar)	96.33
g2pka.1		232	Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]}	96.22
d1nn6a_		224	Chymase (mast cell protease I) {Human (Homo sapien	96.19
d1gvza_		237	Prostate specific antigen (PSA kallikrein) {Horse	96.12
d1op0a_		234	Venom serine protease {Hundred-pace snake (Agkistr	96.03
d2z7fe1		218	Elastase {Human (Homo sapiens) [TaxId: 9606]}	95.75
d1npma_		225	Neuropsin {Mouse (Mus musculus) [TaxId: 10090]}	95.73
d1j16a_		223	Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101	95.69
d1q3xa1		242	Mannan-binding lectin serine protease 2 (MASP-2),	95.62
g1fiw.1		274	Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]}	95.58
d1fuja_		221	Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96	95.57
d1ao5a_		237	Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]	95.55
d1tona_		235	Tonin {Rat (Rattus rattus) [TaxId: 10117]}	95.5
d1bioa_		228	Factor D {Human (Homo sapiens) [TaxId: 9606]}	95.5
d1gdna_		224	Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5	95.44
d1eufa_		224	Duodenase {Cow (Bos taurus) [TaxId: 9913]}	95.32
d1lo6a_		221	Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]}	95.26
d1a7sa_		225	Heparin binding protein, HBP {Human (Homo sapiens)	95.1
d1sgfa_		228	7S NGF protease subunits {Mouse (Mus musculus) [Ta	94.96
d1orfa_		232	Granzyme A {Human (Homo sapiens) [TaxId: 9606]}	94.96
d1fi8a_		227	Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]	94.88
d2f91a1		237	Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus	94.86
d2bz6h1		254	Coagulation factor VIIa {Human (Homo sapiens) [Tax	94.72
d1brup_		241	Elastase {Pig (Sus scrofa) [TaxId: 9823]}	94.62
d2qy0b1		240	Complement C1R protease, catalytic domain {Human (	94.47
d1eq9a_		222	(alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So	94.35
d1z8ga1		255	Hepsin, catalytic domain {Human (Homo sapiens) [Ta	94.29
d1xx9a_		237	Coagulation factor XI {Human (Homo sapiens) [TaxId	94.16
d1rfna_		235	Coagulation factor IXa, protease domain {Human (Ho	94.1
d1fq3a_		227	Granzyme B {Human (Homo sapiens) [TaxId: 9606]}	94.05
d1ekbb_		235	Enteropeptidase (enterokinase light chain) {Cow (B	94.04
d1fxya_		228	Coagulation factor Xa-trypsin chimera {Synthetic,	93.88
d1hj9a_		223	Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}	93.76
d2fpza1		243	beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]}	93.76
d1mzaa_		240	Granzyme K {Human (Homo sapiens) [TaxId: 9606]}	93.71
d2hlca_		230	HL collagenase {Common cattle grub (Hypoderma line	93.47
d1azza_		226	Crab collagenase {Atlantic sand fiddler crab (Uca	93.38
d1pytd_		251	(alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)	93.37
d1autc_		240	Activated protein c (autoprothrombin IIa) {Human (	93.32
d1m9ua_		241	Elastase {Worm (Eisenia fetida) [TaxId: 6396]}	93.29
d1gvkb_		240	Elastase {Pig (Sus scrofa) [TaxId: 9823]}	93.27
d1eaxa_		241	Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960	93.2
d1si5h_		234	Hepatocyte growth factor, HGF {Human (Homo sapiens	93.18
d1t32a1		224	Cathepsin G {Human (Homo sapiens) [TaxId: 9606]}	93.14
d2p3ub1		233	Coagulation factor Xa, protease domain {Human (Hom	93.04
d1ep5a_		156	Viral capsid protein {Venezuelan equine encephalit	92.96
d1wyka_		152	Viral capsid protein {Sindbis virus [TaxId: 11034]	92.86
g1gg6.1		238	(alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)	92.86
d1fona_		232	Procarboxypeptidase A-S6 subunit III (zymogen E) {	92.62
g1h8d.1		289	Thrombin {Human (Homo sapiens) [TaxId: 9606]}	92.51
d1rjxb_		247	Plasmin(ogen), catalytic domain {Human (Homo sapie	92.5
d1vcpa_		149	Viral capsid protein {Semliki forest virus [TaxId:	92.35
g1rtf.1		260	Two-chain tissue plasminogen activator (TC)-T-PA {	91.94
d3rp2a_		224	Chymase II (mast cell proteinase II) {Rat (Rattus	91.59
g1gj7.1		256	Urokinase-type plasminogen activator (LMW U-PA), c	91.53
d1elta_		236	Elastase {Salmon (Salmo salar) [TaxId: 8030]}	91.48
d1os8a_		223	Trypsin {Streptomyces griseus, strain k1 [TaxId: 1	90.26
d1cqqa_		180	3C cysteine protease (picornain 3C) {Human rhinovi	90.19
d1elva1		259	Complement C1S protease, catalytic domain {Human (	89.07
d2h6ma1		212	3C cysteine protease (picornain 3C) {Human hepatit	80.25

>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]}	Back information, alignment and structure

class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Prokaryotic proteases
domain: Protease B
species: Streptomyces griseus, strain k1 [TaxId: 1911]

Probab=99.84  E-value=1.4e-20  Score=174.90  Aligned_cols=185  Identities=22%  Similarity=0.213  Sum_probs=126.2

Q ss_pred             CCCCCCccCCCcccCcccceeeeEEEEEeCCCCceeEEEecCceeccCCCCCCCCCCCCCCcccccccCCCccccccccc
Q 040739          201 LRGGDPSIGSGSQVASQETYGTLGAIVKSQTGSRQVGFLTNRHVAVDLDYPNQKMFHPLPPTLGPGVYLGAVERATSFHH  280 (594)
Q Consensus       201 v~GG~~SIGggs~~~~~~taGTLGclVtD~~G~~~~yiLTNnHVla~~n~~~~~~~~pgdpILQPg~~DGG~~rd~~FIp  280 (594)
                      |.||. .|.+      ....||+|+.|++.   ...|||||+||......+            .....++.. ......-
T Consensus         1 ~~gG~-~~~~------~~~~CT~Gf~v~~~---~~~~ilTA~Hcv~~~~~~------------~~~~~~~~~-~g~~~~~   57 (185)
T d2qaaa1           1 ISGGD-AIYS------STGRCSLGFNVRSG---STYYFLTAGHCTDGATTW------------WANSARTTV-LGTTSGS   57 (185)
T ss_dssp             CCBTC-EEEC------SSCEEECCEEEEET---TEEEEEECHHHHTTCCEE------------ESSTTSCSE-EEEEEEE
T ss_pred             CcCcc-ceeC------CCCcEeeeEeEEEC---CccEEEECCCccCCCCEE------------EEEcCCCeE-eeeEEec
Confidence            35775 6643      23579999999986   467999999998764421            111122220 0011111


Q ss_pred             cCCCccccccccccccccCCCCCccccccccccccCcceeecccCcccccCCCeEEEEeecccceEEEEEEEEEEEeCCC
Q 040739          281 RRPLTFVRADGAFIPFADDFDMSTVTTSVKGLGEIGDVKIVDLQSPISSLIGKQVVKVGRSSGLTTGTVLAYALEYNDEK  360 (594)
Q Consensus       281 ~~p~N~VDaD~AIi~va~~~d~s~vs~~I~~lG~IG~vk~vdl~g~~~p~lG~~V~KvGRTTGlT~G~Itai~V~y~~~~  360 (594)
                      ..|.+    |+||+++......     ....+      ....+.+...+.+|+.|+|.|++||+++|.|.+++..++...
T Consensus        58 ~~~~~----D~All~~~~~~~~-----~~~~~------~~~~v~~~~~~~~G~~v~~~G~~tg~~~g~v~~~~~~~~~~~  122 (185)
T d2qaaa1          58 SFPNN----DYGIVRYTNTTIP-----KDGTV------GGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGG  122 (185)
T ss_dssp             ECSBS----CEEEEEECCSSSC-----CCSEE------TTEECCEECCCCTTCEEEEEETTTEEEEEEEEEEEEEEECST
T ss_pred             cCCCC----CeEEEEeccCCcc-----ccccc------CceeccCCCcCCCCCEEEEccCCCCcccceeEeeEEEEEcCC
Confidence            22444    7799998643211     11111      112233456789999999999999999999999986666544


Q ss_pred             CeEEEEEEEEECCCCCCCCCCCCccceEEeeccCCCCCceEEEEEecCCCCCccccccCCCCCcceEeechHHHHhhcCC
Q 040739          361 GICFLTDFLVVGENQQTFDLEGDSGSLILMKGENGEKPRPIGIIWGGTANRGRLKLKIGQPPENWTSGVDLGRLLNLLEL  440 (594)
Q Consensus       361 G~~~f~dqIVt~~~g~~FS~~GDSGSlVl~~~~~d~~~~aVGLlfGGs~~~g~~~~~~~~~p~~~Tl~~pI~~VL~~L~V  440 (594)
                      + ..+.+++.++.    ++.+||||++||     + .+++|||++++....         ...+.+||.||..+|++|+|
T Consensus       123 ~-~~~~~~~~~~~----~~~~GdSGGPv~-----~-~~~~vGi~~~g~~~~---------~~~~~~~~~Pi~~~l~~~g~  182 (185)
T d2qaaa1         123 G-DVVYGMIRTNV----CAEPGDSGGPLY-----S-GTRAIGLTSGGSGNC---------SSGGTTFFQPVTEALSAYGV  182 (185)
T ss_dssp             T-CEEEEEEEESC----CCCTTCTTCEEE-----E-TTEEEEEEEEEEEET---------TTEEEEEEEEHHHHHHHHTC
T ss_pred             C-CeeeeEEEEee----eecCCcccceeE-----E-CCEEEEEEEEeecCC---------CCCceEEEEEHHHHHHHhCC
Confidence            4 34667888777    799999999999     4 579999999987543         12456899999999999999


Q ss_pred             eEE
Q 040739          441 DLI  443 (594)
Q Consensus       441 ~Lv  443 (594)
                      +|.
T Consensus       183 ~l~  185 (185)
T d2qaaa1         183 SVY  185 (185)
T ss_dssp             EEC
T ss_pred             eeC
Confidence            984

PyMOL of d2qaaa1

>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]}	Back information, alignment and structure

>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]}	Back information, alignment and structure

>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]}	Back information, alignment and structure

>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]}	Back information, alignment and structure

>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]}	Back information, alignment and structure

>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]}	Back information, alignment and structure

>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]}	Back information, alignment and structure

>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]}	Back information, alignment and structure

>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]}	Back information, alignment and structure

>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]}	Back information, alignment and structure

>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]}	Back information, alignment and structure

>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]}	Back information, alignment and structure

>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]}	Back information, alignment and structure

>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]}	Back information, alignment and structure

>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence}	Back information, alignment and structure

>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]}	Back information, alignment and structure

>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]}	Back information, alignment and structure

>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]}	Back information, alignment and structure

>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ep5a_ b.47.1.3 (A:) Viral capsid protein {Venezuelan equine encephalitis virus [TaxId: 11036]}	Back information, alignment and structure

>d1wyka_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus [TaxId: 11034]}	Back information, alignment and structure

>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vcpa_ b.47.1.3 (A:) Viral capsid protein {Semliki forest virus [TaxId: 11033]}	Back information, alignment and structure

>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]}	Back information, alignment and structure

>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]}	Back information, alignment and structure

>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]}	Back information, alignment and structure

>d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]}	Back information, alignment and structure

>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2h6ma1 b.47.1.4 (A:1-212) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]}	Back information, alignment and structure